{ "uniprot_canonical_ac": "O75694-1", "uniprot_ac": "O75694", "uniprot_id": "NU155_HUMAN", "mass": { "chemical_mass": 155199.0, "monoisotopic_mass": 155199.0 }, "refseq": { "ac": "NP_004289", "name": "nuclear pore complex protein Nup155 isoform 2", "summary": "Nucleoporins are proteins that play an important role in the assembly and functioning of the nuclear pore complex (NPC) which regulates the movement of macromolecules across the nuclear envelope (NE). The protein encoded by this gene plays a role in the fusion of NE vesicles and formation of the double membrane NE. The protein may also be involved in cardiac physiology and may be associated with the pathogenesis of atrial fibrillation. Alternative splicing results in multiple transcript variants of this gene. A pseudogene associated with this gene is located on chromosome 6. [provided by RefSeq, May 2013].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004289" }, "gene_names": [ { "name": "NUP155", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O75694", "id": "O75694" }, { "name": "ATFB15; N155", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004289", "id": "NP_004289" }, { "name": "KIAA0791", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O75694", "id": "O75694" }, { "name": "NUP155", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004289", "id": "NP_004289" } ], "protein_names": [ { "name": "Nuclear pore complex protein Nup155", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O75694" }, { "name": "155 kDa nucleoporin", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O75694" }, { "name": "Nucleoporin Nup155", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O75694" }, { "name": "nuclear pore complex protein Nup155 isoform 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004289", "id": "NP_004289" }, { "name": "nuclear pore complex protein Nup155; 155 kDa nucleoporin; nucleoporin 155kD; nucleoporin 155kDa", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004289", "id": "NP_004289" } ], "function": [ { "annotation": "Essential component of nuclear pore complex. Could be essessential for embryogenesis. Nucleoporins may be involved both in binding and translocating proteins during nucleocytoplasmic transport.", "evidence": [ { "database": "UniProtKB", "id": "O75694", "url": "https://www.uniprot.org/uniprot/O75694#function" }, { "database": "UniProtKB", "id": "Q99P88", "url": "https://www.uniprot.org/uniprot/Q99P88#function" } ] }, { "annotation": "Lamin A/C mutation p.Arg399Cys weakens the interaction between nuclear lamina (lamin A/C) and the nuclear pore complex (NUP155), leading to the development of atrial fibrillation.", "evidence": [ { "database": "RefSeq", "id": "NP_004289", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004289" }, { "database": "PubMed", "id": "30488537", "url": "https://glygen.org/publication/PubMed/30488537" } ] }, { "annotation": "Nucleoporins are proteins that play an important role in the assembly and functioning of the nuclear pore complex (NPC) which regulates the movement of macromolecules across the nuclear envelope (NE). The protein encoded by this gene plays a role in the fusion of NE vesicles and formation of the double membrane NE. The protein may also be involved in cardiac physiology and may be associated with the pathogenesis of atrial fibrillation. Alternative splicing results in multiple transcript variants of this gene. A pseudogene associated with this gene is located on chromosome 6. [provided by RefSeq, May 2013].", "evidence": [ { "database": "RefSeq", "id": "NP_004289", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004289" } ] }, { "annotation": "Study revealed that NUP155 controls mRNA translation CDKN1A, a key mediator of the p53 response. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_004289", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004289" }, { "database": "PubMed", "id": "31089132", "url": "https://glygen.org/publication/PubMed/31089132" } ] } ], "disease": [ { "disease_id": "DOID:0050650", "recommended_name": { "id": "DOID:0050650", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050650", "name": "familial atrial fibrillation", "description": "An atrial fibrillation that has_material_basis_in autosomal dominant inheritance of the familial atrial fibrillation (ATFB) genes." }, "synonyms": [ { "id": "DOID:0050650", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050650", "name": "ATFB", "description": "" }, { "id": "MONDO:0013544", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013544", "name": "atrial fibrillation, familial, 11", "description": "Any familial atrial fibrillation in which the cause of the disease is a mutation in the GJA5 gene." }, { "id": "MONDO:0013544", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013544", "name": "GJA5 familial atrial fibrillation", "description": "" }, { "id": "MONDO:0013544", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013544", "name": "atrial fibrillation, familial, 11", "description": "" }, { "id": "MONDO:0013544", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013544", "name": "atrial fibrillation, familial, type 11", "description": "" }, { "id": "MONDO:0013544", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013544", "name": "familial atrial fibrillation caused by mutation in GJA5", "description": "" }, { "id": "MONDO:0013544", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013544", "name": "ATFB11", "description": "" }, { "id": "MONDO:0013530", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013530", "name": "atrial fibrillation, familial, 10", "description": "Any familial atrial fibrillation in which the cause of the disease is a mutation in the SCN5A gene." }, { "id": "MONDO:0013530", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013530", "name": "SCN5A familial atrial fibrillation", "description": "" }, { "id": "MONDO:0013530", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013530", "name": "atrial fibrillation, familial, 10", "description": "" }, { "id": "MONDO:0013530", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013530", "name": "atrial fibrillation, familial, type 10", "description": "" }, { "id": "MONDO:0013530", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013530", "name": "familial atrial fibrillation caused by mutation in SCN5A", "description": "" }, { "id": "MONDO:0013530", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013530", "name": "ATFB10", "description": "" }, { "id": "MONDO:0014155", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014155", "name": "atrial fibrillation, familial, 13", "description": "Any familial atrial fibrillation in which the cause of the disease is a mutation in the SCN1B gene." }, { "id": "MONDO:0014155", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014155", "name": "SCN1B familial atrial fibrillation", "description": "" }, { "id": "MONDO:0014155", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014155", "name": "atrial fibrillation, familial, 13", "description": "" }, { "id": "MONDO:0014155", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014155", "name": "atrial fibrillation, familial, type 13", "description": "" }, { "id": "MONDO:0014155", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014155", "name": "familial atrial fibrillation caused by mutation in SCN1B", "description": "" }, { "id": "MONDO:0014155", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014155", "name": "ATFB13", "description": "" }, { "id": "MONDO:0014156", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014156", "name": "atrial fibrillation, familial, 14", "description": "Any familial atrial fibrillation in which the cause of the disease is a mutation in the SCN2B gene." }, { "id": "MONDO:0014156", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014156", "name": "SCN2B familial atrial fibrillation", "description": "" }, { "id": "MONDO:0014156", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014156", "name": "atrial fibrillation, familial, 14", "description": "" }, { "id": "MONDO:0014156", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014156", "name": "atrial fibrillation, familial, type 14", "description": "" }, { "id": "MONDO:0014156", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014156", "name": "familial atrial fibrillation caused by mutation in SCN2B", "description": "" }, { "id": "MONDO:0014156", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014156", "name": "ATFB14", "description": "" }, { "id": "MONDO:0012066", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012066", "name": "atrial fibrillation, familial, 1", "description": "" }, { "id": "MONDO:0012066", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012066", "name": "atrial fibrillation, autosomal dominant", "description": "" }, { "id": "MONDO:0012066", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012066", "name": "ATFB1", "description": "" }, { "id": "MONDO:0012066", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012066", "name": "atrial fibrillation, familial, 1", "description": "" }, { "id": "MONDO:0012167", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012167", "name": "atrial fibrillation, familial, 2", "description": "" }, { "id": "MONDO:0012167", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012167", "name": "ATFB2", "description": "" }, { "id": "MONDO:0012167", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012167", "name": "atrial fibrillation, familial, 2", "description": "" }, { "id": "MONDO:0011857", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011857", "name": "atrial fibrillation, familial, 3", "description": "Any familial atrial fibrillation in which the cause of the disease is a mutation in the KCNQ1 gene." }, { "id": "MONDO:0011857", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011857", "name": "KCNQ1 familial atrial fibrillation", "description": "" }, { "id": "MONDO:0011857", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011857", "name": "atrial fibrillation, familial, 3", "description": "" }, { "id": "MONDO:0011857", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011857", "name": "atrial fibrillation, familial, type 3", "description": "" }, { "id": "MONDO:0011857", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011857", "name": "familial atrial fibrillation caused by mutation in KCNQ1", "description": "" }, { "id": "MONDO:0011857", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011857", "name": "ATFB3", "description": "" }, { "id": "MONDO:0013545", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013545", "name": "atrial fibrillation, familial, 12", "description": "Any familial atrial fibrillation in which the cause of the disease is a mutation in the ABCC9 gene." }, { "id": "MONDO:0013545", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013545", "name": "ABCC9 familial atrial fibrillation", "description": "" }, { "id": "MONDO:0013545", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013545", "name": "atrial fibrillation, familial, 12", "description": "" }, { "id": "MONDO:0013545", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013545", "name": "atrial fibrillation, familial, type 12", "description": "" }, { "id": "MONDO:0013545", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013545", "name": "familial atrial fibrillation caused by mutation in ABCC9", "description": "" }, { "id": "MONDO:0013545", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013545", "name": "ATFB12", "description": "" }, { "id": "MONDO:0013100", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013100", "name": "atrial fibrillation, familial, 8", "description": "" }, { "id": "MONDO:0013100", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013100", "name": "ATFB8", "description": "" }, { "id": "MONDO:0013100", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013100", "name": "atrial fibrillation, familial, 8", "description": "" }, { "id": "MONDO:0012677", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012677", "name": "atrial fibrillation, familial, 4", "description": "Any familial atrial fibrillation in which the cause of the disease is a mutation in the KCNE2 gene." }, { "id": "MONDO:0012677", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012677", "name": "KCNE2 familial atrial fibrillation", "description": "" }, { "id": "MONDO:0012677", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012677", "name": "atrial fibrillation, familial, 4", "description": "" }, { "id": "MONDO:0012677", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012677", "name": "atrial fibrillation, familial, type 4", "description": "" }, { "id": "MONDO:0012677", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012677", "name": "familial atrial fibrillation caused by mutation in KCNE2", "description": "" }, { "id": "MONDO:0012677", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012677", "name": "ATFB4", "description": "" }, { "id": "MONDO:0012678", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012678", "name": "atrial fibrillation, familial, 5", "description": "" }, { "id": "MONDO:0012678", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012678", "name": "ATFB5", "description": "" }, { "id": "MONDO:0012678", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012678", "name": "atrial fibrillation, familial, 5", "description": "" }, { "id": "MONDO:0014340", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014340", "name": "atrial fibrillation, familial, 15", "description": "Any familial atrial fibrillation in which the cause of the disease is a mutation in the NUP155 gene." }, { "id": "MONDO:0014340", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014340", "name": "NUP155 familial atrial fibrillation", "description": "" }, { "id": "MONDO:0014340", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014340", "name": "atrial fibrillation 15", "description": "" }, { "id": "MONDO:0014340", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014340", "name": "atrial fibrillation, familial, 15", "description": "" }, { "id": "MONDO:0014340", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014340", "name": "atrial fibrillation, familial, type 15", "description": "" }, { "id": "MONDO:0014340", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014340", "name": "familial atrial fibrillation caused by mutation in NUP155", "description": "" }, { "id": "MONDO:0014340", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0014340", "name": "ATFB15", "description": "" }, { "id": "MONDO:0012816", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012816", "name": "atrial fibrillation, familial, 6", "description": "Any familial atrial fibrillation in which the cause of the disease is a mutation in the NPPA gene." }, { "id": "MONDO:0012816", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012816", "name": "NPPA familial atrial fibrillation", "description": "" }, { "id": "MONDO:0012816", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012816", "name": "atrial fibrillation, familial, 6", "description": "" }, { "id": "MONDO:0012816", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012816", "name": "atrial fibrillation, familial, type 6", "description": "" }, { "id": "MONDO:0012816", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012816", "name": "familial atrial fibrillation caused by mutation in NPPA", "description": "" }, { "id": "MONDO:0012816", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012816", "name": "ATFB6", "description": "" }, { "id": "MONDO:0012828", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012828", "name": "atrial fibrillation, familial, 7", "description": "Any familial atrial fibrillation in which the cause of the disease is a mutation in the KCNA5 gene." }, { "id": "MONDO:0012828", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012828", "name": "KCNA5 familial atrial fibrillation", "description": "" }, { "id": "MONDO:0012828", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012828", "name": "atrial fibrillation, familial, 7", "description": "" }, { "id": "MONDO:0012828", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012828", "name": "atrial fibrillation, familial, type 7", "description": "" }, { "id": "MONDO:0012828", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012828", "name": "familial atrial fibrillation caused by mutation in KCNA5", "description": "" }, { "id": "MONDO:0012828", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012828", "name": "ATFB7", "description": "" }, { "id": "MONDO:0013513", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013513", "name": "atrial fibrillation, familial, 9", "description": "Any familial atrial fibrillation in which the cause of the disease is a mutation in the KCNJ2 gene." }, { "id": "MONDO:0013513", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013513", "name": "KCNJ2 familial atrial fibrillation", "description": "" }, { "id": "MONDO:0013513", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013513", "name": "atrial fibrillation, familial, 9", "description": "" }, { "id": "MONDO:0013513", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013513", "name": "atrial fibrillation, familial, type 9", "description": "" }, { "id": "MONDO:0013513", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013513", "name": "familial atrial fibrillation caused by mutation in KCNJ2", "description": "" }, { "id": "MONDO:0013513", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013513", "name": "ATFB9", "description": "" }, { "id": "MIM:614049", "resource": "MIM", "url": "https://www.omim.org/entry/614049", "name": "Atrial fibrillation, familial, 11", "description": "Atrial fibrillation, familial, 11" }, { "id": "MIM:614022", "resource": "MIM", "url": "https://www.omim.org/entry/614022", "name": "Atrial fibrillation, familial, 10", "description": "Atrial fibrillation, familial, 10" }, { "id": "MIM:615377", "resource": "MIM", "url": "https://www.omim.org/entry/615377", "name": "Atrial fibrillation, familial, 13", "description": "Atrial fibrillation, familial, 13" }, { "id": "MIM:615378", "resource": "MIM", "url": "https://www.omim.org/entry/615378", "name": "Atrial fibrillation, familial, 14", "description": "Atrial fibrillation, familial, 14" }, { "id": "MIM:607554", "resource": "MIM", "url": "https://www.omim.org/entry/607554", "name": "Atrial fibrillation, familial, 3", "description": "Atrial fibrillation, familial, 3" }, { "id": "MIM:614050", "resource": "MIM", "url": "https://www.omim.org/entry/614050", "name": "Atrial fibrillation, familial, 12", "description": "Atrial fibrillation, familial, 12" }, { "id": "MIM:611493", "resource": "MIM", "url": "https://www.omim.org/entry/611493", "name": "Atrial fibrillation, familial, 4", "description": "Atrial fibrillation, familial, 4" }, { "id": "MIM:615770", "resource": "MIM", "url": "https://www.omim.org/entry/615770", "name": "Atrial fibrillation, familial, 15", "description": "Atrial fibrillation, familial, 15" }, { "id": "MIM:612201", "resource": "MIM", "url": "https://www.omim.org/entry/612201", "name": "Atrial fibrillation, familial, 6", "description": "Atrial fibrillation, familial, 6" }, { "id": "MIM:612240", "resource": "MIM", "url": "https://www.omim.org/entry/612240", "name": "Atrial fibrillation, familial, 7", "description": "Atrial fibrillation, familial, 7" }, { "id": "MIM:613980", "resource": "MIM", "url": "https://www.omim.org/entry/613980", "name": "Atrial fibrillation, familial, 9", "description": "Atrial fibrillation, familial, 9" } ], "evidence": [ { "id": "615770", "database": "MIM", "url": "https://www.omim.org/entry/615770" } ] } ], "snv": [ { "evidence": [ { "id": "O75694", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O75694" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 55, "end_pos": 55, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "P", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NPT->NST); n-glyco-sequon-gain (NNP->NNS).", "chr_id": "5", "chr_pos": "37364379", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "P55", "disease": [ { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs374698290", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs374698290" }, { "id": "rs374698290", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs374698290" }, { "id": "rs374698290", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs374698290#frequency_tab" }, { "id": "rs374698290", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs374698290" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1258, "end_pos": 1258, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "5", "chr_pos": "37298889", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1258", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1289180343", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1289180343" }, { "id": "rs1289180343", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1289180343" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1258, "end_pos": 1258, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).", "chr_id": "5", "chr_pos": "37298888", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1258", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs757856280", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757856280" }, { "id": "rs757856280", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757856280" }, { "id": "rs757856280", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs757856280" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1292, "end_pos": 1292, "sequence_org": "I", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NEI->NET).", "chr_id": "5", "chr_pos": "37294384", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "I1292", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O75694", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O75694" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1338, "end_pos": 1338, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "P", "sequence_mut": "A", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NPS->NAS).", "chr_id": "5", "chr_pos": "37292904", "ref_nt": "G", "alt_nt": "C", "minor_allelic_frequency": "", "site_lbl": "P1338", "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1209885529", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1209885529" }, { "id": "rs1209885529", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1209885529" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 1368, "end_pos": 1368, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SSS->NSS).", "chr_id": "5", "chr_pos": "37291973", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S1368", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O75694", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O75694" }, { "id": "rs745476310", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745476310" }, { "id": "rs745476310", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745476310" }, { "id": "rs745476310", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs745476310" }, { "id": "rs745476310", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs745476310" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 335, "end_pos": 335, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "D", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (DRS->NRS).", "chr_id": "5", "chr_pos": "37342639", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "D335", "disease": [ { "disease_id": "DOID:4362", "recommended_name": { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "cervical cancer", "description": "A female reproductive organ cancer that is located_in the cervix." }, "synonyms": [ { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "cervical neoplasm", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "cervix cancer", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "cervix uteri cancer", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "neoplasm of uterine cervix", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "tumor of the Cervix Uteri", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "uterine cervical neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervical cancer", "description": "A primary or metastatic malignant neoplasm involving the cervix." }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervical neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "tumor of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "tumour of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "uterine cervical neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cancer of uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervical cancer, somatic", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervix cancer", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervix uteri cancer", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervical neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervical tumor", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervical tumour", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix tumor", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix tumour", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix uteri neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix uteri tumor", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix uteri tumour", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of the cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of the uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of the cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of the uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of the cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of the uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant uterine cervix neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant uterine cervix tumor", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant uterine cervix tumour", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "uterine cervix cancer", "description": "" }, { "id": "MIM:603956", "resource": "MIM", "url": "https://www.omim.org/entry/603956", "name": "Cervical cancer", "description": "Cervical cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] }, { "evidence": [ { "id": "rs748088416", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748088416" }, { "id": "rs748088416", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748088416" }, { "id": "rs748088416", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs748088416" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 79, "end_pos": 79, "sequence_org": "P", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NLP->NLS).", "chr_id": "5", "chr_pos": "37364307", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P79", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O75694", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O75694" }, { "id": "rs749163402", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749163402" }, { "id": "rs749163402", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749163402" }, { "id": "rs749163402", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749163402" }, { "id": "rs749163402", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs749163402#frequency_tab" }, { "id": "rs749163402", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs749163402" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 851, "end_pos": 851, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "A", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NAA->NAT).", "chr_id": "5", "chr_pos": "37310629", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "A851", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] }, { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi" ] }, { "evidence": [ { "id": "rs758060390", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758060390" }, { "id": "rs758060390", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758060390" }, { "id": "rs758060390", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs758060390#frequency_tab" }, { "id": "rs758060390", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs758060390" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 976, "end_pos": 976, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "5", "chr_pos": "37305188", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T976", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs939757722", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs939757722" }, { "id": "rs939757722", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs939757722#frequency_tab" }, { "id": "rs939757722", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs939757722" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 976, "end_pos": 976, "sequence_org": "T", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->R).", "chr_id": "5", "chr_pos": "37305187", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T976", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs763296719", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763296719" }, { "id": "rs763296719", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763296719" }, { "id": "rs763296719", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs763296719" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 994, "end_pos": 994, "sequence_org": "S", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->R).", "chr_id": "5", "chr_pos": "37305134", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S994", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "68.42", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000113569", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000113569" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "74.19", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000113569", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000113569" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "79.65", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000113569", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000113569" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "55.72", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000113569", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000113569" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "80.79", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000113569", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000113569" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "82.43", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000113569", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000113569" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "70.55", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000113569", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000113569" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "74.85", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000113569", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000113569" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "77.25", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000113569", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000113569" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "70.1", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000113569", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000113569" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "79.46", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000113569", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000113569" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "77.19", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000113569", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000113569" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "81.55", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000113569", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000113569" } ] } ], "expression_disease": [ { "significant": "No", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O75694", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75694" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O75694", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75694" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O75694", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75694" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O75694", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75694" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O75694", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75694" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O75694", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75694" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O75694", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75694" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O75694", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75694" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O75694", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75694" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O75694", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75694" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O75694", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75694" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O75694", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75694" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75694", "url": "https://www.uniprot.org/uniprot/O75694" } ], "common_name": "Human" } ], "gene": [ { "name": "NUP155", "url": "https://www.uniprot.org/uniprot/O75694", "locus": { "chromosome": "5", "start_pos": 37288137, "end_pos": 37371106, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000113569", "url": "https://www.ensembl.org/id/ENSG00000113569" } ] } } ], "crossref": [ { "id": "ENSG00000113569", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000113569", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "O75694", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O75694", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "CHEMBL4295680", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL4295680", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "NUP155", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=NUP155", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "9631", "url": "https://www.ncbi.nlm.nih.gov/gene/9631", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "8063", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=8063", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "E9PF10", "url": "https://www.ebi.ac.uk/intact/interactors/id:E9PF10*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "O75694", "url": "https://www.ebi.ac.uk/intact/interactors/id:O75694*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR004870", "url": "https://www.ebi.ac.uk/interpro/entry/IPR004870", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR014908", "url": "https://www.ebi.ac.uk/interpro/entry/IPR014908", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR042533", "url": "https://www.ebi.ac.uk/interpro/entry/IPR042533", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR042537", "url": "https://www.ebi.ac.uk/interpro/entry/IPR042537", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR042538", "url": "https://www.ebi.ac.uk/interpro/entry/IPR042538", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:9631", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:9631", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "606694", "url": "http://www.omim.org/entry/606694", "database": "MIM", "categories": [ "Other" ] }, { "id": "615770", "url": "http://www.omim.org/entry/615770", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O75694", "url": "https://www.nextprot.org/entry/NX_O75694", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "O75694", "url": "https://oglcnac.org/atlas/detail/O75694", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "O75694", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75694", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "SWAPFQK", "url": "https://omabrowser.org/oma/group/SWAPFQK/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "52774at2759", "url": "http://www.orthodb.org/?query=52774at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10350", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10350", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10350:SF6", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10350:SF6", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "5A9Q", "url": "https://www.rcsb.org/structure/5A9Q", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5IJN", "url": "https://www.rcsb.org/structure/5IJN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5IJO", "url": "https://www.rcsb.org/structure/5IJO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7EYE", "url": "https://www.rcsb.org/structure/7EYE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7EYF", "url": "https://www.rcsb.org/structure/7EYF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7EYQ", "url": "https://www.rcsb.org/structure/7EYQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7PER", "url": "https://www.rcsb.org/structure/7PER", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7R1Y", "url": "https://www.rcsb.org/structure/7R1Y", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7R5J", "url": "https://www.rcsb.org/structure/7R5J", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7R5K", "url": "https://www.rcsb.org/structure/7R5K", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF08801", "url": "http://pfam.xfam.org/family/PF08801", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O75694", "url": "https://pharos.nih.gov/targets/O75694", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O75694", "url": "http://purl.obolibrary.org/obo/PR_O75694", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-159227", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159227", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-159230", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159230", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-159231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159231", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-159236", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159236", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-165054", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-165054", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-168271", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168271", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-168276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168276", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-168325", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168325", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-168333", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168333", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-170822", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-170822", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-180746", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180746", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-180910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180910", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-191859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-191859", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-3232142", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3232142", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-3301854", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3301854", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-3371453", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371453", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-4085377", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4085377", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-4551638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4551638", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-4570464", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4570464", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-4615885", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4615885", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5619107", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5619107", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9610379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9610379", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9615933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9615933", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_004289", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004289", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "D6RA13", "url": "https://www.uniprot.org/uniprot/D6RA13", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D6RA13-1", "url": "https://www.uniprot.org/uniprot/D6RA13-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PF10", "url": "https://www.uniprot.org/uniprot/E9PF10", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PF10-1", "url": "https://www.uniprot.org/uniprot/E9PF10-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O75694", "url": "https://www.uniprot.org/uniprot/O75694", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O75694-1", "url": "https://www.uniprot.org/uniprot/O75694-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O75694-2", "url": "https://www.uniprot.org/uniprot/O75694-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MPSSLLGAAMPASTSAAALQEALENAGRLIDRQLQEDRMYPDLSELLMVSAPNNPTVSGMSDMDYPLQGPGLLSVPNLPEISSIRRVPLPPELVEQFGHMQCNCMMGVFPPISRAWLTIDSDIFMWNYEDGGDLAYFDGLSETILAVGLVKPKAGIFQPHVRHLLVLATPVDIVILGLSYANLQTGSGVLNDSLSGGMQLLPDPLYSLPTDNTYLLTITSTDNGRIFLAGKDGCLYEVAYQAEAGWFSQRCRKINHSKSSLSFLVPSLLQFTFSEDDPILQIAIDNSRNILYTRSEKGVIQVYDLGQDGQGMSRVASVSQNAIVSAAGNIARTIDRSVFKPIVQIAVIENSESLDCQLLAVTHAGVRLYFSTCPFRQPLARPNTLTLVHVRLPPGFSASSTVEKPSKVHRALYSKGILLMAASENEDNDILWCVNHDTFPFQKPMMETQMTAGVDGHSWALSAIDELKVDKIITPLNKDHIPITDSPVVVQQHMLPPKKFVLLSAQGSLMFHKLRPVDQLRHLLVSNVGGDGEEIERFFKLHQEDQACATCLILACSTAACDREVSAWATRAFFRYGGEAQMRFPTTLPPPSNVGPILGSPVYSSSPVPSGSPYPNPSFLGTPSHGIQPPAMSTPVCALGNPATQATNMSCVTGPEIVYSGKHNGICIYFSRIMGNIWDASLVVERIFKSGNREITAIESSVPCQLLESVLQELKGLQEFLDRNSQFAGGPLGNPNTTAKVQQRLIGFMRPENGNPQQMQQELQRKFHEAQLSEKISLQAIQQLVRKSYQALALWKLLCEHQFTIIVAELQKELQEQLKITTFKDLVIRDKELTGALIASLINCYIRDNAAVDGISLHLQDICPLLYSTDDAICSKANELLQRSRQVQNKTEKERMLRESLKEYQKISNQVDLSNVCAQYRQVRFYEGVVELSLTAAEKKDPQGLGLHFYKHGEPEEDIVGLQAFQERLNSYKCITDTLQELVNQSKAAPQSPSVPKKPGPPVLSSDPNMLSNEEAGHHFEQMLKLSQRSKDELFSIALYNWLIQVDLADKLLQVASPFLEPHLVRMAKVDQNRVRYMDLLWRYYEKNRSFSNAARVLSRLADMHSTEISLQQRLEYIARAILSAKSSTAISSIAADGEFLHELEEKMEVARIQLQIQETLQRQYSHHSSVQDAVSQLDSELMDITKLYGEFADPFKLAECKLAIIHCAGYSDPILVQTLWQDIIEKELSDSVTLSSSDRMHALSLKIVLLGKIYAGTPRFFPLDFIVQFLEQQVCTLNWDVGFVIQTMNEIGVPLPRLLEVYDQLFKSRDPFWNRMKKPLHLLDCIHVLLIRYVENPSQVLNCERRRFTNLCLDAVCGYLVELQSMSSSVAVQAITGNFKSLQAKLERLH", "length": 1391, "header": "sp|O75694-1|NU155_HUMAN Isoform 1 of Nuclear pore complex protein Nup155 OS=Homo sapiens OX=9606 GN=NUP155 PE=1 SV=1 CANONICAL=O75694-1" }, "isoforms": [ { "isoform_ac": "D6RA13-1", "url": "", "sequence": { "sequence": "MPSSLLGAAMPASTSAAALQEALENAGRLIDRQLQEDRMYPDLSELLMVSAPSE", "length": 54, "header": "tr|D6RA13-1|D6RA13_HUMAN Computationally mapped isoform of Nucleoporin 155 OS=Homo sapiens OX=9606 GN=NUP155 PE=1 SV=1 CANONICAL=O75694-1" }, "locus": {} }, { "isoform_ac": "E9PF10-1", "url": "", "sequence": { "sequence": "MPSSLLGAAMPASTSAAALQEALENAGRLIDRQLQEDRMYPDLSELLMVSAPNNPTVSGMSDMDYPLQGPGLLSVPNLPEISSIRRVPLPPELVEQFGHMQCNCMMGVFPPISRAWLTIDSDIFMWNYEDGGDLAYFDGLSETILAVGLVKPKAGIFQPHVRHLLVLATPVDIVILGLSYANLQTGSGVLNDSLSGGMQLLPDPLYSLPTDNTYLLTITSTDNGRIFLAGKDGCLYEVAYQAEAGWFSQRCRKINHSKSSLSFLVPSLLQFTFSEDDPILQIAIDNSRNILYTRSEKGVIQVYDLGQDGQGMSRVASVSQNAIVSAAGNIARTIDRSVFKPIVQIAVIENSESLDCQLLAVTHAGVRLYFSTCPFRQPLARPNTLTLVHVRLPPGFSASSTVEKPSKVHRALYSKGILLMAASENEDNDILWCVNHDTFPFQKPMMETQMTAGVDGHSWALSAIDELKVDKIITPLNKDHIPITDSPVVVQQHMLPPKKFVLLSAQGSLMFHKLRPVDQLRHLLVSNVGGDGEEIERFFKLHQEDQACATCLILACSTAACDREVSAWATRAFFRYGGEAQMRFPTTLPPPSNVGPILGSPVYSSSPVPSGSPYPNPSFLGTPSHGIQPPAMSTPVCALGNPATQATNMSCVTGPEIVYSGKHNGICIYFSRIMGNIWDASLVVERIFKSGNREITAIESSVPCQLLESVLQELKGLQEFLDRNSQFAGGPLGNPNTTAKVQQRLIGFMRPENGNPQQMQQELQRKFHEAQLSEKISLQAIQQLVRKSYQALALWKLLCEHQFTIIVAELQKANELLQRSRQVQNKTEKERMLRESLKEYQKISNQVDLSNVCAQYRQVRFYEGVVELSLTAAEKKDPQGLGLHFYKHGEPEEDIVGLQAFQERLNSYKCITDTLQELVNQSKAAPQSPSVPKKPGPPVLSSDPNMLSNEEAGHHFEQMLKLSQRSKDELFSIALYNWLIQVDLADKLLQVASPFLEPHLVRMAKVDQNRVRYMDLLWRYYEKNRSFSNAARVLSRLADMHSTEISLQQRLEYIARAILSAKSSTAISSIAADGEFLHELEEKMEVARIQLQIQETLQRQYSHHSSVQDAVSQLDSELMDITKLYGEFADPFKLAECKLAIIHCAGYSDPILVQTLWQDIIEKELSDSVTLSSSDRMHALSLKIVLLGKIYAGTPRFFPLDFIVQFLEQQVCTLNWDVGFVIQTMNEIGVPLPRLLEVYDQLFKSRDPFWNRMKKPLHLLDCIHVLLIRYVENPSQVLNCERRRFTNLCLDAVCGYLVELQSMSSSVAVQAITGNFKSLQAKLERLH", "length": 1327, "header": "tr|E9PF10-1|E9PF10_HUMAN Computationally mapped isoform of Nucleoporin 155 OS=Homo sapiens OX=9606 GN=NUP155 PE=1 SV=1 CANONICAL=O75694-1" }, "locus": { "chromosome": "5", "start_pos": 37370977, "end_pos": 37291903, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000513532.1", "url": "https://www.ensembl.org/id/ENST00000513532.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000422019.1", "url": "https://www.ensembl.org/id/ENSP00000422019.1" } ] } }, { "isoform_ac": "O75694-1", "url": "", "sequence": { "sequence": "MPSSLLGAAMPASTSAAALQEALENAGRLIDRQLQEDRMYPDLSELLMVSAPNNPTVSGMSDMDYPLQGPGLLSVPNLPEISSIRRVPLPPELVEQFGHMQCNCMMGVFPPISRAWLTIDSDIFMWNYEDGGDLAYFDGLSETILAVGLVKPKAGIFQPHVRHLLVLATPVDIVILGLSYANLQTGSGVLNDSLSGGMQLLPDPLYSLPTDNTYLLTITSTDNGRIFLAGKDGCLYEVAYQAEAGWFSQRCRKINHSKSSLSFLVPSLLQFTFSEDDPILQIAIDNSRNILYTRSEKGVIQVYDLGQDGQGMSRVASVSQNAIVSAAGNIARTIDRSVFKPIVQIAVIENSESLDCQLLAVTHAGVRLYFSTCPFRQPLARPNTLTLVHVRLPPGFSASSTVEKPSKVHRALYSKGILLMAASENEDNDILWCVNHDTFPFQKPMMETQMTAGVDGHSWALSAIDELKVDKIITPLNKDHIPITDSPVVVQQHMLPPKKFVLLSAQGSLMFHKLRPVDQLRHLLVSNVGGDGEEIERFFKLHQEDQACATCLILACSTAACDREVSAWATRAFFRYGGEAQMRFPTTLPPPSNVGPILGSPVYSSSPVPSGSPYPNPSFLGTPSHGIQPPAMSTPVCALGNPATQATNMSCVTGPEIVYSGKHNGICIYFSRIMGNIWDASLVVERIFKSGNREITAIESSVPCQLLESVLQELKGLQEFLDRNSQFAGGPLGNPNTTAKVQQRLIGFMRPENGNPQQMQQELQRKFHEAQLSEKISLQAIQQLVRKSYQALALWKLLCEHQFTIIVAELQKELQEQLKITTFKDLVIRDKELTGALIASLINCYIRDNAAVDGISLHLQDICPLLYSTDDAICSKANELLQRSRQVQNKTEKERMLRESLKEYQKISNQVDLSNVCAQYRQVRFYEGVVELSLTAAEKKDPQGLGLHFYKHGEPEEDIVGLQAFQERLNSYKCITDTLQELVNQSKAAPQSPSVPKKPGPPVLSSDPNMLSNEEAGHHFEQMLKLSQRSKDELFSIALYNWLIQVDLADKLLQVASPFLEPHLVRMAKVDQNRVRYMDLLWRYYEKNRSFSNAARVLSRLADMHSTEISLQQRLEYIARAILSAKSSTAISSIAADGEFLHELEEKMEVARIQLQIQETLQRQYSHHSSVQDAVSQLDSELMDITKLYGEFADPFKLAECKLAIIHCAGYSDPILVQTLWQDIIEKELSDSVTLSSSDRMHALSLKIVLLGKIYAGTPRFFPLDFIVQFLEQQVCTLNWDVGFVIQTMNEIGVPLPRLLEVYDQLFKSRDPFWNRMKKPLHLLDCIHVLLIRYVENPSQVLNCERRRFTNLCLDAVCGYLVELQSMSSSVAVQAITGNFKSLQAKLERLH", "length": 1391, "header": "sp|O75694-1|NU155_HUMAN Isoform 1 of Nuclear pore complex protein Nup155 OS=Homo sapiens OX=9606 GN=NUP155 PE=1 SV=1 CANONICAL=O75694-1" }, "locus": { "chromosome": "5", "start_pos": 37370977, "end_pos": 37291903, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000231498.8", "url": "https://www.ensembl.org/id/ENST00000231498.8" }, { "database": "Ensembl Peptide", "id": "ENSP00000231498.3", "url": "https://www.ensembl.org/id/ENSP00000231498.3" } ] } }, { "isoform_ac": "O75694-2", "url": "", "sequence": { "sequence": "MSDMDYPLQGPGLLSVPNLPEISSIRRVPLPPELVEQFGHMQCNCMMGVFPPISRAWLTIDSDIFMWNYEDGGDLAYFDGLSETILAVGLVKPKAGIFQPHVRHLLVLATPVDIVILGLSYANLQTGSGVLNDSLSGGMQLLPDPLYSLPTDNTYLLTITSTDNGRIFLAGKDGCLYEVAYQAEAGWFSQRCRKINHSKSSLSFLVPSLLQFTFSEDDPILQIAIDNSRNILYTRSEKGVIQVYDLGQDGQGMSRVASVSQNAIVSAAGNIARTIDRSVFKPIVQIAVIENSESLDCQLLAVTHAGVRLYFSTCPFRQPLARPNTLTLVHVRLPPGFSASSTVEKPSKVHRALYSKGILLMAASENEDNDILWCVNHDTFPFQKPMMETQMTAGVDGHSWALSAIDELKVDKIITPLNKDHIPITDSPVVVQQHMLPPKKFVLLSAQGSLMFHKLRPVDQLRHLLVSNVGGDGEEIERFFKLHQEDQACATCLILACSTAACDREVSAWATRAFFRYGGEAQMRFPTTLPPPSNVGPILGSPVYSSSPVPSGSPYPNPSFLGTPSHGIQPPAMSTPVCALGNPATQATNMSCVTGPEIVYSGKHNGICIYFSRIMGNIWDASLVVERIFKSGNREITAIESSVPCQLLESVLQELKGLQEFLDRNSQFAGGPLGNPNTTAKVQQRLIGFMRPENGNPQQMQQELQRKFHEAQLSEKISLQAIQQLVRKSYQALALWKLLCEHQFTIIVAELQKELQEQLKITTFKDLVIRDKELTGALIASLINCYIRDNAAVDGISLHLQDICPLLYSTDDAICSKANELLQRSRQVQNKTEKERMLRESLKEYQKISNQVDLSNVCAQYRQVRFYEGVVELSLTAAEKKDPQGLGLHFYKHGEPEEDIVGLQAFQERLNSYKCITDTLQELVNQSKAAPQSPSVPKKPGPPVLSSDPNMLSNEEAGHHFEQMLKLSQRSKDELFSIALYNWLIQVDLADKLLQVASPFLEPHLVRMAKVDQNRVRYMDLLWRYYEKNRSFSNAARVLSRLADMHSTEISLQQRLEYIARAILSAKSSTAISSIAADGEFLHELEEKMEVARIQLQIQETLQRQYSHHSSVQDAVSQLDSELMDITKLYGEFADPFKLAECKLAIIHCAGYSDPILVQTLWQDIIEKELSDSVTLSSSDRMHALSLKIVLLGKIYAGTPRFFPLDFIVQFLEQQVCTLNWDVGFVIQTMNEIGVPLPRLLEVYDQLFKSRDPFWNRMKKPLHLLDCIHVLLIRYVENPSQVLNCERRRFTNLCLDAVCGYLVELQSMSSSVAVQAITGNFKSLQAKLERLH", "length": 1332, "header": "sp|O75694-2|NU155_HUMAN Isoform 2 of Nuclear pore complex protein Nup155 OS=Homo sapiens OX=9606 GN=NUP155 PE=1 SV=1 CANONICAL=O75694-1" }, "locus": { "chromosome": "5", "start_pos": 37364364, "end_pos": 37291903, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000381843.6", "url": "https://www.ensembl.org/id/ENST00000381843.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000371265.2", "url": "https://www.ensembl.org/id/ENSP00000371265.2" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 1258, "start_aa": "Thr", "end_pos": 1258, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1258", "evidence": [ { "id": "O75694", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75694" }, { "id": "35008409", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35008409" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30397120", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30397120" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" }, { "id": "25367160", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25367160" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "22121020", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22121020" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" }, { "id": "O75694", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75694" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "predicted", "site_seq": "S", "relation": "attached", "comment": "O-linked (GlcNAc) serine O-GlcNAcylation", "start_pos": 526, "start_aa": "Ser", "end_pos": 526, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser526", "evidence": [ { "id": "O75694", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75694#ptm_processing" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 587, "start_aa": "Thr", "end_pos": 587, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr587", "evidence": [ { "id": "O75694", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75694" }, { "id": "35008409", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35008409" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30397120", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30397120" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" }, { "id": "25367160", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25367160" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "22121020", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22121020" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 976, "start_aa": "Thr", "end_pos": 976, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr976", "evidence": [ { "id": "O75694", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75694" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 992, "start_aa": "Ser", "end_pos": 992, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser992", "evidence": [ { "id": "O75694", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75694" }, { "id": "35008409", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35008409" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "30397120", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30397120" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" }, { "id": "25367160", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25367160" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "22121020", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22121020" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" }, { "id": "O75694", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75694" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 994, "start_aa": "Ser", "end_pos": 994, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser994", "evidence": [ { "id": "O75694", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75694" }, { "id": "33465208", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33465208" } ] } ], "phosphorylation": [ { "start_pos": 1030, "end_pos": 1030, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75694", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75694" }, { "database": "PubMed", "id": "20068230", "url": "https://glygen.org/publication/PubMed/20068230" } ], "site_lbl": "Ser1030" }, { "start_pos": 1057, "end_pos": 1057, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O75694", "url": "https://www.uniprot.org/uniprot/O75694" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O75694", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75694" } ], "site_lbl": "Ser1057" }, { "start_pos": 13, "end_pos": 13, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75694", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75694" }, { "database": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" } ], "site_lbl": "Ser13" }, { "start_pos": 313, "end_pos": 313, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75694", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75694" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser313" }, { "start_pos": 4, "end_pos": 4, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75694", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75694" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser4" }, { "start_pos": 504, "end_pos": 504, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75694", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75694" }, { "database": "PubMed", "id": "18767875", "url": "https://glygen.org/publication/PubMed/18767875" } ], "site_lbl": "Ser504" }, { "start_pos": 681, "end_pos": 681, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75694", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75694" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser681" }, { "start_pos": 992, "end_pos": 992, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75694", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75694" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser992" }, { "start_pos": 994, "end_pos": 994, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75694", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75694" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "O75694", "url": "http://phospho.elm.eu.org/byAccession/O75694.html" } ], "site_lbl": "Ser994" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Localization of a human nucleoporin 155 gene (NUP155) to the 5p13 region and cloning of its cDNA.", "journal": "Genomics", "date": "1999", "authors": "Zhang X, Yang H, Corydon M J, Zhang X, Pedersen S, Korenberg J R, Chen X N, Laporte J, Gregersen N, Niebuhr E, Liu G, Bolund L", "evidence": [ { "database": "UniProtKB", "id": "O75694", "url": "https://www.uniprot.org/uniprot/O75694" } ], "reference": [ { "type": "PubMed", "id": "10191094", "url": "https://glygen.org/publication/PubMed/10191094" } ] }, { "title": "Influenza A virus NS1 protein targets poly(A)-binding protein II of the cellular 3'-end processing machinery.", "journal": "The EMBO journal", "date": "1999", "authors": "Chen Z, Li Y, Krug RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-168276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168276" } ], "reference": [ { "type": "PubMed", "id": "10205180", "url": "https://glygen.org/publication/PubMed/10205180" } ] }, { "title": "The Mex67p-mediated nuclear mRNA export pathway is conserved from yeast to human.", "journal": "The EMBO journal", "date": "1999", "authors": "Katahira J, Strasser K, Podtelejnikov A, Mann M, Jung JU, Hurt E", "evidence": [ { "database": "Reactome", "id": "R-HSA-159236", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159236" } ], "reference": [ { "type": "PubMed", "id": "10228171", "url": "https://glygen.org/publication/PubMed/10228171" } ] }, { "title": "The human Tap protein is a nuclear mRNA export factor that contains novel RNA-binding and nucleocytoplasmic transport sequences.", "journal": "Genes & development", "date": "1999", "authors": "Kang Y, Cullen BR", "evidence": [ { "database": "Reactome", "id": "R-HSA-159236", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159236" } ], "reference": [ { "type": "PubMed", "id": "10323864", "url": "https://glygen.org/publication/PubMed/10323864" } ] }, { "title": "Localization in the nucleolus and coiled bodies of protein subunits of the ribonucleoprotein ribonuclease P.", "journal": "The Journal of cell biology", "date": "1999", "authors": "Jarrous N, Wolenski JS, Wesolowski D, Lee C, Altman S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531" } ], "reference": [ { "type": "PubMed", "id": "10444065", "url": "https://glygen.org/publication/PubMed/10444065" } ] }, { "title": "Analysis of the RNA binding specificity of the human tap protein, a constitutive transport element-specific nuclear RNA export factor.", "journal": "Virology", "date": "1999", "authors": "Kang Y, Bogerd HP, Yang J, Cullen BR", "evidence": [ { "database": "Reactome", "id": "R-HSA-159236", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159236" } ], "reference": [ { "type": "PubMed", "id": "10489353", "url": "https://glygen.org/publication/PubMed/10489353" } ] }, { "title": "Two separate sequences of PB2 subunit constitute the RNA cap-binding site of influenza virus RNA polymerase.", "journal": "Genes to cells : devoted to molecular & cellular mechanisms", "date": "1999", "authors": "Honda A, Mizumoto K, Ishihama A", "evidence": [ { "database": "Reactome", "id": "R-HSA-168325", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168325" } ], "reference": [ { "type": "PubMed", "id": "10526235", "url": "https://glygen.org/publication/PubMed/10526235" } ] }, { "title": "Newly assembled snRNPs associate with coiled bodies before speckles, suggesting a nuclear snRNP maturation pathway.", "journal": "Current biology : CB", "date": "1999", "authors": "Sleeman JE, Lamond AI", "evidence": [ { "database": "Reactome", "id": "R-HSA-191859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-191859" } ], "reference": [ { "type": "PubMed", "id": "10531003", "url": "https://glygen.org/publication/PubMed/10531003" } ] }, { "title": "Essential role for the tudor domain of SMN in spliceosomal U snRNP assembly: implications for spinal muscular atrophy.", "journal": "Human molecular genetics", "date": "1999", "authors": "Buhler D, Raker V, Luhrmann R, Fischer U", "evidence": [ { "database": "Reactome", "id": "R-HSA-191859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-191859" } ], "reference": [ { "type": "PubMed", "id": "10556282", "url": "https://glygen.org/publication/PubMed/10556282" } ] }, { "title": "Cell cycle regulation of PML modification and ND10 composition.", "journal": "Journal of cell science", "date": "1999", "authors": "Everett RD, Lomonte P, Sternsdorf T, van Driel R, Orr A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "10574707", "url": "https://glygen.org/publication/PubMed/10574707" } ] }, { "title": "Nuclear import of hepatic glucokinase depends upon glucokinase regulatory protein, whereas export is due to a nuclear export signal sequence in glucokinase.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Shiota C, Coffey J, Grimsby J, Grippo JF, Magnuson MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-170822", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-170822" } ], "reference": [ { "type": "PubMed", "id": "10601273", "url": "https://glygen.org/publication/PubMed/10601273" } ] }, { "title": "Gemin3: A novel DEAD box protein that interacts with SMN, the spinal muscular atrophy gene product, and is a component of gems.", "journal": "The Journal of cell biology", "date": "1999", "authors": "Charroux B, Pellizzoni L, Perkinson RA, Shevchenko A, Mann M, Dreyfuss G", "evidence": [ { "database": "Reactome", "id": "R-HSA-191859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-191859" } ], "reference": [ { "type": "PubMed", "id": "10601333", "url": "https://glygen.org/publication/PubMed/10601333" } ] }, { "title": "The C-terminal domain of TAP interacts with the nuclear pore complex and promotes export of specific CTE-bearing RNA substrates.", "journal": "RNA (New York, N.Y.)", "date": "2000", "authors": "Bachi A, Braun IC, Rodrigues JP, Pante N, Ribbeck K, von Kobbe C, Kutay U, Wilm M, Gorlich D, Carmo-Fonseca M, Izaurralde E", "evidence": [ { "database": "Reactome", "id": "R-HSA-159236", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159236" } ], "reference": [ { "type": "PubMed", "id": "10668806", "url": "https://glygen.org/publication/PubMed/10668806" } ] }, { "title": "Gemin4. A novel component of the SMN complex that is found in both gems and nucleoli.", "journal": "The Journal of cell biology", "date": "2000", "authors": "Charroux B, Pellizzoni L, Perkinson RA, Yong J, Shevchenko A, Mann M, Dreyfuss G", "evidence": [ { "database": "Reactome", "id": "R-HSA-191859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-191859" } ], "reference": [ { "type": "PubMed", "id": "10725331", "url": "https://glygen.org/publication/PubMed/10725331" } ] }, { "title": "SUMO-1 conjugation to topoisomerase I: A possible repair response to topoisomerase-mediated DNA damage.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2000", "authors": "Mao Y, Sun M, Desai SD, Liu LF", "evidence": [ { "database": "Reactome", "id": "R-HSA-4615885", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4615885" } ], "reference": [ { "type": "PubMed", "id": "10759568", "url": "https://glygen.org/publication/PubMed/10759568" } ] }, { "title": "Influenza virus NS1 protein counteracts PKR-mediated inhibition of replication.", "journal": "Journal of virology", "date": "2000", "authors": "Bergmann M, Garcia-Sastre A, Carnero E, Pehamberger H, Wolff K, Palese P, Muster T", "evidence": [ { "database": "Reactome", "id": "R-HSA-168276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168276" } ], "reference": [ { "type": "PubMed", "id": "10846107", "url": "https://glygen.org/publication/PubMed/10846107" } ] }, { "title": "Specific sequences of the Sm and Sm-like (Lsm) proteins mediate their interaction with the spinal muscular atrophy disease gene product (SMN).", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Friesen WJ, Dreyfuss G", "evidence": [ { "database": "Reactome", "id": "R-HSA-191859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-191859" } ], "reference": [ { "type": "PubMed", "id": "10851237", "url": "https://glygen.org/publication/PubMed/10851237" } ] }, { "title": "SUMO-1 conjugation to human DNA topoisomerase II isozymes.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Mao Y, Desai SD, Liu LF", "evidence": [ { "database": "Reactome", "id": "R-HSA-4615885", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4615885" } ], "reference": [ { "type": "PubMed", "id": "10862613", "url": "https://glygen.org/publication/PubMed/10862613" } ] }, { "title": "GTP hydrolysis by Ran is required for nuclear envelope assembly.", "journal": "Molecular cell", "date": "2000", "authors": "Hetzer M, Bilbao-Cortes D, Walther TC, Gruss OJ, Mattaj IW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9615933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9615933" } ], "reference": [ { "type": "PubMed", "id": "10911995", "url": "https://glygen.org/publication/PubMed/10911995" } ] }, { "title": "Selective nuclear export of viral mRNAs in influenza-virus-infected cells.", "journal": "Trends in microbiology", "date": "2000", "authors": "Chen Z, Krug RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-168325", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168325" } ], "reference": [ { "type": "PubMed", "id": "10920397", "url": "https://glygen.org/publication/PubMed/10920397" } ] }, { "title": "Identification of Mrj, a DnaJ/Hsp40 family protein, as a keratin 8/18 filament regulatory protein.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Izawa I, Nishizawa M, Ohtakara K, Ohtsuka K, Inada H, Inagaki M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371453", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371453" } ], "reference": [ { "type": "PubMed", "id": "10954706", "url": "https://glygen.org/publication/PubMed/10954706" } ] }, { "title": "The protein Aly links pre-messenger-RNA splicing to nuclear export in metazoans.", "journal": "Nature", "date": "2000", "authors": "Zhou Z, Luo MJ, Straesser K, Katahira J, Hurt E, Reed R", "evidence": [ { "database": "Reactome", "id": "R-HSA-159231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159231" } ], "reference": [ { "type": "PubMed", "id": "11014198", "url": "https://glygen.org/publication/PubMed/11014198" } ] }, { "title": "TAP (NXF1) belongs to a multigene family of putative RNA export factors with a conserved modular architecture.", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Herold A, Suyama M, Rodrigues JP, Braun IC, Kutay U, Carmo-Fonseca M, Bork P, Izaurralde E", "evidence": [ { "database": "Reactome", "id": "R-HSA-159236", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159236" } ], "reference": [ { "type": "PubMed", "id": "11073998", "url": "https://glygen.org/publication/PubMed/11073998" } ] }, { "title": "A PPxY motif within the VP40 protein of Ebola virus interacts physically and functionally with a ubiquitin ligase: implications for filovirus budding.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2000", "authors": "Harty RN, Brown ME, Wang G, Huibregtse J, Hayes FP", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "11095724", "url": "https://glygen.org/publication/PubMed/11095724" } ] }, { "title": "Ubiquitination of HIV-1 and MuLV Gag.", "journal": "Virology", "date": "2000", "authors": "Ott DE, Coren LV, Chertova EN, Gagliardi TD, Schubert U", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "11112487", "url": "https://glygen.org/publication/PubMed/11112487" } ] }, { "title": "Influenza A virus NS2 protein mediates vRNP nuclear export through NES-independent interaction with hCRM1.", "journal": "The EMBO journal", "date": "2000", "authors": "Neumann G, Hughes MT, Kawaoka Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-168333", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168333" } ], "reference": [ { "type": "PubMed", "id": "11118210", "url": "https://glygen.org/publication/PubMed/11118210" } ] }, { "title": "A role for the basic patch and the C terminus of RanGTP in regulating the dynamic interactions with importin beta, CRM1 and RanBP1.", "journal": "Journal of molecular biology", "date": "2001", "authors": "Nilsson J, Askjaer P, Kjems J", "evidence": [ { "database": "Reactome", "id": "R-HSA-168333", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168333" } ], "reference": [ { "type": "PubMed", "id": "11124902", "url": "https://glygen.org/publication/PubMed/11124902" } ] }, { "title": "Influenza B virus NS1 protein inhibits conjugation of the interferon (IFN)-induced ubiquitin-like ISG15 protein.", "journal": "The EMBO journal", "date": "2001", "authors": "Yuan W, Krug RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "11157743", "url": "https://glygen.org/publication/PubMed/11157743" } ] }, { "title": "Roles of Ran-GTP and Ran-GDP in precursor vesicle recruitment and fusion during nuclear envelope assembly in a human cell-free system.", "journal": "Current biology : CB", "date": "2001", "authors": "Zhang C, Clarke PR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9615933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9615933" } ], "reference": [ { "type": "PubMed", "id": "11231159", "url": "https://glygen.org/publication/PubMed/11231159" } ] }, { "title": "Influenza virus propagation is impaired by inhibition of the Raf/MEK/ERK signalling cascade.", "journal": "Nature cell biology", "date": "2001", "authors": "Pleschka S, Wolff T, Ehrhardt C, Hobom G, Planz O, Rapp UR, Ludwig S", "evidence": [ { "database": "Reactome", "id": "R-HSA-168333", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168333" } ], "reference": [ { "type": "PubMed", "id": "11231581", "url": "https://glygen.org/publication/PubMed/11231581" } ] }, { "title": "Prediction of structural domains of TAP reveals details of its interaction with p15 and nucleoporins.", "journal": "EMBO reports", "date": "2000", "authors": "Suyama M, Doerks T, Braun IC, Sattler M, Izaurralde E, Bork P", "evidence": [ { "database": "Reactome", "id": "R-HSA-159236", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159236" } ], "reference": [ { "type": "PubMed", "id": "11256625", "url": "https://glygen.org/publication/PubMed/11256625" } ] }, { "title": "Overexpression of TAP/p15 heterodimers bypasses nuclear retention and stimulates nuclear mRNA export.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Braun IC, Herold A, Rode M, Conti E, Izaurralde E", "evidence": [ { "database": "Reactome", "id": "R-HSA-159236", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159236" } ], "reference": [ { "type": "PubMed", "id": "11259411", "url": "https://glygen.org/publication/PubMed/11259411" } ] }, { "title": "NXT1 (p15) is a crucial cellular cofactor in TAP-dependent export of intron-containing RNA in mammalian cells.", "journal": "Molecular and cellular biology", "date": "2001", "authors": "Guzik BW, Levesque L, Prasad S, Bor YC, Black BE, Paschal BM, Rekosh D, Hammarskjold ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-159236", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159236" } ], "reference": [ { "type": "PubMed", "id": "11259602", "url": "https://glygen.org/publication/PubMed/11259602" } ] }, { "title": "Nuclear export of influenza virus ribonucleoproteins: identification of an export intermediate at the nuclear periphery.", "journal": "Virology", "date": "2001", "authors": "Ma K, Roy AM, Whittaker GR", "evidence": [ { "database": "Reactome", "id": "R-HSA-168333", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168333" } ], "reference": [ { "type": "PubMed", "id": "11289803", "url": "https://glygen.org/publication/PubMed/11289803" } ] }, { "title": "The evolutionarily conserved region of the U snRNA export mediator PHAX is a novel RNA-binding domain that is essential for U snRNA export.", "journal": "RNA (New York, N.Y.)", "date": "2001", "authors": "Segref A, Mattaj IW, Ohno M", "evidence": [ { "database": "Reactome", "id": "R-HSA-191859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-191859" } ], "reference": [ { "type": "PubMed", "id": "11333016", "url": "https://glygen.org/publication/PubMed/11333016" } ] }, { "title": "Inhibition of nuclear export of ribonucleoprotein complexes of influenza virus by leptomycin B.", "journal": "Virus research", "date": "2001", "authors": "Watanabe K, Takizawa N, Katoh M, Hoshida K, Kobayashi N, Nagata K", "evidence": [ { "database": "Reactome", "id": "R-HSA-168333", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168333" } ], "reference": [ { "type": "PubMed", "id": "11451485", "url": "https://glygen.org/publication/PubMed/11451485" } ] }, { "title": "Protein-RNA interactions in the subunits of human nuclear RNase P.", "journal": "RNA (New York, N.Y.)", "date": "2001", "authors": "Jiang T, Guerrier-Takada C, Altman S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531" } ], "reference": [ { "type": "PubMed", "id": "11455963", "url": "https://glygen.org/publication/PubMed/11455963" } ] }, { "title": "Amino acid substitutions of coiled-coil protein Tpr abrogate anchorage to the nuclear pore complex but not parallel, in-register homodimerization.", "journal": "Molecular biology of the cell", "date": "2001", "authors": "Hase ME, Kuznetsov NV, Cordes VC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5619107", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5619107" } ], "reference": [ { "type": "PubMed", "id": "11514627", "url": "https://glygen.org/publication/PubMed/11514627" } ] }, { "title": "RNA export mediated by tap involves NXT1-dependent interactions with the nuclear pore complex.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Levesque L, Guzik B, Guan T, Coyle J, Black BE, Rekosh D, Hammarskjold ML, Paschal BM", "evidence": [ { "database": "Reactome", "id": "R-HSA-159236", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159236" } ], "reference": [ { "type": "PubMed", "id": "11579093", "url": "https://glygen.org/publication/PubMed/11579093" } ] }, { "title": "Nucleolar delocalization of human topoisomerase I in response to topotecan correlates with sumoylation of the protein.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Mo YY, Yu Y, Shen Z, Beck WT", "evidence": [ { "database": "Reactome", "id": "R-HSA-4615885", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4615885" } ], "reference": [ { "type": "PubMed", "id": "11709553", "url": "https://glygen.org/publication/PubMed/11709553" } ] }, { "title": "Gemin5, a novel WD repeat protein component of the SMN complex that binds Sm proteins.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Gubitz AK, Mourelatos Z, Abel L, Rappsilber J, Mann M, Dreyfuss G", "evidence": [ { "database": "Reactome", "id": "R-HSA-191859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-191859" } ], "reference": [ { "type": "PubMed", "id": "11714716", "url": "https://glygen.org/publication/PubMed/11714716" } ] }, { "title": "A eubacterial origin for the human tRNA nucleotidyltransferase?", "journal": "Biological chemistry", "date": "2001", "authors": "Reichert AS, Thurlow DL, Morl M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531" } ], "reference": [ { "type": "PubMed", "id": "11727826", "url": "https://glygen.org/publication/PubMed/11727826" } ] }, { "title": "Formation of Tap/NXT1 heterodimers activates Tap-dependent nuclear mRNA export by enhancing recruitment to nuclear pore complexes.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Wiegand HL, Coburn GA, Zeng Y, Kang Y, Bogerd HP, Cullen BR", "evidence": [ { "database": "Reactome", "id": "R-HSA-159236", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159236" } ], "reference": [ { "type": "PubMed", "id": "11739738", "url": "https://glygen.org/publication/PubMed/11739738" } ] }, { "title": "Chemistry of gene silencing: the mechanism of NAD+-dependent deacetylation reactions.", "journal": "Biochemistry", "date": "2001", "authors": "Sauve AA, Celic I, Avalos J, Deng H, Boeke JD, Schramm VL", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371453", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371453" } ], "reference": [ { "type": "PubMed", "id": "11747420", "url": "https://glygen.org/publication/PubMed/11747420" } ] }, { "title": "Purification of native survival of motor neurons complexes and identification of Gemin6 as a novel component.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Pellizzoni L, Baccon J, Rappsilber J, Mann M, Dreyfuss G", "evidence": [ { "database": "Reactome", "id": "R-HSA-191859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-191859" } ], "reference": [ { "type": "PubMed", "id": "11748230", "url": "https://glygen.org/publication/PubMed/11748230" } ] }, { "title": "Complex formation between Tap and p15 affects binding to FG-repeat nucleoporins and nucleocytoplasmic shuttling.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Katahira J, Straesser K, Saiwaki T, Yoneda Y, Hurt E", "evidence": [ { "database": "Reactome", "id": "R-HSA-159236", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159236" } ], "reference": [ { "type": "PubMed", "id": "11756420", "url": "https://glygen.org/publication/PubMed/11756420" } ] }, { "title": "UBP43 (USP18) specifically removes ISG15 from conjugated proteins.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Malakhov MP, Malakhova OA, Kim KI, Ritchie KJ, Zhang DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "11788588", "url": "https://glygen.org/publication/PubMed/11788588" } ] }, { "title": "The nucleoporin RanBP2 has SUMO1 E3 ligase activity.", "journal": "Cell", "date": "2002", "authors": "Pichler A, Gast A, Seeler JS, Dejean A, Melchior F", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "11792325", "url": "https://glygen.org/publication/PubMed/11792325" } ] }, { "title": "Recruitment of the Crm1 nuclear export factor is sufficient to induce cytoplasmic expression of incompletely spliced human immunodeficiency virus mRNAs.", "journal": "Journal of virology", "date": "2002", "authors": "Yi R, Bogerd HP, Cullen BR", "evidence": [ { "database": "Reactome", "id": "R-HSA-165054", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-165054" } ], "reference": [ { "type": "PubMed", "id": "11836381", "url": "https://glygen.org/publication/PubMed/11836381" } ] }, { "title": "Human ribonuclease P: subunits, function, and intranuclear localization.", "journal": "RNA (New York, N.Y.)", "date": "2002", "authors": "Jarrous N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531" } ], "reference": [ { "type": "PubMed", "id": "11871657", "url": "https://glygen.org/publication/PubMed/11871657" } ] }, { "title": "Modification of the human thymine-DNA glycosylase by ubiquitin-like proteins facilitates enzymatic turnover.", "journal": "The EMBO journal", "date": "2002", "authors": "Hardeland U, Steinacher R, Jiricny J, Schar P", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "11889051", "url": "https://glygen.org/publication/PubMed/11889051" } ] }, { "title": "Ran-binding protein 3 links Crm1 to the Ran guanine nucleotide exchange factor.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Nemergut ME, Lindsay ME, Brownawell AM, Macara IG", "evidence": [ { "database": "Reactome", "id": "R-HSA-168333", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168333" } ], "reference": [ { "type": "PubMed", "id": "11932251", "url": "https://glygen.org/publication/PubMed/11932251" } ] }, { "title": "SUMO-1 modification of histone deacetylase 1 (HDAC1) modulates its biological activities.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "David G, Neptune MA, DePinho RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-4551638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4551638" } ], "reference": [ { "type": "PubMed", "id": "11960997", "url": "https://glygen.org/publication/PubMed/11960997" } ] }, { "title": "An element in the 3' untranslated region of human LINE-1 retrotransposon mRNA binds NXF1(TAP) and can function as a nuclear export element.", "journal": "RNA (New York, N.Y.)", "date": "2002", "authors": "Lindtner S, Felber BK, Kjems J", "evidence": [ { "database": "Reactome", "id": "R-HSA-159227", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159227" } ], "reference": [ { "type": "PubMed", "id": "12003494", "url": "https://glygen.org/publication/PubMed/12003494" } ] }, { "title": "PYPAF7, a novel PYRIN-containing Apaf1-like protein that regulates activation of NF-kappa B and caspase-1-dependent cytokine processing.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Wang L, Manji GA, Grenier JM, Al-Garawi A, Merriam S, Lora JM, Geddes BJ, Briskin M, DiStefano PS, Bertin J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "12019269", "url": "https://glygen.org/publication/PubMed/12019269" } ] }, { "title": "The SUMO E3 ligase RanBP2 promotes modification of the HDAC4 deacetylase.", "journal": "The EMBO journal", "date": "2002", "authors": "Kirsh O, Seeler JS, Pichler A, Gast A, Muller S, Miska E, Mathieu M, Harel-Bellan A, Kouzarides T, Melchior F, Dejean A", "evidence": [ { "database": "Reactome", "id": "R-HSA-4551638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4551638" } ], "reference": [ { "type": "PubMed", "id": "12032081", "url": "https://glygen.org/publication/PubMed/12032081" } ] }, { "title": "Genomic organization, transcript variants and comparative analysis of the human nucleoporin 155 (NUP155) gene.", "journal": "Gene", "date": "2002", "authors": "Zhang Xiuqing, Yang Huanming, Yu Jun, Chen Cong, Zhang Guangyu, Bao Jingyue, Du Yutao, Kibukawa Miho, Li Zhijie, Wang Jun, Hu Songnian, Dong Wei, Wang Jian, Gregersen Niels, Niebuhr Erik, Bolund Lars", "evidence": [ { "database": "UniProtKB", "id": "O75694", "url": "https://www.uniprot.org/uniprot/O75694" } ], "reference": [ { "type": "PubMed", "id": "12034489", "url": "https://glygen.org/publication/PubMed/12034489" } ] }, { "title": "Identification and characterization of Gemin7, a novel component of the survival of motor neuron complex.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Baccon J, Pellizzoni L, Rappsilber J, Mann M, Dreyfuss G", "evidence": [ { "database": "Reactome", "id": "R-HSA-191859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-191859" } ], "reference": [ { "type": "PubMed", "id": "12065586", "url": "https://glygen.org/publication/PubMed/12065586" } ] }, { "title": "The RNA polymerase of influenza a virus is stabilized by interaction with its viral RNA promoter.", "journal": "Journal of virology", "date": "2002", "authors": "Brownlee GG, Sharps JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-168325", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168325" } ], "reference": [ { "type": "PubMed", "id": "12072510", "url": "https://glygen.org/publication/PubMed/12072510" } ] }, { "title": "The exon junction complex is detected on CBP80-bound but not eIF4E-bound mRNA in mammalian cells: dynamics of mRNP remodeling.", "journal": "The EMBO journal", "date": "2002", "authors": "Lejeune F, Ishigaki Y, Li X, Maquat LE", "evidence": [ { "database": "Reactome", "id": "R-HSA-159236", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159236" } ], "reference": [ { "type": "PubMed", "id": "12093754", "url": "https://glygen.org/publication/PubMed/12093754" } ] }, { "title": "SMN, the spinal muscular atrophy protein, forms a pre-import snRNP complex with snurportin1 and importin beta.", "journal": "Human molecular genetics", "date": "2002", "authors": "Narayanan U, Ospina JK, Frey MR, Hebert MD, Matera AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-191859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-191859" } ], "reference": [ { "type": "PubMed", "id": "12095920", "url": "https://glygen.org/publication/PubMed/12095920" } ] }, { "title": "Steady-state nuclear localization of exportin-t involves RanGTP binding and two distinct nuclear pore complex interaction domains.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Kuersten S, Arts GJ, Walther TC, Englmeier L, Mattaj IW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531" } ], "reference": [ { "type": "PubMed", "id": "12138183", "url": "https://glygen.org/publication/PubMed/12138183" } ] }, { "title": "Sumoylation of topoisomerase I is involved in its partitioning between nucleoli and nucleoplasm and its clearing from nucleoli in response to camptothecin.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Rallabhandi P, Hashimoto K, Mo YY, Beck WT, Moitra PK, D'Arpa P", "evidence": [ { "database": "Reactome", "id": "R-HSA-4615885", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4615885" } ], "reference": [ { "type": "PubMed", "id": "12149243", "url": "https://glygen.org/publication/PubMed/12149243" } ] }, { "title": "Proteomic analysis of the mammalian nuclear pore complex.", "journal": "The Journal of cell biology", "date": "2002", "authors": "Cronshaw JM, Krutchinsky AN, Zhang W, Chait BT, Matunis MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-4570464", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4570464" } ], "reference": [ { "type": "PubMed", "id": "12196509", "url": "https://glygen.org/publication/PubMed/12196509" } ] }, { "title": "Docking of HIV-1 Vpr to the nuclear envelope is mediated by the interaction with the nucleoporin hCG1.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Le Rouzic E, Mousnier A, Rustum C, Stutz F, Hallberg E, Dargemont C, Benichou S", "evidence": [ { "database": "Reactome", "id": "R-HSA-180910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180910" } ], "reference": [ { "type": "PubMed", "id": "12228227", "url": "https://glygen.org/publication/PubMed/12228227" } ] }, { "title": "Sumoylation of Mdm2 by protein inhibitor of activated STAT (PIAS) and RanBP2 enzymes.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Miyauchi Y, Yogosawa S, Honda R, Nishida T, Yasuda H", "evidence": [ { "database": "Reactome", "id": "R-HSA-3232142", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3232142" } ], "reference": [ { "type": "PubMed", "id": "12393906", "url": "https://glygen.org/publication/PubMed/12393906" } ] }, { "title": "SMN-mediated assembly of RNPs: a complex story.", "journal": "Trends in cell biology", "date": "2002", "authors": "Meister G, Eggert C, Fischer U", "evidence": [ { "database": "Reactome", "id": "R-HSA-191859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-191859" } ], "reference": [ { "type": "PubMed", "id": "12441251", "url": "https://glygen.org/publication/PubMed/12441251" } ] }, { "title": "Overlapping motifs (PTAP and PPEY) within the Ebola virus VP40 protein function independently as late budding domains: involvement of host proteins TSG101 and VPS-4.", "journal": "Journal of virology", "date": "2003", "authors": "Licata JM, Simpson-Holley M, Wright NT, Han Z, Paragas J, Harty RN", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "12525615", "url": "https://glygen.org/publication/PubMed/12525615" } ] }, { "title": "Crystal structures of the Bacillus stearothermophilus CCA-adding enzyme and its complexes with ATP or CTP.", "journal": "Cell", "date": "2002", "authors": "Li F, Xiong Y, Wang J, Cho HD, Tomita K, Weiner AM, Steitz TA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531" } ], "reference": [ { "type": "PubMed", "id": "12526808", "url": "https://glygen.org/publication/PubMed/12526808" } ] }, { "title": "High-throughput immunoblotting. Ubiquitiin-like protein ISG15 modifies key regulators of signal transduction.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Malakhov MP, Kim KI, Malakhova OA, Jacobs BS, Borden EC, Zhang DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "12582176", "url": "https://glygen.org/publication/PubMed/12582176" } ] }, { "title": "Nup98 localizes to both nuclear and cytoplasmic sides of the nuclear pore and binds to two distinct nucleoporin subcomplexes.", "journal": "Molecular biology of the cell", "date": "2003", "authors": "Griffis ER, Xu S, Powers MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3301854", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3301854" } ], "reference": [ { "type": "PubMed", "id": "12589057", "url": "https://glygen.org/publication/PubMed/12589057" } ] }, { "title": "IKKepsilon and TBK1 are essential components of the IRF3 signaling pathway.", "journal": "Nature immunology", "date": "2003", "authors": "Fitzgerald KA, McWhirter SM, Faia KL, Rowe DC, Latz E, Golenbock DT, Coyle AJ, Liao SM, Maniatis T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "12692549", "url": "https://glygen.org/publication/PubMed/12692549" } ] }, { "title": "A candidate prostate cancer susceptibility gene encodes tRNA 3' processing endoribonuclease.", "journal": "Nucleic acids research", "date": "2003", "authors": "Takaku H, Minagawa A, Takagi M, Nashimoto M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531" } ], "reference": [ { "type": "PubMed", "id": "12711671", "url": "https://glygen.org/publication/PubMed/12711671" } ] }, { "title": "Crystal structure of the human CCA-adding enzyme: insights into template-independent polymerization.", "journal": "Journal of molecular biology", "date": "2003", "authors": "Augustin MA, Reichert AS, Betat H, Huber R, Morl M, Steegborn C", "evidence": [ { "database": "Reactome", "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531" } ], "reference": [ { "type": "PubMed", "id": "12729736", "url": "https://glygen.org/publication/PubMed/12729736" } ] }, { "title": "Cutting edge: Monarch-1: a pyrin/nucleotide-binding domain/leucine-rich repeat protein that controls classical and nonclassical MHC class I genes.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2003", "authors": "Williams KL, Taxman DJ, Linhoff MW, Reed W, Ting JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "12759408", "url": "https://glygen.org/publication/PubMed/12759408" } ] }, { "title": "Interaction between the small-nuclear-RNA cap hypermethylase and the spinal muscular atrophy protein, survival of motor neuron.", "journal": "EMBO reports", "date": "2003", "authors": "Mouaikel J, Narayanan U, Verheggen C, Matera AG, Bertrand E, Tazi J, Bordonne R", "evidence": [ { "database": "Reactome", "id": "R-HSA-191859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-191859" } ], "reference": [ { "type": "PubMed", "id": "12776181", "url": "https://glygen.org/publication/PubMed/12776181" } ] }, { "title": "Direct interaction with nup153 mediates binding of Tpr to the periphery of the nuclear pore complex.", "journal": "Molecular biology of the cell", "date": "2003", "authors": "Hase ME, Cordes VC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5619107", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5619107" } ], "reference": [ { "type": "PubMed", "id": "12802065", "url": "https://glygen.org/publication/PubMed/12802065" } ] }, { "title": "The SUMO pathway is required for selective degradation of DNA topoisomerase IIbeta induced by a catalytic inhibitor ICRF-193(1).", "journal": "FEBS letters", "date": "2003", "authors": "Isik S, Sano K, Tsutsui K, Seki M, Enomoto T, Saitoh H, Tsutsui K", "evidence": [ { "database": "Reactome", "id": "R-HSA-4615885", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4615885" } ], "reference": [ { "type": "PubMed", "id": "12832072", "url": "https://glygen.org/publication/PubMed/12832072" } ] }, { "title": "Cofactor Tpr2 combines two TPR domains and a J domain to regulate the Hsp70/Hsp90 chaperone system.", "journal": "The EMBO journal", "date": "2003", "authors": "Brychzy A, Rein T, Winklhofer KF, Hartl FU, Young JC, Obermann WM", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371453", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371453" } ], "reference": [ { "type": "PubMed", "id": "12853476", "url": "https://glygen.org/publication/PubMed/12853476" } ] }, { "title": "Microtubule network facilitates nuclear targeting of human cytomegalovirus capsid.", "journal": "Journal of virology", "date": "2003", "authors": "Ogawa-Goto K, Tanaka K, Gibson W, Moriishi E, Miura Y, Kurata T, Irie S, Sata T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690" } ], "reference": [ { "type": "PubMed", "id": "12857923", "url": "https://glygen.org/publication/PubMed/12857923" } ] }, { "title": "Regulation of molecular chaperone gene transcription involves the serine phosphorylation, 14-3-3 epsilon binding, and cytoplasmic sequestration of heat shock factor 1.", "journal": "Molecular and cellular biology", "date": "2003", "authors": "Wang X, Grammatikakis N, Siganou A, Calderwood SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371453", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371453" } ], "reference": [ { "type": "PubMed", "id": "12917326", "url": "https://glygen.org/publication/PubMed/12917326" } ] }, { "title": "Characterization of two isoforms of a human DnaJ homologue, HSJ2.", "journal": "Molecular biology reports", "date": "2003", "authors": "Hanai R, Mashima K", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371453", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371453" } ], "reference": [ { "type": "PubMed", "id": "12974469", "url": "https://glygen.org/publication/PubMed/12974469" } ] }, { "title": "The GW182 protein colocalizes with mRNA degradation associated proteins hDcp1 and hLSm4 in cytoplasmic GW bodies.", "journal": "RNA (New York, N.Y.)", "date": "2003", "authors": "Eystathioy T, Jakymiw A, Chan EK, Seraphin B, Cougot N, Fritzler MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "13130130", "url": "https://glygen.org/publication/PubMed/13130130" } ] }, { "title": "The DNA topoisomerase I binding protein topors as a novel cellular target for SUMO-1 modification: characterization of domains necessary for subcellular localization and sumolation.", "journal": "Experimental cell research", "date": "2003", "authors": "Weger S, Hammer E, Engstler M", "evidence": [ { "database": "Reactome", "id": "R-HSA-4085377", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4085377" } ], "reference": [ { "type": "PubMed", "id": "14516784", "url": "https://glygen.org/publication/PubMed/14516784" } ] }, { "title": "Histone sumoylation is associated with transcriptional repression.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2003", "authors": "Shiio Y, Eisenman RN", "evidence": [ { "database": "Reactome", "id": "R-HSA-4551638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4551638" } ], "reference": [ { "type": "PubMed", "id": "14578449", "url": "https://glygen.org/publication/PubMed/14578449" } ] }, { "title": "Differences in regulatory properties between human and rat glucokinase regulatory protein.", "journal": "The Biochemical journal", "date": "2004", "authors": "Brocklehurst KJ, Davies RA, Agius L", "evidence": [ { "database": "Reactome", "id": "R-HSA-170822", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-170822" } ], "reference": [ { "type": "PubMed", "id": "14627435", "url": "https://glygen.org/publication/PubMed/14627435" } ] }, { "title": "The mRNA export factor human Gle1 interacts with the nuclear pore complex protein Nup155.", "journal": "Mol. Cell. Proteomics", "date": "2004", "authors": "Rayala HJ, Kendirgi F, Barry DM, Majerus PW, Wente SR", "evidence": [ { "database": "UniProtKB", "id": "O75694", "url": "https://www.uniprot.org/uniprot/O75694" } ], "reference": [ { "type": "PubMed", "id": "14645504", "url": "https://glygen.org/publication/PubMed/14645504" } ] }, { "title": "SUMO modification of a novel MAR-binding protein, SATB2, modulates immunoglobulin mu gene expression.", "journal": "Genes & development", "date": "2003", "authors": "Dobreva G, Dambacher J, Grosschedl R", "evidence": [ { "database": "Reactome", "id": "R-HSA-4551638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4551638" } ], "reference": [ { "type": "PubMed", "id": "14701874", "url": "https://glygen.org/publication/PubMed/14701874" } ] }, { "title": "SUMO modification of heterogeneous nuclear ribonucleoproteins.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Vassileva MT, Matunis MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-4570464", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4570464" } ], "reference": [ { "type": "PubMed", "id": "15082759", "url": "https://glygen.org/publication/PubMed/15082759" } ] }, { "title": "Identification of a human endonuclease complex reveals a link between tRNA splicing and pre-mRNA 3' end formation.", "journal": "Cell", "date": "2004", "authors": "Paushkin SV, Patel M, Furia BS, Peltz SW, Trotta CR", "evidence": [ { "database": "Reactome", "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531" } ], "reference": [ { "type": "PubMed", "id": "15109492", "url": "https://glygen.org/publication/PubMed/15109492" } ] }, { "title": "Nuclear export of mRNA: from the site of transcription to the cytoplasm.", "journal": "Experimental cell research", "date": "2004", "authors": "Erkmann JA, Kutay U", "evidence": [ { "database": "Reactome", "id": "R-HSA-159231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159231" } ], "reference": [ { "type": "PubMed", "id": "15120988", "url": "https://glygen.org/publication/PubMed/15120988" } ] }, { "title": "The UbcH8 ubiquitin E2 enzyme is also the E2 enzyme for ISG15, an IFN-alpha/beta-induced ubiquitin-like protein.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Zhao C, Beaudenon SL, Kelley ML, Waddell MB, Yuan W, Schulman BA, Huibregtse JM, Krug RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "15131269", "url": "https://glygen.org/publication/PubMed/15131269" } ] }, { "title": "Sumoylation of heterogeneous nuclear ribonucleoproteins, zinc finger proteins, and nuclear pore complex proteins: a proteomic analysis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Li T, Evdokimov E, Shen RF, Chao CC, Tekle E, Wang T, Stadtman ER, Yang DC, Chock PB", "evidence": [ { "database": "Reactome", "id": "R-HSA-4570464", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4570464" } ], "reference": [ { "type": "PubMed", "id": "15161980", "url": "https://glygen.org/publication/PubMed/15161980" } ] }, { "title": "A proteomic study of SUMO-2 target proteins.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Vertegaal AC, Ogg SC, Jaffray E, Rodriguez MS, Hay RT, Andersen JS, Mann M, Lamond AI", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "15175327", "url": "https://glygen.org/publication/PubMed/15175327" } ] }, { "title": "SENP1 enhances androgen receptor-dependent transcription through desumoylation of histone deacetylase 1.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Cheng J, Wang D, Wang Z, Yeh ET", "evidence": [ { "database": "Reactome", "id": "R-HSA-4551638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4551638" } ], "reference": [ { "type": "PubMed", "id": "15199155", "url": "https://glygen.org/publication/PubMed/15199155" } ] }, { "title": "The RNA helicase RIG-I has an essential function in double-stranded RNA-induced innate antiviral responses.", "journal": "Nature immunology", "date": "2004", "authors": "Yoneyama M, Kikuchi M, Natsukawa T, Shinobu N, Imaizumi T, Miyagishi M, Taira K, Akira S, Fujita T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "15208624", "url": "https://glygen.org/publication/PubMed/15208624" } ] }, { "title": "Nucleocytoplasmic transport: the influenza virus NS1 protein regulates the transport of spliced NS2 mRNA and its precursor NS1 mRNA.", "journal": "Genes & development", "date": "1992", "authors": "Alonso-Caplen FV, Nemeroff ME, Qiu Y, Krug RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-168325", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168325" } ], "reference": [ { "type": "PubMed", "id": "1531330", "url": "https://glygen.org/publication/PubMed/1531330" } ] }, { "title": "The N-terminal half-domain of the long form of tRNase Z is required for the RNase 65 activity.", "journal": "Nucleic acids research", "date": "2004", "authors": "Takaku H, Minagawa A, Takagi M, Nashimoto M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531" } ], "reference": [ { "type": "PubMed", "id": "15317868", "url": "https://glygen.org/publication/PubMed/15317868" } ] }, { "title": "p14 Arf promotes small ubiquitin-like modifier conjugation of Werners helicase.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Woods YL, Xirodimas DP, Prescott AR, Sparks A, Lane DP, Saville MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "15355988", "url": "https://glygen.org/publication/PubMed/15355988" } ] }, { "title": "Interactions between extracellular signal-regulated protein kinase 1, 14-3-3epsilon, and heat shock factor 1 during stress.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Wang X, Grammatikakis N, Siganou A, Stevenson MA, Calderwood SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371453", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371453" } ], "reference": [ { "type": "PubMed", "id": "15364926", "url": "https://glygen.org/publication/PubMed/15364926" } ] }, { "title": "The RanBP2 SUMO E3 ligase is neither HECT- nor RING-type.", "journal": "Nature structural & molecular biology", "date": "2004", "authors": "Pichler A, Knipscheer P, Saitoh H, Sixma TK, Melchior F", "evidence": [ { "database": "Reactome", "id": "R-HSA-4085377", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4085377" } ], "reference": [ { "type": "PubMed", "id": "15378033", "url": "https://glygen.org/publication/PubMed/15378033" } ] }, { "title": "Interferon-inducible ubiquitin E2, Ubc8, is a conjugating enzyme for protein ISGylation.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Kim KI, Giannakopoulos NV, Virgin HW, Zhang DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "15485925", "url": "https://glygen.org/publication/PubMed/15485925" } ] }, { "title": "Architecture of CRM1/Exportin1 suggests how cooperativity is achieved during formation of a nuclear export complex.", "journal": "Molecular cell", "date": "2004", "authors": "Petosa C, Schoehn G, Askjaer P, Bauer U, Moulin M, Steuerwald U, Soler-Lopez M, Baudin F, Mattaj IW, Muller CW", "evidence": [ { "database": "Reactome", "id": "R-HSA-168333", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168333" } ], "reference": [ { "type": "PubMed", "id": "15574331", "url": "https://glygen.org/publication/PubMed/15574331" } ] }, { "title": "Multiple activities contribute to Pc2 E3 function.", "journal": "The EMBO journal", "date": "2005", "authors": "Kagey MH, Melhuish TA, Powers SE, Wotton D", "evidence": [ { "database": "Reactome", "id": "R-HSA-4551638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4551638" } ], "reference": [ { "type": "PubMed", "id": "15592428", "url": "https://glygen.org/publication/PubMed/15592428" } ] }, { "title": "Unique binding interactions among Ubc9, SUMO and RanBP2 reveal a mechanism for SUMO paralog selection.", "journal": "Nature structural & molecular biology", "date": "2005", "authors": "Tatham MH, Kim S, Jaffray E, Song J, Chen Y, Hay RT", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "15608651", "url": "https://glygen.org/publication/PubMed/15608651" } ] }, { "title": "Specific and potent RNAi in the nucleus of human cells.", "journal": "Nature structural & molecular biology", "date": "2005", "authors": "Robb GB, Brown KM, Khurana J, Rana TM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "15643423", "url": "https://glygen.org/publication/PubMed/15643423" } ] }, { "title": "An unconventional NLS is critical for the nuclear import of the influenza A virus nucleoprotein and ribonucleoprotein.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2005", "authors": "Cros JF, Garcia-Sastre A, Palese P", "evidence": [ { "database": "Reactome", "id": "R-HSA-168271", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168271" } ], "reference": [ { "type": "PubMed", "id": "15702989", "url": "https://glygen.org/publication/PubMed/15702989" } ] }, { "title": "Vertebrate Nup53 interacts with the nuclear lamina and is required for the assembly of a Nup93-containing complex.", "journal": "Mol. Biol. Cell", "date": "2005", "authors": "Hawryluk-Gara LA, Shibuya EK, Wozniak RW", "evidence": [ { "database": "UniProtKB", "id": "O75694", "url": "https://www.uniprot.org/uniprot/O75694" } ], "reference": [ { "type": "PubMed", "id": "15703211", "url": "https://glygen.org/publication/PubMed/15703211" } ] }, { "title": "Importin-alpha promotes passage through the nuclear pore complex of human immunodeficiency virus type 1 Vpr.", "journal": "Journal of virology", "date": "2005", "authors": "Kamata M, Nitahara-Kasahara Y, Miyamoto Y, Yoneda Y, Aida Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-180910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180910" } ], "reference": [ { "type": "PubMed", "id": "15731250", "url": "https://glygen.org/publication/PubMed/15731250" } ] }, { "title": "Human Mpp11 J protein: ribosome-tethered molecular chaperones are ubiquitous.", "journal": "Science (New York, N.Y.)", "date": "2005", "authors": "Hundley HA, Walter W, Bairstow S, Craig EA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371453", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371453" } ], "reference": [ { "type": "PubMed", "id": "15802566", "url": "https://glygen.org/publication/PubMed/15802566" } ] }, { "title": "Functionality of human thymine DNA glycosylase requires SUMO-regulated changes in protein conformation.", "journal": "Current biology : CB", "date": "2005", "authors": "Steinacher R, Schar P", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "15823533", "url": "https://glygen.org/publication/PubMed/15823533" } ] }, { "title": "Intra-nuclear trafficking of the BLM helicase to DNA damage-induced foci is regulated by SUMO modification.", "journal": "Human molecular genetics", "date": "2005", "authors": "Eladad S, Ye TZ, Hu P, Leversha M, Beresten S, Matunis MJ, Ellis NA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "15829507", "url": "https://glygen.org/publication/PubMed/15829507" } ] }, { "title": "SUMO-1 modification of PIASy, an E3 ligase, is necessary for PIASy-dependent activation of Tcf-4.", "journal": "Molecular and cellular biology", "date": "2005", "authors": "Ihara M, Yamamoto H, Kikuchi A", "evidence": [ { "database": "Reactome", "id": "R-HSA-4085377", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4085377" } ], "reference": [ { "type": "PubMed", "id": "15831457", "url": "https://glygen.org/publication/PubMed/15831457" } ] }, { "title": "Intracellular localization and partial amino acid sequence of a stress-inducible 40-kDa protein in HeLa cells.", "journal": "Cell structure and function", "date": "1992", "authors": "Hattori H, Liu YC, Tohnai I, Ueda M, Kaneda T, Kobayashi T, Tanabe K, Ohtsuka K", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371453", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371453" } ], "reference": [ { "type": "PubMed", "id": "1586970", "url": "https://glygen.org/publication/PubMed/1586970" } ] }, { "title": "SUMO-modified PCNA recruits Srs2 to prevent recombination during S phase.", "journal": "Nature", "date": "2005", "authors": "Pfander B, Moldovan GL, Sacher M, Hoege C, Jentsch S", "evidence": [ { "database": "Reactome", "id": "R-HSA-4615885", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4615885" } ], "reference": [ { "type": "PubMed", "id": "15931174", "url": "https://glygen.org/publication/PubMed/15931174" } ] }, { "title": "Stabilization of PML nuclear localization by conjugation and oligomerization of SUMO-3.", "journal": "Oncogene", "date": "2005", "authors": "Fu C, Ahmed K, Ding H, Ding X, Lan J, Yang Z, Miao Y, Zhu Y, Shi Y, Zhu J, Huang H, Yao X", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "15940266", "url": "https://glygen.org/publication/PubMed/15940266" } ] }, { "title": "Crystal structure of thymine DNA glycosylase conjugated to SUMO-1.", "journal": "Nature", "date": "2005", "authors": "Baba D, Maita N, Jee JG, Uchimura Y, Saitoh H, Sugasawa K, Hanaoka F, Tochio H, Hiroaki H, Shirakawa M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "15959518", "url": "https://glygen.org/publication/PubMed/15959518" } ] }, { "title": "Crosstalk between SUMO and ubiquitin on PCNA is mediated by recruitment of the helicase Srs2p.", "journal": "Molecular cell", "date": "2005", "authors": "Papouli E, Chen S, Davies AA, Huttner D, Krejci L, Sung P, Ulrich HD", "evidence": [ { "database": "Reactome", "id": "R-HSA-4615885", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4615885" } ], "reference": [ { "type": "PubMed", "id": "15989970", "url": "https://glygen.org/publication/PubMed/15989970" } ] }, { "title": "Human ISG15 conjugation targets both IFN-induced and constitutively expressed proteins functioning in diverse cellular pathways.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Zhao C, Denison C, Huibregtse JM, Gygi S, Krug RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "16009940", "url": "https://glygen.org/publication/PubMed/16009940" } ] }, { "title": "DNA repair factor XPC is modified by SUMO-1 and ubiquitin following UV irradiation.", "journal": "Nucleic acids research", "date": "2005", "authors": "Wang QE, Zhu Q, Wani G, El-Mahdy MA, Li J, Wani AA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "16030353", "url": "https://glygen.org/publication/PubMed/16030353" } ] }, { "title": "ISG15 modification of Ubc13 suppresses its ubiquitin-conjugating activity.", "journal": "Biochemical and biophysical research communications", "date": "2005", "authors": "Takeuchi T, Yokosawa H", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "16112642", "url": "https://glygen.org/publication/PubMed/16112642" } ] }, { "title": "ISG15 modification of ubiquitin E2 Ubc13 disrupts its ability to form thioester bond with ubiquitin.", "journal": "Biochemical and biophysical research communications", "date": "2005", "authors": "Zou W, Papov V, Malakhova O, Kim KI, Dao C, Li J, Zhang DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "16122702", "url": "https://glygen.org/publication/PubMed/16122702" } ] }, { "title": "Proteomic identification of proteins conjugated to ISG15 in mouse and human cells.", "journal": "Biochemical and biophysical research communications", "date": "2005", "authors": "Giannakopoulos NV, Luo JK, Papov V, Zou W, Lenschow DJ, Jacobs BS, Borden EC, Li J, Virgin HW, Zhang DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "16139798", "url": "https://glygen.org/publication/PubMed/16139798" } ] }, { "title": "Deletion of gpUL132, a structural component of human cytomegalovirus, results in impaired virus replication in fibroblasts.", "journal": "Journal of virology", "date": "2005", "authors": "Spaderna S, Kropff B, Kodel Y, Shen S, Coley S, Lu S, Britt W, Mach M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690" } ], "reference": [ { "type": "PubMed", "id": "16140760", "url": "https://glygen.org/publication/PubMed/16140760" } ] }, { "title": "Fourier transform ion cyclotron resonance mass spectrometry for the analysis of small ubiquitin-like modifier (SUMO) modification: identification of lysines in RanBP2 and SUMO targeted for modification during the E3 autoSUMOylation reaction.", "journal": "Analytical chemistry", "date": "2005", "authors": "Cooper HJ, Tatham MH, Jaffray E, Heath JK, Lam TT, Marshall AG, Hay RT", "evidence": [ { "database": "Reactome", "id": "R-HSA-4085377", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4085377" } ], "reference": [ { "type": "PubMed", "id": "16194093", "url": "https://glygen.org/publication/PubMed/16194093" } ] }, { "title": "Phosphorylation of HSF1 by MAPK-activated protein kinase 2 on serine 121, inhibits transcriptional activity and promotes HSP90 binding.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Wang X, Khaleque MA, Zhao MJ, Zhong R, Gaestel M, Calderwood SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371453", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371453" } ], "reference": [ { "type": "PubMed", "id": "16278218", "url": "https://glygen.org/publication/PubMed/16278218" } ] }, { "title": "Mutations in tap uncouple RNA export activity from translocation through the nuclear pore complex.", "journal": "Molecular biology of the cell", "date": "2006", "authors": "Levesque L, Bor YC, Matzat LH, Jin L, Berberoglu S, Rekosh D, Hammarskjold ML, Paschal BM", "evidence": [ { "database": "Reactome", "id": "R-HSA-159236", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159236" } ], "reference": [ { "type": "PubMed", "id": "16314397", "url": "https://glygen.org/publication/PubMed/16314397" } ] }, { "title": "The interferon-inducible ubiquitin-protein isopeptide ligase (E3) EFP also functions as an ISG15 E3 ligase.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Zou W, Zhang DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "16352599", "url": "https://glygen.org/publication/PubMed/16352599" } ] }, { "title": "Naturally occurring mutations in human mitochondrial pre-tRNASer(UCN) can affect the transfer ribonuclease Z cleavage site, processing kinetics, and substrate secondary structure.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Yan H, Zareen N, Levinger L", "evidence": [ { "database": "Reactome", "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531" } ], "reference": [ { "type": "PubMed", "id": "16361254", "url": "https://glygen.org/publication/PubMed/16361254" } ] }, { "title": "The antisense strand of small interfering RNAs directs histone methylation and transcriptional gene silencing in human cells.", "journal": "RNA (New York, N.Y.)", "date": "2006", "authors": "Weinberg MS, Villeneuve LM, Ehsani A, Amarzguioui M, Aagaard L, Chen ZX, Riggs AD, Rossi JJ, Morris KV", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "16373483", "url": "https://glygen.org/publication/PubMed/16373483" } ] }, { "title": "Herc5, an interferon-induced HECT E3 enzyme, is required for conjugation of ISG15 in human cells.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Dastur A, Beaudenon S, Kelley M, Krug RM, Huibregtse JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "16407192", "url": "https://glygen.org/publication/PubMed/16407192" } ] }, { "title": "Link between the ubiquitin conjugation system and the ISG15 conjugation system: ISG15 conjugation to the UbcH6 ubiquitin E2 enzyme.", "journal": "Journal of biochemistry", "date": "2005", "authors": "Takeuchi T, Iwahara S, Saeki Y, Sasajima H, Yokosawa H", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "16428300", "url": "https://glygen.org/publication/PubMed/16428300" } ] }, { "title": "SUMO modification of human XRCC4 regulates its localization and function in DNA double-strand break repair.", "journal": "Molecular and cellular biology", "date": "2006", "authors": "Yurchenko V, Xue Z, Sadofsky MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "16478998", "url": "https://glygen.org/publication/PubMed/16478998" } ] }, { "title": "Characterization of a family of nucleolar SUMO-specific proteases with preference for SUMO-2 or SUMO-3.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Gong L, Yeh ET", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "16608850", "url": "https://glygen.org/publication/PubMed/16608850" } ] }, { "title": "Membrane accumulation of influenza A virus hemagglutinin triggers nuclear export of the viral genome via protein kinase Calpha-mediated activation of ERK signaling.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Marjuki H, Alam MI, Ehrhardt C, Wagner R, Planz O, Klenk HD, Ludwig S, Pleschka S", "evidence": [ { "database": "Reactome", "id": "R-HSA-168333", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168333" } ], "reference": [ { "type": "PubMed", "id": "16608852", "url": "https://glygen.org/publication/PubMed/16608852" } ] }, { "title": "Crystal structure of SUMO-3-modified thymine-DNA glycosylase.", "journal": "Journal of molecular biology", "date": "2006", "authors": "Baba D, Maita N, Jee JG, Uchimura Y, Saitoh H, Sugasawa K, Hanaoka F, Tochio H, Hiroaki H, Shirakawa M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "16626738", "url": "https://glygen.org/publication/PubMed/16626738" } ] }, { "title": "In situ SUMOylation analysis reveals a modulatory role of RanBP2 in the nuclear rim and PML bodies.", "journal": "Experimental cell research", "date": "2006", "authors": "Saitoh N, Uchimura Y, Tachibana T, Sugahara S, Saitoh H, Nakao M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "16688858", "url": "https://glygen.org/publication/PubMed/16688858" } ] }, { "title": "Negative regulation of interferon-regulatory factor 3-dependent innate antiviral response by the prolyl isomerase Pin1.", "journal": "Nature immunology", "date": "2006", "authors": "Saitoh T, Tun-Kyi A, Ryo A, Yamamoto M, Finn G, Fujita T, Akira S, Yamamoto N, Lu KP, Yamaoka S", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "16699525", "url": "https://glygen.org/publication/PubMed/16699525" } ] }, { "title": "Cleavage of pre-tRNAs by the splicing endonuclease requires a composite active site.", "journal": "Nature", "date": "2006", "authors": "Trotta CR, Paushkin SV, Patel M, Li H, Peltz SW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531" } ], "reference": [ { "type": "PubMed", "id": "16710424", "url": "https://glygen.org/publication/PubMed/16710424" } ] }, { "title": "Pin-ning down immune responses to RNA viruses.", "journal": "Nature immunology", "date": "2006", "authors": "Goutagny N, Severa M, Fitzgerald KA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "16715065", "url": "https://glygen.org/publication/PubMed/16715065" } ] }, { "title": "Cumulative mutations of ubiquitin acceptor sites in human immunodeficiency virus type 1 gag cause a late budding defect.", "journal": "Journal of virology", "date": "2006", "authors": "Gottwein E, Jager S, Habermann A, Krausslich HG", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "16775314", "url": "https://glygen.org/publication/PubMed/16775314" } ] }, { "title": "Human SMC5/6 complex promotes sister chromatid homologous recombination by recruiting the SMC1/3 cohesin complex to double-strand breaks.", "journal": "The EMBO journal", "date": "2006", "authors": "Potts PR, Porteus MH, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "16810316", "url": "https://glygen.org/publication/PubMed/16810316" } ] }, { "title": "HERC5 is an IFN-induced HECT-type E3 protein ligase that mediates type I IFN-induced ISGylation of protein targets.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Wong JJ, Pung YF, Sze NS, Chin KC", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "16815975", "url": "https://glygen.org/publication/PubMed/16815975" } ] }, { "title": "Negative regulation of protein phosphatase 2Cbeta by ISG15 conjugation.", "journal": "FEBS letters", "date": "2006", "authors": "Takeuchi T, Kobayashi T, Tamura S, Yokosawa H", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "16872604", "url": "https://glygen.org/publication/PubMed/16872604" } ] }, { "title": "ISG15 enhances the innate antiviral response by inhibition of IRF-3 degradation.", "journal": "Cellular and molecular biology (Noisy-le-Grand, France)", "date": "2006", "authors": "Lu G, Reinert JT, Pitha-Rowe I, Okumura A, Kellum M, Knobeloch KP, Hassel B, Pitha PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "16914094", "url": "https://glygen.org/publication/PubMed/16914094" } ] }, { "title": "Functional association between viral and cellular transcription during influenza virus infection.", "journal": "Reviews in medical virology", "date": "2006", "authors": "Engelhardt OG, Fodor E", "evidence": [ { "database": "Reactome", "id": "R-HSA-168325", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168325" } ], "reference": [ { "type": "PubMed", "id": "16933365", "url": "https://glygen.org/publication/PubMed/16933365" } ] }, { "title": "Argonaute-1 directs siRNA-mediated transcriptional gene silencing in human cells.", "journal": "Nature structural & molecular biology", "date": "2006", "authors": "Kim DH, Villeneuve LM, Morris KV, Rossi JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "16936726", "url": "https://glygen.org/publication/PubMed/16936726" } ] }, { "title": "The solution structure of REF2-I reveals interdomain interactions and regions involved in binding mRNA export factors and RNA.", "journal": "RNA (New York, N.Y.)", "date": "2006", "authors": "Golovanov AP, Hautbergue GM, Tintaru AM, Lian LY, Wilson SA", "evidence": [ { "database": "Reactome", "id": "R-HSA-159236", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159236" } ], "reference": [ { "type": "PubMed", "id": "17000901", "url": "https://glygen.org/publication/PubMed/17000901" } ] }, { "title": "Phosphorylation-dependent control of Pc2 SUMO E3 ligase activity by its substrate protein HIPK2.", "journal": "Molecular cell", "date": "2006", "authors": "Roscic A, Moller A, Calzado MA, Renner F, Wimmer VC, Gresko E, Ludi KS, Schmitz ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-4551638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4551638" } ], "reference": [ { "type": "PubMed", "id": "17018294", "url": "https://glygen.org/publication/PubMed/17018294" } ] }, { "title": "Nuclear traffic of influenza virus proteins and ribonucleoprotein complexes.", "journal": "Virus research", "date": "2007", "authors": "Boulo S, Akarsu H, Ruigrok RW, Baudin F", "evidence": [ { "database": "Reactome", "id": "R-HSA-168333", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168333" } ], "reference": [ { "type": "PubMed", "id": "17081640", "url": "https://glygen.org/publication/PubMed/17081640" } ] }, { "title": "Small dsRNAs induce transcriptional activation in human cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Li LC, Okino ST, Zhao H, Pookot D, Place RF, Urakami S, Enokida H, Dahiya R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "17085592", "url": "https://glygen.org/publication/PubMed/17085592" } ] }, { "title": "ELYS is a dual nucleoporin/kinetochore protein required for nuclear pore assembly and proper cell division.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Rasala BA, Orjalo AV, Shen Z, Briggs S, Forbes DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9615933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9615933" } ], "reference": [ { "type": "PubMed", "id": "17098863", "url": "https://glygen.org/publication/PubMed/17098863" } ] }, { "title": "Nuclear export of influenza A virus mRNAs requires ongoing RNA polymerase II activity.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2007", "authors": "Amorim MJ, Read EK, Dalton RM, Medcalf L, Digard P", "evidence": [ { "database": "Reactome", "id": "R-HSA-168325", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168325" } ], "reference": [ { "type": "PubMed", "id": "17132145", "url": "https://glygen.org/publication/PubMed/17132145" } ] }, { "title": "PIASgamma is required for faithful chromosome segregation in human cells.", "journal": "PloS one", "date": "2006", "authors": "Diaz-Martinez LA, Gimenez-Abian JF, Azuma Y, Guacci V, Gimenez-Martin G, Lanier LM, Clarke DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-4615885", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4615885" } ], "reference": [ { "type": "PubMed", "id": "17183683", "url": "https://glygen.org/publication/PubMed/17183683" } ] }, { "title": "A splice variant of the human CCA-adding enzyme with modified activity.", "journal": "Journal of molecular biology", "date": "2007", "authors": "Lizano E, Schuster J, Muller M, Kelso J, Morl M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531" } ], "reference": [ { "type": "PubMed", "id": "17204286", "url": "https://glygen.org/publication/PubMed/17204286" } ] }, { "title": "Interaction of immobilized human exportin-t with calf liver tRNA.", "journal": "RNA biology", "date": "2006", "authors": "Li S, Sprinzl M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531" } ], "reference": [ { "type": "PubMed", "id": "17224653", "url": "https://glygen.org/publication/PubMed/17224653" } ] }, { "title": "MEL-28/ELYS is required for the recruitment of nucleoporins to chromatin and postmitotic nuclear pore complex assembly.", "journal": "EMBO reports", "date": "2007", "authors": "Franz C, Walczak R, Yavuz S, Santarella R, Gentzel M, Askjaer P, Galy V, Hetzer M, Mattaj IW, Antonin W", "evidence": [ { "database": "Reactome", "id": "R-HSA-9615933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9615933" } ], "reference": [ { "type": "PubMed", "id": "17235358", "url": "https://glygen.org/publication/PubMed/17235358" } ] }, { "title": "ISG15 modification of the eIF4E cognate 4EHP enhances cap structure-binding activity of 4EHP.", "journal": "Genes & development", "date": "2007", "authors": "Okumura F, Zou W, Zhang DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "17289916", "url": "https://glygen.org/publication/PubMed/17289916" } ] }, { "title": "CRM1-mediated nuclear export: to the pore and beyond.", "journal": "Trends in cell biology", "date": "2007", "authors": "Hutten S, Kehlenbach RH", "evidence": [ { "database": "Reactome", "id": "R-HSA-159231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159231" } ], "reference": [ { "type": "PubMed", "id": "17317185", "url": "https://glygen.org/publication/PubMed/17317185" } ] }, { "title": "Nuclear and nucleolar targeting of influenza A virus NS1 protein: striking differences between different virus subtypes.", "journal": "Journal of virology", "date": "2007", "authors": "Melen K, Kinnunen L, Fagerlund R, Ikonen N, Twu KY, Krug RM, Julkunen I", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "17376915", "url": "https://glygen.org/publication/PubMed/17376915" } ] }, { "title": "A human homologue of the Escherichia coli DnaJ heat-shock protein.", "journal": "Nucleic acids research", "date": "1991", "authors": "Raabe T, Manley JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371453", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371453" } ], "reference": [ { "type": "PubMed", "id": "1754405", "url": "https://glygen.org/publication/PubMed/1754405" } ] }, { "title": "Ubiquitylation-independent degradation of Xeroderma pigmentosum group C protein is required for efficient nucleotide excision repair.", "journal": "Nucleic acids research", "date": "2007", "authors": "Wang QE, Praetorius-Ibba M, Zhu Q, El-Mahdy MA, Wani G, Zhao Q, Qin S, Patnaik S, Wani AA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "17693435", "url": "https://glygen.org/publication/PubMed/17693435" } ] }, { "title": "An in vitro nuclear disassembly system reveals a role for the RanGTPase system and microtubule-dependent steps in nuclear envelope breakdown.", "journal": "The Journal of cell biology", "date": "2007", "authors": "Muhlhausser P, Kutay U", "evidence": [ { "database": "Reactome", "id": "R-HSA-3301854", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3301854" } ], "reference": [ { "type": "PubMed", "id": "17698605", "url": "https://glygen.org/publication/PubMed/17698605" } ] }, { "title": "Entry route of HCMV into endothelial cells.", "journal": "Journal of clinical virology : the official publication of the Pan American Society for Clinical Virology", "date": "2008", "authors": "Sinzger C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690" } ], "reference": [ { "type": "PubMed", "id": "18203656", "url": "https://glygen.org/publication/PubMed/18203656" } ] }, { "title": "A comparative analysis of CCA-adding enzymes from human and E. coli: differences in CCA addition and tRNA 3'-end repair.", "journal": "Biochimie", "date": "2008", "authors": "Lizano E, Scheibe M, Rammelt C, Betat H, Morl M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531" } ], "reference": [ { "type": "PubMed", "id": "18226598", "url": "https://glygen.org/publication/PubMed/18226598" } ] }, { "title": "MicroRNA-373 induces expression of genes with complementary promoter sequences.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Place RF, Li LC, Pookot D, Noonan EJ, Dahiya R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "18227514", "url": "https://glygen.org/publication/PubMed/18227514" } ] }, { "title": "DBC1 is a negative regulator of SIRT1.", "journal": "Nature", "date": "2008", "authors": "Kim JE, Chen J, Lou Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371453", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371453" } ], "reference": [ { "type": "PubMed", "id": "18235501", "url": "https://glygen.org/publication/PubMed/18235501" } ] }, { "title": "Negative regulation of the deacetylase SIRT1 by DBC1.", "journal": "Nature", "date": "2008", "authors": "Zhao W, Kruse JP, Tang Y, Jung SY, Qin J, Gu W", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371453", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371453" } ], "reference": [ { "type": "PubMed", "id": "18235502", "url": "https://glygen.org/publication/PubMed/18235502" } ] }, { "title": "ISG15 inhibits Nedd4 ubiquitin E3 activity and enhances the innate antiviral response.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Malakhova OA, Zhang DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "18287095", "url": "https://glygen.org/publication/PubMed/18287095" } ] }, { "title": "ISG15 inhibits Ebola VP40 VLP budding in an L-domain-dependent manner by blocking Nedd4 ligase activity.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Okumura A, Pitha PM, Harty RN", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "18305167", "url": "https://glygen.org/publication/PubMed/18305167" } ] }, { "title": "Systematic kinetic analysis of mitotic dis- and reassembly of the nuclear pore in living cells.", "journal": "The Journal of cell biology", "date": "2008", "authors": "Dultz E, Zanin E, Wurzenberger C, Braun M, Rabut G, Sironi L, Ellenberg J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9615933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9615933" } ], "reference": [ { "type": "PubMed", "id": "18316408", "url": "https://glygen.org/publication/PubMed/18316408" } ] }, { "title": "Mutually exclusive interactions drive handover of mRNA from export adaptors to TAP.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Hautbergue GM, Hung ML, Golovanov AP, Lian LY, Wilson SA", "evidence": [ { "database": "Reactome", "id": "R-HSA-159236", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159236" } ], "reference": [ { "type": "PubMed", "id": "18364396", "url": "https://glygen.org/publication/PubMed/18364396" } ] }, { "title": "Conjugation of human topoisomerase 2 alpha with small ubiquitin-like modifiers 2/3 in response to topoisomerase inhibitors: cell cycle stage and chromosome domain specificity.", "journal": "Cancer research", "date": "2008", "authors": "Agostinho M, Santos V, Ferreira F, Costa R, Cardoso J, Pinheiro I, Rino J, Jaffray E, Hay RT, Ferreira J", "evidence": [ { "database": "Reactome", "id": "R-HSA-4615885", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4615885" } ], "reference": [ { "type": "PubMed", "id": "18381449", "url": "https://glygen.org/publication/PubMed/18381449" } ] }, { "title": "Resolution of sister centromeres requires RanBP2-mediated SUMOylation of topoisomerase IIalpha.", "journal": "Cell", "date": "2008", "authors": "Dawlaty MM, Malureanu L, Jeganathan KB, Kao E, Sustmann C, Tahk S, Shuai K, Grosschedl R, van Deursen JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-4615885", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4615885" } ], "reference": [ { "type": "PubMed", "id": "18394993", "url": "https://glygen.org/publication/PubMed/18394993" } ] }, { "title": "SUMO conjugation to the matrix attachment region-binding protein, special AT-rich sequence-binding protein-1 (SATB1), targets SATB1 to promyelocytic nuclear bodies where it undergoes caspase cleavage.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Tan JA, Sun Y, Song J, Chen Y, Krontiris TG, Durrin LK", "evidence": [ { "database": "Reactome", "id": "R-HSA-4551638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4551638" } ], "reference": [ { "type": "PubMed", "id": "18408014", "url": "https://glygen.org/publication/PubMed/18408014" } ] }, { "title": "Binding of ATP to UAP56 is necessary for mRNA export.", "journal": "Journal of cell science", "date": "2008", "authors": "Kota KP, Wagner SR, Huerta E, Underwood JM, Nickerson JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-159236", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159236" } ], "reference": [ { "type": "PubMed", "id": "18411249", "url": "https://glygen.org/publication/PubMed/18411249" } ] }, { "title": "SKAR links pre-mRNA splicing to mTOR/S6K1-mediated enhanced translation efficiency of spliced mRNAs.", "journal": "Cell", "date": "2008", "authors": "Ma XM, Yoon SO, Richardson CJ, Julich K, Blenis J", "evidence": [ { "database": "Reactome", "id": "R-HSA-159236", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159236" } ], "reference": [ { "type": "PubMed", "id": "18423201", "url": "https://glygen.org/publication/PubMed/18423201" } ] }, { "title": "Tegument proteins of human cytomegalovirus.", "journal": "Microbiology and molecular biology reviews : MMBR", "date": "2008", "authors": "Kalejta RF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690" } ], "reference": [ { "type": "PubMed", "id": "18535146", "url": "https://glygen.org/publication/PubMed/18535146" } ] }, { "title": "Structure of the Hsp110:Hsc70 nucleotide exchange machine.", "journal": "Molecular cell", "date": "2008", "authors": "Schuermann JP, Jiang J, Cuellar J, Llorca O, Wang L, Gimenez LE, Jin S, Taylor AB, Demeler B, Morano KA, Hart PJ, Valpuesta JM, Lafer EM, Sousa R", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371453", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371453" } ], "reference": [ { "type": "PubMed", "id": "18550409", "url": "https://glygen.org/publication/PubMed/18550409" } ] }, { "title": "The basis for selective E1-E2 interactions in the ISG15 conjugation system.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Durfee LA, Kelley ML, Huibregtse JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "18583345", "url": "https://glygen.org/publication/PubMed/18583345" } ] }, { "title": "Histone deacetylase 7 promotes PML sumoylation and is essential for PML nuclear body formation.", "journal": "Molecular and cellular biology", "date": "2008", "authors": "Gao C, Ho CC, Reineke E, Lam M, Cheng X, Stanya KJ, Liu Y, Chakraborty S, Shih HM, Kao HY", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "18625722", "url": "https://glygen.org/publication/PubMed/18625722" } ] }, { "title": "The polycomb repressive complex 2 is a potential target of SUMO modifications.", "journal": "PloS one", "date": "2008", "authors": "Riising EM, Boggio R, Chiocca S, Helin K, Pasini D", "evidence": [ { "database": "Reactome", "id": "R-HSA-4551638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4551638" } ], "reference": [ { "type": "PubMed", "id": "18628979", "url": "https://glygen.org/publication/PubMed/18628979" } ] }, { "title": "A quantitative atlas of mitotic phosphorylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP", "evidence": [ { "database": "iPTMnet", "id": "O75694-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75694-1" } ], "reference": [ { "type": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ] }, { "title": "Ubc9 sumoylation regulates SUMO target discrimination.", "journal": "Molecular cell", "date": "2008", "authors": "Knipscheer P, Flotho A, Klug H, Olsen JV, van Dijk WJ, Fish A, Johnson ES, Mann M, Sixma TK, Pichler A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "18691969", "url": "https://glygen.org/publication/PubMed/18691969" } ] }, { "title": "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.", "journal": "Molecular cell", "date": "2008", "authors": "Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M", "evidence": [ { "database": "iPTMnet", "id": "O75694-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75694-1" } ], "reference": [ { "type": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" } ] }, { "title": "Small ubiquitin-related modifier (SUMO) binding determines substrate recognition and paralog-selective SUMO modification.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Zhu J, Zhu S, Guzzo CM, Ellis NA, Sung KS, Choi CY, Matunis MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "18708356", "url": "https://glygen.org/publication/PubMed/18708356" } ] }, { "title": "Successive and selective release of phosphorylated peptides captured by hydroxy acid-modified metal oxide chromatography.", "journal": "Journal of proteome research", "date": "2008", "authors": "Kyono Y, Sugiyama N, Imami K, Tomita M, Ishihama Y", "evidence": [ { "database": "iPTMnet", "id": "O75694-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75694-1" } ], "reference": [ { "type": "PubMed", "id": "18767875", "url": "https://glygen.org/publication/PubMed/18767875" } ] }, { "title": "Functional analyses for tRNase Z variants: an aspartate and a histidine in the active site are essential for the catalytic activity.", "journal": "Biochimica et biophysica acta", "date": "2008", "authors": "Elbarbary RA, Takaku H, Nashimoto M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531" } ], "reference": [ { "type": "PubMed", "id": "18809514", "url": "https://glygen.org/publication/PubMed/18809514" } ] }, { "title": "Fluorescence correlation spectroscopy and fluorescence cross-correlation spectroscopy reveal the cytoplasmic origination of loaded nuclear RISC in vivo in human cells.", "journal": "Nucleic acids research", "date": "2008", "authors": "Ohrt T, Mutze J, Staroske W, Weinmann L, Hock J, Crell K, Meister G, Schwille P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "18842624", "url": "https://glygen.org/publication/PubMed/18842624" } ] }, { "title": "MicroRNA-directed transcriptional gene silencing in mammalian cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Kim DH, Saetrom P, Snove O Jr, Rossi JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "18852463", "url": "https://glygen.org/publication/PubMed/18852463" } ] }, { "title": "RanBP2 and SENP3 function in a mitotic SUMO2/3 conjugation-deconjugation cycle on Borealin.", "journal": "Molecular biology of the cell", "date": "2009", "authors": "Klein UR, Haindl M, Nigg EA, Muller S", "evidence": [ { "database": "Reactome", "id": "R-HSA-4615885", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4615885" } ], "reference": [ { "type": "PubMed", "id": "18946085", "url": "https://glygen.org/publication/PubMed/18946085" } ] }, { "title": "Molecular characterization of human Argonaute-containing ribonucleoprotein complexes and their bound target mRNAs.", "journal": "RNA (New York, N.Y.)", "date": "2008", "authors": "Landthaler M, Gaidatzis D, Rothballer A, Chen PY, Soll SJ, Dinic L, Ojo T, Hafner M, Zavolan M, Tuschl T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "18978028", "url": "https://glygen.org/publication/PubMed/18978028" } ] }, { "title": "RNase P without RNA: identification and functional reconstitution of the human mitochondrial tRNA processing enzyme.", "journal": "Cell", "date": "2008", "authors": "Holzmann J, Frank P, Loffler E, Bennett KL, Gerner C, Rossmanith W", "evidence": [ { "database": "Reactome", "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531" } ], "reference": [ { "type": "PubMed", "id": "18984158", "url": "https://glygen.org/publication/PubMed/18984158" } ] }, { "title": "Mutation in nuclear pore component NUP155 leads to atrial fibrillation and early sudden cardiac death.", "journal": "Cell", "date": "2008", "authors": "Zhang X, Chen S, Yoo S, Chakrabarti S, Zhang T, Ke T, Oberti C, Yong SL, Fang F, Li L, de la Fuente R, Wang L, Chen Q, Wang QK", "evidence": [ { "database": "UniProtKB", "id": "O75694", "url": "https://www.uniprot.org/uniprot/O75694" } ], "reference": [ { "type": "PubMed", "id": "19070573", "url": "https://glygen.org/publication/PubMed/19070573" } ] }, { "title": "ISG15 Arg151 and the ISG15-conjugating enzyme UbE1L are important for innate immune control of Sindbis virus.", "journal": "Journal of virology", "date": "2009", "authors": "Giannakopoulos NV, Arutyunova E, Lai C, Lenschow DJ, Haas AL, Virgin HW", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "19073728", "url": "https://glygen.org/publication/PubMed/19073728" } ] }, { "title": "Inhibition of IRF3-dependent antiviral responses by cellular and viral proteins.", "journal": "Cell research", "date": "2009", "authors": "Tsuchida T, Kawai T, Akira S", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "19125153", "url": "https://glygen.org/publication/PubMed/19125153" } ] }, { "title": "Importin 8 is a gene silencing factor that targets argonaute proteins to distinct mRNAs.", "journal": "Cell", "date": "2009", "authors": "Weinmann L, Hock J, Ivacevic T, Ohrt T, Mutze J, Schwille P, Kremmer E, Benes V, Urlaub H, Meister G", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "19167051", "url": "https://glygen.org/publication/PubMed/19167051" } ] }, { "title": "Stress-inducible regulation of heat shock factor 1 by the deacetylase SIRT1.", "journal": "Science (New York, N.Y.)", "date": "2009", "authors": "Westerheide SD, Anckar J, Stevens SM Jr, Sistonen L, Morimoto RI", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371453", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371453" } ], "reference": [ { "type": "PubMed", "id": "19229036", "url": "https://glygen.org/publication/PubMed/19229036" } ] }, { "title": "ISG15 modification of filamin B negatively regulates the type I interferon-induced JNK signalling pathway.", "journal": "EMBO reports", "date": "2009", "authors": "Jeon YJ, Choi JS, Lee JY, Yu KR, Kim SM, Ka SH, Oh KH, Kim KI, Zhang DE, Bang OS, Chung CH", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "19270716", "url": "https://glygen.org/publication/PubMed/19270716" } ] }, { "title": "A novel mechanism whereby BRCA1/1a/1b fine tunes the dynamic complex interplay between SUMO-dependent/independent activities of Ubc9 on E2-induced ERalpha activation/repression and degradation in breast cancer cells.", "journal": "International journal of oncology", "date": "2009", "authors": "Xu J, Watkins T, Reddy A, Reddy ES, Rao VN", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "19287951", "url": "https://glygen.org/publication/PubMed/19287951" } ] }, { "title": "The C-terminal domains of human TNRC6A, TNRC6B, and TNRC6C silence bound transcripts independently of Argonaute proteins.", "journal": "RNA (New York, N.Y.)", "date": "2009", "authors": "Lazzaretti D, Tournier I, Izaurralde E", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "19383768", "url": "https://glygen.org/publication/PubMed/19383768" } ] }, { "title": "A C-terminal silencing domain in GW182 is essential for miRNA function.", "journal": "RNA (New York, N.Y.)", "date": "2009", "authors": "Eulalio A, Helms S, Fritzsch C, Fauser M, Izaurralde E", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "19383769", "url": "https://glygen.org/publication/PubMed/19383769" } ] }, { "title": "Mammalian GW182 contains multiple Argonaute-binding sites and functions in microRNA-mediated translational repression.", "journal": "RNA (New York, N.Y.)", "date": "2009", "authors": "Takimoto K, Wakiyama M, Yokoyama S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "19398495", "url": "https://glygen.org/publication/PubMed/19398495" } ] }, { "title": "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.", "journal": "Analytical chemistry", "date": "2009", "authors": "Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S", "evidence": [ { "database": "iPTMnet", "id": "O75694-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75694-1" } ], "reference": [ { "type": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" } ] }, { "title": "Catalysis of guanine nucleotide exchange on Ran by the mitotic regulator RCC1.", "journal": "Nature", "date": "1991", "authors": "Bischoff FR, Ponstingl H", "evidence": [ { "database": "Reactome", "id": "R-HSA-165054", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-165054" } ], "reference": [ { "type": "PubMed", "id": "1944575", "url": "https://glygen.org/publication/PubMed/1944575" } ] }, { "title": "mRNA nuclear export at a glance.", "journal": "Journal of cell science", "date": "2009", "authors": "Carmody SR, Wente SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-159231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159231" } ], "reference": [ { "type": "PubMed", "id": "19494120", "url": "https://glygen.org/publication/PubMed/19494120" } ] }, { "title": "Proteomics analysis of nucleolar SUMO-1 target proteins upon proteasome inhibition.", "journal": "Molecular & cellular proteomics : MCP", "date": "2009", "authors": "Matafora V, D'Amato A, Mori S, Blasi F, Bachi A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "19596686", "url": "https://glygen.org/publication/PubMed/19596686" } ] }, { "title": "Sumoylation of poly(ADP-ribose) polymerase 1 inhibits its acetylation and restrains transcriptional coactivator function.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2009", "authors": "Messner S, Schuermann D, Altmeyer M, Kassner I, Schmidt D, Schar P, Muller S, Hottiger MO", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "19622798", "url": "https://glygen.org/publication/PubMed/19622798" } ] }, { "title": "Human cytomegalovirus exploits ESCRT machinery in the process of virion maturation.", "journal": "Journal of virology", "date": "2009", "authors": "Tandon R, AuCoin DP, Mocarski ES", "evidence": [ { "database": "Reactome", "id": "R-HSA-9610379", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9610379" } ], "reference": [ { "type": "PubMed", "id": "19640981", "url": "https://glygen.org/publication/PubMed/19640981" } ] }, { "title": "Phosphorylation dynamics during early differentiation of human embryonic stem cells.", "journal": "Cell stem cell", "date": "2009", "authors": "Van Hoof D, Munoz J, Braam SR, Pinkse MW, Linding R, Heck AJ, Mummery CL, Krijgsveld J", "evidence": [ { "database": "iPTMnet", "id": "O75694-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75694-1" } ], "reference": [ { "type": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" } ] }, { "title": "Chromatin structure regulates human cytomegalovirus gene expression during latency, reactivation and lytic infection.", "journal": "Biochimica et biophysica acta", "date": "2010", "authors": "Sinclair J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690" } ], "reference": [ { "type": "PubMed", "id": "19682613", "url": "https://glygen.org/publication/PubMed/19682613" } ] }, { "title": "SUMO-dependent regulation of centrin-2.", "journal": "Journal of cell science", "date": "2009", "authors": "Klein UR, Nigg EA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "19706679", "url": "https://glygen.org/publication/PubMed/19706679" } ] }, { "title": "PARP-1 transcriptional activity is regulated by sumoylation upon heat shock.", "journal": "The EMBO journal", "date": "2009", "authors": "Martin N, Schwamborn K, Schreiber V, Werner A, Guillier C, Zhang XD, Bischof O, Seeler JS, Dejean A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "19779455", "url": "https://glygen.org/publication/PubMed/19779455" } ] }, { "title": "Two signals mediate nuclear localization of influenza virus (A/WSN/33) polymerase basic protein 2.", "journal": "Journal of virology", "date": "1991", "authors": "Mukaigawa J, Nayak DP", "evidence": [ { "database": "Reactome", "id": "R-HSA-168271", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168271" } ], "reference": [ { "type": "PubMed", "id": "1985200", "url": "https://glygen.org/publication/PubMed/1985200" } ] }, { "title": "Substrate specificity of SIRT1-catalyzed lysine Nepsilon-deacetylation reaction probed with the side chain modified Nepsilon-acetyl-lysine analogs.", "journal": "Bioorganic chemistry", "date": "2010", "authors": "Jamonnak N, Hirsch BM, Pang Y, Zheng W", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371453", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371453" } ], "reference": [ { "type": "PubMed", "id": "19914676", "url": "https://glygen.org/publication/PubMed/19914676" } ] }, { "title": "SUMO modification regulates BLM and RAD51 interaction at damaged replication forks.", "journal": "PLoS biology", "date": "2009", "authors": "Ouyang KJ, Woo LL, Zhu J, Huo D, Matunis MJ, Ellis NA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "19956565", "url": "https://glygen.org/publication/PubMed/19956565" } ] }, { "title": "The SUMO modification pathway is involved in the BRCA1 response to genotoxic stress.", "journal": "Nature", "date": "2009", "authors": "Morris JR, Boutell C, Keppler M, Densham R, Weekes D, Alamshah A, Butler L, Galanty Y, Pangon L, Kiuchi T, Ng T, Solomon E", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "20016594", "url": "https://glygen.org/publication/PubMed/20016594" } ] }, { "title": "Mammalian SUMO E3-ligases PIAS1 and PIAS4 promote responses to DNA double-strand breaks.", "journal": "Nature", "date": "2009", "authors": "Galanty Y, Belotserkovskaya R, Coates J, Polo S, Miller KM, Jackson SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "20016603", "url": "https://glygen.org/publication/PubMed/20016603" } ] }, { "title": "Extensive crosstalk between O-GlcNAcylation and phosphorylation regulates cytokinesis.", "journal": "Science signaling", "date": "2010", "authors": "Wang Z, Udeshi ND, Slawson C, Compton PD, Sakabe K, Cheung WD, Shabanowitz J, Hunt DF, Hart GW", "evidence": [ { "database": "iPTMnet", "id": "O75694-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75694-1" } ], "reference": [ { "type": "PubMed", "id": "20068230", "url": "https://glygen.org/publication/PubMed/20068230" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "iPTMnet", "id": "O75694-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75694-1" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "A role for non-covalent SUMO interaction motifs in Pc2/CBX4 E3 activity.", "journal": "PloS one", "date": "2010", "authors": "Merrill JC, Melhuish TA, Kagey MH, Yang SH, Sharrocks AD, Wotton D", "evidence": [ { "database": "Reactome", "id": "R-HSA-4551638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4551638" } ], "reference": [ { "type": "PubMed", "id": "20098713", "url": "https://glygen.org/publication/PubMed/20098713" } ] }, { "title": "Arginine methylation of REF/ALY promotes efficient handover of mRNA to TAP/NXF1.", "journal": "Nucleic acids research", "date": "2010", "authors": "Hung ML, Hautbergue GM, Snijders AP, Dickman MJ, Wilson SA", "evidence": [ { "database": "Reactome", "id": "R-HSA-159230", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159230" } ], "reference": [ { "type": "PubMed", "id": "20129943", "url": "https://glygen.org/publication/PubMed/20129943" } ] }, { "title": "ISG15 conjugation system targets the viral NS1 protein in influenza A virus-infected cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Zhao C, Hsiang TY, Kuo RL, Krug RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "20133869", "url": "https://glygen.org/publication/PubMed/20133869" } ] }, { "title": "Regulation of histone mRNA in the unperturbed cell cycle: evidence suggesting control at two posttranscriptional steps.", "journal": "Molecular and cellular biology", "date": "1991", "authors": "Harris ME, Bohni R, Schneiderman MH, Ramamurthy L, Schumperli D, Marzluff WF", "evidence": [ { "database": "Reactome", "id": "R-HSA-159231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159231" } ], "reference": [ { "type": "PubMed", "id": "2017161", "url": "https://glygen.org/publication/PubMed/2017161" } ] }, { "title": "Specific complex of human immunodeficiency virus type 1 rev and nucleolar B23 proteins: dissociation by the Rev response element.", "journal": "Molecular and cellular biology", "date": "1991", "authors": "Fankhauser C, Izaurralde E, Adachi Y, Wingfield P, Laemmli UK", "evidence": [ { "database": "Reactome", "id": "R-HSA-180746", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180746" } ], "reference": [ { "type": "PubMed", "id": "2017166", "url": "https://glygen.org/publication/PubMed/2017166" } ] }, { "title": "The putative nuclear localization signal of the human RAD52 protein is a potential sumoylation site.", "journal": "Journal of biochemistry", "date": "2010", "authors": "Saito K, Kagawa W, Suzuki T, Suzuki H, Yokoyama S, Saitoh H, Tashiro S, Dohmae N, Kurumizaka H", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "20190268", "url": "https://glygen.org/publication/PubMed/20190268" } ] }, { "title": "Species-specific antagonism of host ISGylation by the influenza B virus NS1 protein.", "journal": "Journal of virology", "date": "2010", "authors": "Versteeg GA, Hale BG, van Boheemen S, Wolff T, Lenschow DJ, Garcia-Sastre A", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "20219937", "url": "https://glygen.org/publication/PubMed/20219937" } ] }, { "title": "Hypoxia inactivates the VHL tumor suppressor through PIASy-mediated SUMO modification.", "journal": "PloS one", "date": "2010", "authors": "Cai Q, Verma SC, Kumar P, Ma M, Robertson ES", "evidence": [ { "database": "Reactome", "id": "R-HSA-3232142", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3232142" } ], "reference": [ { "type": "PubMed", "id": "20300531", "url": "https://glygen.org/publication/PubMed/20300531" } ] }, { "title": "Positive regulation of interferon regulatory factor 3 activation by Herc5 via ISG15 modification.", "journal": "Molecular and cellular biology", "date": "2010", "authors": "Shi HX, Yang K, Liu X, Liu XY, Wei B, Shan YF, Zhu LH, Wang C", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "20308324", "url": "https://glygen.org/publication/PubMed/20308324" } ] }, { "title": "Phosphorylation-dependent interaction of SATB1 and PIAS1 directs SUMO-regulated caspase cleavage of SATB1.", "journal": "Molecular and cellular biology", "date": "2010", "authors": "Tan JA, Song J, Chen Y, Durrin LK", "evidence": [ { "database": "Reactome", "id": "R-HSA-4551638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4551638" } ], "reference": [ { "type": "PubMed", "id": "20351170", "url": "https://glygen.org/publication/PubMed/20351170" } ] }, { "title": "Herc5 attenuates influenza A virus by catalyzing ISGylation of viral NS1 protein.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2010", "authors": "Tang Y, Zhong G, Zhu L, Liu X, Shan Y, Feng H, Bu Z, Chen H, Wang C", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "20385878", "url": "https://glygen.org/publication/PubMed/20385878" } ] }, { "title": "SUMO-specific protease 2 is essential for suppression of polycomb group protein-mediated gene silencing during embryonic development.", "journal": "Molecular cell", "date": "2010", "authors": "Kang X, Qi Y, Zuo Y, Wang Q, Zou Y, Schwartz RJ, Cheng J, Yeh ET", "evidence": [ { "database": "Reactome", "id": "R-HSA-4551638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4551638" } ], "reference": [ { "type": "PubMed", "id": "20417598", "url": "https://glygen.org/publication/PubMed/20417598" } ] }, { "title": "The nuclear pore complex and nuclear transport.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2010", "authors": "Wente SR, Rout MP", "evidence": [ { "database": "Reactome", "id": "R-HSA-159231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159231" } ], "reference": [ { "type": "PubMed", "id": "20630994", "url": "https://glygen.org/publication/PubMed/20630994" } ] }, { "title": "SUMOylation modulates the function of Aurora-B kinase.", "journal": "Journal of cell science", "date": "2010", "authors": "Fernandez-Miranda G, Perez de Castro I, Carmena M, Aguirre-Portoles C, Ruchaud S, Fant X, Montoya G, Earnshaw WC, Malumbres M", "evidence": [ { "database": "Reactome", "id": "R-HSA-4615885", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4615885" } ], "reference": [ { "type": "PubMed", "id": "20663916", "url": "https://glygen.org/publication/PubMed/20663916" } ] }, { "title": "Regulation of DNA repair through deSUMOylation and SUMOylation of replication protein A complex.", "journal": "Molecular cell", "date": "2010", "authors": "Dou H, Huang C, Singh M, Carpenter PB, Yeh ET", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "20705237", "url": "https://glygen.org/publication/PubMed/20705237" } ] }, { "title": "A proteomic screen for nucleolar SUMO targets shows SUMOylation modulates the function of Nop5/Nop58.", "journal": "Molecular cell", "date": "2010", "authors": "Westman BJ, Verheggen C, Hutten S, Lam YW, Bertrand E, Lamond AI", "evidence": [ { "database": "Reactome", "id": "R-HSA-4570464", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4570464" } ], "reference": [ { "type": "PubMed", "id": "20797632", "url": "https://glygen.org/publication/PubMed/20797632" } ] }, { "title": "Site-specific identification of SUMO-2 targets in cells reveals an inverted SUMOylation motif and a hydrophobic cluster SUMOylation motif.", "journal": "Molecular cell", "date": "2010", "authors": "Matic I, Schimmel J, Hendriks IA, van Santen MA, van de Rijke F, van Dam H, Gnad F, Mann M, Vertegaal AC", "evidence": [ { "database": "Reactome", "id": "R-HSA-4570464", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4570464" } ], "reference": [ { "type": "PubMed", "id": "20797634", "url": "https://glygen.org/publication/PubMed/20797634" } ] }, { "title": "Ubiquitin/SUMO modification regulates VHL protein stability and nucleocytoplasmic localization.", "journal": "PloS one", "date": "2010", "authors": "Cai Q, Robertson ES", "evidence": [ { "database": "Reactome", "id": "R-HSA-3232142", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3232142" } ], "reference": [ { "type": "PubMed", "id": "20844582", "url": "https://glygen.org/publication/PubMed/20844582" } ] }, { "title": "Structural basis for cooperative RNA binding and export complex assembly by HIV Rev.", "journal": "Nature structural & molecular biology", "date": "2010", "authors": "Daugherty MD, Liu B, Frankel AD", "evidence": [ { "database": "Reactome", "id": "R-HSA-165054", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-165054" } ], "reference": [ { "type": "PubMed", "id": "20953181", "url": "https://glygen.org/publication/PubMed/20953181" } ] }, { "title": "SUMO E3 ligase activity of TRIM proteins.", "journal": "Oncogene", "date": "2011", "authors": "Chu Y, Yang X", "evidence": [ { "database": "Reactome", "id": "R-HSA-3232142", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3232142" } ], "reference": [ { "type": "PubMed", "id": "20972456", "url": "https://glygen.org/publication/PubMed/20972456" } ] }, { "title": "Pom121 links two essential subcomplexes of the nuclear pore complex core to the membrane.", "journal": "The Journal of cell biology", "date": "2010", "authors": "Mitchell JM, Mansfeld J, Capitanio J, Kutay U, Wozniak RW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9615933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9615933" } ], "reference": [ { "type": "PubMed", "id": "20974814", "url": "https://glygen.org/publication/PubMed/20974814" } ] }, { "title": "A novel proteomics approach to identify SUMOylated proteins and their modification sites in human cells.", "journal": "Molecular & cellular proteomics : MCP", "date": "2011", "authors": "Galisson F, Mahrouche L, Courcelles M, Bonneil E, Meloche S, Chelbi-Alix MK, Thibault P", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "21098080", "url": "https://glygen.org/publication/PubMed/21098080" } ] }, { "title": "Cell cycle-dependent conjugation of endogenous BRCA1 protein with SUMO-2/3.", "journal": "Biochimica et biophysica acta", "date": "2011", "authors": "Vialter A, Vincent A, Demidem A, Morvan D, Stepien G, Venezia ND, Rio PG", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "21147198", "url": "https://glygen.org/publication/PubMed/21147198" } ] }, { "title": "Crystal structure of SUMO-modified proliferating cell nuclear antigen.", "journal": "Journal of molecular biology", "date": "2011", "authors": "Freudenthal BD, Brogie JE, Gakhar L, Kondratick CM, Washington MT", "evidence": [ { "database": "Reactome", "id": "R-HSA-4615885", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4615885" } ], "reference": [ { "type": "PubMed", "id": "21167178", "url": "https://glygen.org/publication/PubMed/21167178" } ] }, { "title": "SUMO-1 regulates the conformational dynamics of thymine-DNA Glycosylase regulatory domain and competes with its DNA binding activity.", "journal": "BMC biochemistry", "date": "2011", "authors": "Smet-Nocca C, Wieruszeski JM, Leger H, Eilebrecht S, Benecke A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "21284855", "url": "https://glygen.org/publication/PubMed/21284855" } ] }, { "title": "HSPC117 is the essential subunit of a human tRNA splicing ligase complex.", "journal": "Science (New York, N.Y.)", "date": "2011", "authors": "Popow J, Englert M, Weitzer S, Schleiffer A, Mierzwa B, Mechtler K, Trowitzsch S, Will CL, Luhrmann R, Soll D, Martinez J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531" } ], "reference": [ { "type": "PubMed", "id": "21311021", "url": "https://glygen.org/publication/PubMed/21311021" } ] }, { "title": "Phosphorylation of Nup98 by multiple kinases is crucial for NPC disassembly during mitotic entry.", "journal": "Cell", "date": "2011", "authors": "Laurell E, Beck K, Krupina K, Theerthagiri G, Bodenmiller B, Horvath P, Aebersold R, Antonin W, Kutay U", "evidence": [ { "database": "Reactome", "id": "R-HSA-3301854", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3301854" } ], "reference": [ { "type": "PubMed", "id": "21335236", "url": "https://glygen.org/publication/PubMed/21335236" } ] }, { "title": "Transcriptional gene silencing in mammalian cells by miRNA mimics that target gene promoters.", "journal": "Nucleic acids research", "date": "2011", "authors": "Younger ST, Corey DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "21427083", "url": "https://glygen.org/publication/PubMed/21427083" } ] }, { "title": "RNA binding properties of conserved protein subunits of human RNase P.", "journal": "Nucleic acids research", "date": "2011", "authors": "Reiner R, Alfiya-Mor N, Berrebi-Demma M, Wesolowski D, Altman S, Jarrous N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531" } ], "reference": [ { "type": "PubMed", "id": "21450806", "url": "https://glygen.org/publication/PubMed/21450806" } ] }, { "title": "The Nse2/Mms21 SUMO ligase of the Smc5/6 complex in the maintenance of genome stability.", "journal": "FEBS letters", "date": "2011", "authors": "Stephan AK, Kliszczak M, Morrison CG", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "21550342", "url": "https://glygen.org/publication/PubMed/21550342" } ] }, { "title": "Mitotic kinase Aurora-B is regulated by SUMO-2/3 conjugation/deconjugation during mitosis.", "journal": "Genes to cells : devoted to molecular & cellular mechanisms", "date": "2011", "authors": "Ban R, Nishida T, Urano T", "evidence": [ { "database": "Reactome", "id": "R-HSA-4615885", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4615885" } ], "reference": [ { "type": "PubMed", "id": "21554500", "url": "https://glygen.org/publication/PubMed/21554500" } ] }, { "title": "Localization of human RNase Z isoforms: dual nuclear/mitochondrial targeting of the ELAC2 gene product by alternative translation initiation.", "journal": "PloS one", "date": "2011", "authors": "Rossmanith W", "evidence": [ { "database": "Reactome", "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531" } ], "reference": [ { "type": "PubMed", "id": "21559454", "url": "https://glygen.org/publication/PubMed/21559454" } ] }, { "title": "Transcriptional regulation by miRNA mimics that target sequences downstream of gene termini.", "journal": "Molecular bioSystems", "date": "2011", "authors": "Younger ST, Corey DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "21589992", "url": "https://glygen.org/publication/PubMed/21589992" } ] }, { "title": "Involvement of human ELAC2 gene product in 3' end processing of mitochondrial tRNAs.", "journal": "RNA biology", "date": "2011", "authors": "Brzezniak LK, Bijata M, Szczesny RJ, Stepien PP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531" } ], "reference": [ { "type": "PubMed", "id": "21593607", "url": "https://glygen.org/publication/PubMed/21593607" } ] }, { "title": "A role for SUMOylation in snoRNP biogenesis revealed by quantitative proteomics.", "journal": "Nucleus (Austin, Tex.)", "date": "2011", "authors": "Westman BJ, Lamond AI", "evidence": [ { "database": "Reactome", "id": "R-HSA-4570464", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4570464" } ], "reference": [ { "type": "PubMed", "id": "21647297", "url": "https://glygen.org/publication/PubMed/21647297" } ] }, { "title": "Heparan sulfate proteoglycans.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2011", "authors": "Sarrazin S, Lamanna WC, Esko JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690" } ], "reference": [ { "type": "PubMed", "id": "21690215", "url": "https://glygen.org/publication/PubMed/21690215" } ] }, { "title": "Direct evidence of nuclear Argonaute distribution during transcriptional silencing links the actin cytoskeleton to nuclear RNAi machinery in human cells.", "journal": "Nucleic acids research", "date": "2012", "authors": "Ahlenstiel CL, Lim HG, Cooper DA, Ishida T, Kelleher AD, Suzuki K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "22064859", "url": "https://glygen.org/publication/PubMed/22064859" } ] }, { "title": "GlcNAcylation of histone H2B facilitates its monoubiquitination.", "journal": "Nature", "date": "2011", "authors": "Fujiki R, Hashiba W, Sekine H, Yokoyama A, Chikanishi T, Ito S, Imai Y, Kim J, He HH, Igarashi K, Kanno J, Ohtake F, Kitagawa H, Roeder RG, Brown M, Kato S", "evidence": [ { "database": "O-GlcNAc Database", "id": "O75694", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75694" } ], "reference": [ { "type": "PubMed", "id": "22121020", "url": "https://glygen.org/publication/PubMed/22121020" } ] }, { "title": "The human cytomegalovirus UL11 protein interacts with the receptor tyrosine phosphatase CD45, resulting in functional paralysis of T cells.", "journal": "PLoS pathogens", "date": "2011", "authors": "Gabaev I, Steinbruck L, Pokoyski C, Pich A, Stanton RJ, Schwinzer R, Schulz TF, Jacobs R, Messerle M, Kay-Fedorov PC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690" } ], "reference": [ { "type": "PubMed", "id": "22174689", "url": "https://glygen.org/publication/PubMed/22174689" } ] }, { "title": "Comparative large-scale characterisation of plant vs. mammal proteins reveals similar and idiosyncratic N-alpha acetylation features.", "journal": "Mol. Cell. Proteomics", "date": "2012", "authors": "Bienvenut WV, Sumpton D, Martinez A, Lilla S, Espagne C, Meinnel T, Giglione C", "evidence": [ { "database": "UniProtKB", "id": "E9PF10", "url": "https://www.uniprot.org/uniprot/E9PF10" } ], "reference": [ { "type": "PubMed", "id": "22223895", "url": "https://glygen.org/publication/PubMed/22223895" } ] }, { "title": "CBX4-mediated SUMO modification regulates BMI1 recruitment at sites of DNA damage.", "journal": "Nucleic acids research", "date": "2012", "authors": "Ismail IH, Gagne JP, Caron MC, McDonald D, Xu Z, Masson JY, Poirier GG, Hendzel MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-4551638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4551638" } ], "reference": [ { "type": "PubMed", "id": "22402492", "url": "https://glygen.org/publication/PubMed/22402492" } ] }, { "title": "A role for small RNAs in DNA double-strand break repair.", "journal": "Cell", "date": "2012", "authors": "Wei W, Ba Z, Gao M, Wu Y, Ma Y, Amiard S, White CI, Rendtlew Danielsen JM, Yang YG, Qi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "22445173", "url": "https://glygen.org/publication/PubMed/22445173" } ] }, { "title": "Role of SUMO modification of human PCNA at stalled replication fork.", "journal": "Nucleic acids research", "date": "2012", "authors": "Gali H, Juhasz S, Morocz M, Hajdu I, Fatyol K, Szukacsov V, Burkovics P, Haracska L", "evidence": [ { "database": "Reactome", "id": "R-HSA-4615885", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4615885" } ], "reference": [ { "type": "PubMed", "id": "22457066", "url": "https://glygen.org/publication/PubMed/22457066" } ] }, { "title": "The RanBP2/RanGAP1*SUMO1/Ubc9 complex is a multisubunit SUMO E3 ligase.", "journal": "Molecular cell", "date": "2012", "authors": "Werner A, Flotho A, Melchior F", "evidence": [ { "database": "Reactome", "id": "R-HSA-4615885", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4615885" } ], "reference": [ { "type": "PubMed", "id": "22464730", "url": "https://glygen.org/publication/PubMed/22464730" } ] }, { "title": "Regulation of SIRT1 activity by genotoxic stress.", "journal": "Genes & development", "date": "2012", "authors": "Yuan J, Luo K, Liu T, Lou Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371453", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371453" } ], "reference": [ { "type": "PubMed", "id": "22465953", "url": "https://glygen.org/publication/PubMed/22465953" } ] }, { "title": "Dynamically regulated sumoylation of HDAC2 controls p53 deacetylation and restricts apoptosis following genotoxic stress.", "journal": "Journal of molecular cell biology", "date": "2012", "authors": "Brandl A, Wagner T, Uhlig KM, Knauer SK, Stauber RH, Melchior F, Schneider G, Heinzel T, Kramer OH", "evidence": [ { "database": "Reactome", "id": "R-HSA-4551638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4551638" } ], "reference": [ { "type": "PubMed", "id": "22493095", "url": "https://glygen.org/publication/PubMed/22493095" } ] }, { "title": "DNA damage-inducible SUMOylation of HERC2 promotes RNF8 binding via a novel SUMO-binding Zinc finger.", "journal": "The Journal of cell biology", "date": "2012", "authors": "Danielsen JR, Povlsen LK, Villumsen BH, Streicher W, Nilsson J, Wikstrom M, Bekker-Jensen S, Mailand N", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "22508508", "url": "https://glygen.org/publication/PubMed/22508508" } ] }, { "title": "Hikeshi, a nuclear import carrier for Hsp70s, protects cells from heat shock-induced nuclear damage.", "journal": "Cell", "date": "2012", "authors": "Kose S, Furuta M, Imamoto N", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371453", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371453" } ], "reference": [ { "type": "PubMed", "id": "22541429", "url": "https://glygen.org/publication/PubMed/22541429" } ] }, { "title": "Sumoylation of MDC1 is important for proper DNA damage response.", "journal": "The EMBO journal", "date": "2012", "authors": "Luo K, Zhang H, Wang L, Yuan J, Lou Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "22635276", "url": "https://glygen.org/publication/PubMed/22635276" } ] }, { "title": "SUMO-targeted ubiquitin E3 ligase RNF4 is required for the response of human cells to DNA damage.", "journal": "Genes & development", "date": "2012", "authors": "Yin Y, Seifert A, Chua JS, Maure JF, Golebiowski F, Hay RT", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "22661230", "url": "https://glygen.org/publication/PubMed/22661230" } ] }, { "title": "Site-specific DICER and DROSHA RNA products control the DNA-damage response.", "journal": "Nature", "date": "2012", "authors": "Francia S, Michelini F, Saxena A, Tang D, de Hoon M, Anelli V, Mione M, Carninci P, d'Adda di Fagagna F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "22722852", "url": "https://glygen.org/publication/PubMed/22722852" } ] }, { "title": "Human intronless genes: functional groups, associated diseases, evolution, and mRNA processing in absence of splicing.", "journal": "Biochemical and biophysical research communications", "date": "2012", "authors": "Grzybowska EA", "evidence": [ { "database": "Reactome", "id": "R-HSA-159227", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159227" } ], "reference": [ { "type": "PubMed", "id": "22732409", "url": "https://glygen.org/publication/PubMed/22732409" } ] }, { "title": "DBC1 phosphorylation by ATM/ATR inhibits SIRT1 deacetylase in response to DNA damage.", "journal": "Journal of molecular cell biology", "date": "2012", "authors": "Zannini L, Buscemi G, Kim JE, Fontanella E, Delia D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371453", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371453" } ], "reference": [ { "type": "PubMed", "id": "22735644", "url": "https://glygen.org/publication/PubMed/22735644" } ] }, { "title": "Scc1 sumoylation by Mms21 promotes sister chromatid recombination through counteracting Wapl.", "journal": "Genes & development", "date": "2012", "authors": "Wu N, Kong X, Ji Z, Zeng W, Potts PR, Yokomori K, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "22751501", "url": "https://glygen.org/publication/PubMed/22751501" } ] }, { "title": "DNA damage-induced heterogeneous nuclear ribonucleoprotein K sumoylation regulates p53 transcriptional activation.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Pelisch F, Pozzi B, Risso G, Munoz MJ, Srebrow A", "evidence": [ { "database": "Reactome", "id": "R-HSA-4570464", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4570464" } ], "reference": [ { "type": "PubMed", "id": "22825850", "url": "https://glygen.org/publication/PubMed/22825850" } ] }, { "title": "TREX exposes the RNA-binding domain of Nxf1 to enable mRNA export.", "journal": "Nature communications", "date": "2012", "authors": "Viphakone N, Hautbergue GM, Walsh M, Chang CT, Holland A, Folco EG, Reed R, Wilson SA", "evidence": [ { "database": "Reactome", "id": "R-HSA-159236", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159236" } ], "reference": [ { "type": "PubMed", "id": "22893130", "url": "https://glygen.org/publication/PubMed/22893130" } ] }, { "title": "RPA assists HSF1 access to nucleosomal DNA by recruiting histone chaperone FACT.", "journal": "Molecular cell", "date": "2012", "authors": "Fujimoto M, Takaki E, Takii R, Tan K, Prakasam R, Hayashida N, Iemura S, Natsume T, Nakai A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371453", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371453" } ], "reference": [ { "type": "PubMed", "id": "22940245", "url": "https://glygen.org/publication/PubMed/22940245" } ] }, { "title": "TAK1, more than just innate immunity.", "journal": "IUBMB life", "date": "2012", "authors": "Dai L, Aye Thu C, Liu XY, Xi J, Cheung PC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "22941947", "url": "https://glygen.org/publication/PubMed/22941947" } ] }, { "title": "Exportin t and Exportin 5: tRNA and miRNA biogenesis - and beyond.", "journal": "Biological chemistry", "date": "2012", "authors": "Leisegang MS, Martin R, Ramirez AS, Bohnsack MT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531" } ], "reference": [ { "type": "PubMed", "id": "22944664", "url": "https://glygen.org/publication/PubMed/22944664" } ] }, { "title": "Argonaute proteins couple chromatin silencing to alternative splicing.", "journal": "Nature structural & molecular biology", "date": "2012", "authors": "Ameyar-Zazoua M, Rachez C, Souidi M, Robin P, Fritsch L, Young R, Morozova N, Fenouil R, Descostes N, Andrau JC, Mathieu J, Hamiche A, Ait-Si-Ali S, Muchardt C, Batsche E, Harel-Bellan A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "22961379", "url": "https://glygen.org/publication/PubMed/22961379" } ] }, { "title": "SUMOylation of hnRNP-K is required for p53-mediated cell-cycle arrest in response to DNA damage.", "journal": "The EMBO journal", "date": "2012", "authors": "Lee SW, Lee MH, Park JH, Kang SH, Yoo HM, Ka SH, Oh YM, Jeon YJ, Chung CH", "evidence": [ { "database": "Reactome", "id": "R-HSA-4570464", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4570464" } ], "reference": [ { "type": "PubMed", "id": "23092970", "url": "https://glygen.org/publication/PubMed/23092970" } ] }, { "title": "Human TNRC6A is an Argonaute-navigator protein for microRNA-mediated gene silencing in the nucleus.", "journal": "RNA (New York, N.Y.)", "date": "2013", "authors": "Nishi K, Nishi A, Nagasawa T, Ui-Tei K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "23150874", "url": "https://glygen.org/publication/PubMed/23150874" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "O75694", "url": "https://www.uniprot.org/uniprot/O75694" }, { "database": "iPTMnet", "id": "O75694", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75694" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "Chtop is a component of the dynamic TREX mRNA export complex.", "journal": "The EMBO journal", "date": "2013", "authors": "Chang CT, Hautbergue GM, Walsh MJ, Viphakone N, van Dijk TB, Philipsen S, Wilson SA", "evidence": [ { "database": "Reactome", "id": "R-HSA-159236", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159236" } ], "reference": [ { "type": "PubMed", "id": "23299939", "url": "https://glygen.org/publication/PubMed/23299939" } ] }, { "title": "The SIRT1 modulators AROS and DBC1 regulate HSF1 activity and the heat shock response.", "journal": "PloS one", "date": "2013", "authors": "Raynes R, Pombier KM, Nguyen K, Brunquell J, Mendez JE, Westerheide SD", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371453", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371453" } ], "reference": [ { "type": "PubMed", "id": "23349863", "url": "https://glygen.org/publication/PubMed/23349863" } ] }, { "title": "Aiding and abetting cancer: mRNA export and the nuclear pore.", "journal": "Trends in cell biology", "date": "2013", "authors": "Culjkovic-Kraljacic B, Borden KL", "evidence": [ { "database": "Reactome", "id": "R-HSA-159231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159231" } ], "reference": [ { "type": "PubMed", "id": "23582887", "url": "https://glygen.org/publication/PubMed/23582887" } ] }, { "title": "Targeted identification of SUMOylation sites in human proteins using affinity enrichment and paralog-specific reporter ions.", "journal": "Molecular & cellular proteomics : MCP", "date": "2013", "authors": "Lamoliatte F, Bonneil E, Durette C, Caron-Lizotte O, Wildemann D, Zerweck J, Wenshuk H, Thibault P", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "23750026", "url": "https://glygen.org/publication/PubMed/23750026" } ] }, { "title": "Structural and biochemical studies of SLIP1-SLBP identify DBP5 and eIF3g as SLIP1-binding proteins.", "journal": "Nucleic acids research", "date": "2013", "authors": "von Moeller H, Lerner R, Ricciardi A, Basquin C, Marzluff WF, Conti E", "evidence": [ { "database": "Reactome", "id": "R-HSA-159231", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159231" } ], "reference": [ { "type": "PubMed", "id": "23804756", "url": "https://glygen.org/publication/PubMed/23804756" } ] }, { "title": "Mapping interactions between mRNA export factors in living cells.", "journal": "PloS one", "date": "2013", "authors": "Teng IF, Wilson SA", "evidence": [ { "database": "Reactome", "id": "R-HSA-159236", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159236" } ], "reference": [ { "type": "PubMed", "id": "23826332", "url": "https://glygen.org/publication/PubMed/23826332" } ] }, { "title": "DNA-dependent SUMO modification of PARP-1.", "journal": "DNA repair", "date": "2013", "authors": "Zilio N, Williamson CT, Eustermann S, Shah R, West SC, Neuhaus D, Ulrich HD", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "23871147", "url": "https://glygen.org/publication/PubMed/23871147" } ] }, { "title": "The double-stranded RNA binding domain of human Dicer functions as a nuclear localization signal.", "journal": "RNA (New York, N.Y.)", "date": "2013", "authors": "Doyle M, Badertscher L, Jaskiewicz L, Guttinger S, Jurado S, Hugenschmidt T, Kutay U, Filipowicz W", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "23882114", "url": "https://glygen.org/publication/PubMed/23882114" } ] }, { "title": "PIAS4 is an activator of hypoxia signalling via VHL suppression during growth of pancreatic cancer cells.", "journal": "British journal of cancer", "date": "2013", "authors": "Chien W, Lee KL, Ding LW, Wuensche P, Kato H, Doan NB, Poellinger L, Said JW, Koeffler HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-3232142", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3232142" } ], "reference": [ { "type": "PubMed", "id": "24002598", "url": "https://glygen.org/publication/PubMed/24002598" } ] }, { "title": "BLM SUMOylation regulates ssDNA accumulation at stalled replication forks.", "journal": "Frontiers in genetics", "date": "2013", "authors": "Ouyang KJ, Yagle MK, Matunis MJ, Ellis NA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "24027577", "url": "https://glygen.org/publication/PubMed/24027577" } ] }, { "title": "A role for paralog-specific sumoylation in histone deacetylase 1 stability.", "journal": "Journal of molecular cell biology", "date": "2013", "authors": "Citro S, Jaffray E, Hay RT, Seiser C, Chiocca S", "evidence": [ { "database": "Reactome", "id": "R-HSA-4551638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4551638" } ], "reference": [ { "type": "PubMed", "id": "24068740", "url": "https://glygen.org/publication/PubMed/24068740" } ] }, { "title": "Ago1 Interacts with RNA polymerase II and binds to the promoters of actively transcribed genes in human cancer cells.", "journal": "PLoS genetics", "date": "2013", "authors": "Huang V, Zheng J, Qi Z, Wang J, Place RF, Yu J, Li H, Li LC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "24086155", "url": "https://glygen.org/publication/PubMed/24086155" } ] }, { "title": "SUMOylation of the polycomb group protein L3MBTL2 facilitates repression of its target genes.", "journal": "Nucleic acids research", "date": "2014", "authors": "Stielow C, Stielow B, Finkernagel F, Scharfe M, Jarek M, Suske G", "evidence": [ { "database": "Reactome", "id": "R-HSA-4551638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4551638" } ], "reference": [ { "type": "PubMed", "id": "24369422", "url": "https://glygen.org/publication/PubMed/24369422" } ] }, { "title": "RNAi factors are present and active in human cell nuclei.", "journal": "Cell reports", "date": "2014", "authors": "Gagnon KT, Li L, Chu Y, Janowski BA, Corey DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "24388755", "url": "https://glygen.org/publication/PubMed/24388755" } ] }, { "title": "Importin 8 regulates the transport of mature microRNAs into the cell nucleus.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Wei Y, Li L, Wang D, Zhang CY, Zen K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "24596094", "url": "https://glygen.org/publication/PubMed/24596094" } ] }, { "title": "Identification and characterization of an RNA molecule that copurifies with RNase P activity from HeLa cells.", "journal": "Genes & development", "date": "1989", "authors": "Bartkiewicz M, Gold H, Altman S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531" } ], "reference": [ { "type": "PubMed", "id": "2470644", "url": "https://glygen.org/publication/PubMed/2470644" } ] }, { "title": "Proteome-wide identification of SUMO2 modification sites.", "journal": "Science signaling", "date": "2014", "authors": "Tammsalu T, Matic I, Jaffray EG, Ibrahim AFM, Tatham MH, Hay RT", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "24782567", "url": "https://glygen.org/publication/PubMed/24782567" } ] }, { "title": "Analysis of orthologous groups reveals archease and DDX1 as tRNA splicing factors.", "journal": "Nature", "date": "2014", "authors": "Popow J, Jurkin J, Schleiffer A, Martinez J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531" } ], "reference": [ { "type": "PubMed", "id": "24870230", "url": "https://glygen.org/publication/PubMed/24870230" } ] }, { "title": "Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2014", "authors": "Impens F, Radoshevich L, Cossart P, Ribet D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "25114211", "url": "https://glygen.org/publication/PubMed/25114211" } ] }, { "title": "Uncovering global SUMOylation signaling networks in a site-specific manner.", "journal": "Nature structural & molecular biology", "date": "2014", "authors": "Hendriks IA, D'Souza RC, Yang B, Verlaan-de Vries M, Mann M, Vertegaal AC", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "25218447", "url": "https://glygen.org/publication/PubMed/25218447" } ] }, { "title": "Argonaute-1 binds transcriptional enhancers and controls constitutive and alternative splicing in human cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2014", "authors": "Allo M, Agirre E, Bessonov S, Bertucci P, Gomez Acuna L, Buggiano V, Bellora N, Singh B, Petrillo E, Blaustein M, Minana B, Dujardin G, Pozzi B, Pelisch F, Bechara E, Agafonov DE, Srebrow A, Luhrmann R, Valcarcel J, Eyras E, Kornblihtt AR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "25313066", "url": "https://glygen.org/publication/PubMed/25313066" } ] }, { "title": "The human embryonic stem cell proteome revealed by multidimensional fractionation followed by tandem mass spectrometry.", "journal": "Proteomics", "date": "2015", "authors": "Zhao P, Schulz TC, Sherrer ES, Weatherly DB, Robins AJ, Wells L", "evidence": [ { "database": "O-GlcNAc Database", "id": "O75694", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75694" }, { "database": "O-GlcNAc Atlas", "id": "O75694", "url": "https://oglcnac.org/atlas/detail/O75694" } ], "reference": [ { "type": "PubMed", "id": "25367160", "url": "https://glygen.org/publication/PubMed/25367160" } ] }, { "title": "Large-scale analysis of lysine SUMOylation by SUMO remnant immunoaffinity profiling.", "journal": "Nature communications", "date": "2014", "authors": "Lamoliatte F, Caron D, Durette C, Mahrouche L, Maroui MA, Caron-Lizotte O, Bonneil E, Chelbi-Alix MK, Thibault P", "evidence": [ { "database": "Reactome", "id": "R-HSA-4551638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4551638" } ], "reference": [ { "type": "PubMed", "id": "25391492", "url": "https://glygen.org/publication/PubMed/25391492" } ] }, { "title": "Analysis of the initiation of nuclear pore assembly by ectopically targeting nucleoporins to chromatin.", "journal": "Nucleus (Austin, Tex.)", "date": "2015", "authors": "Schwartz M, Travesa A, Martell SW, Forbes DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9615933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9615933" } ], "reference": [ { "type": "PubMed", "id": "25602437", "url": "https://glygen.org/publication/PubMed/25602437" } ] }, { "title": "On-enzyme refolding permits small RNA and tRNA surveillance by the CCA-adding enzyme.", "journal": "Cell", "date": "2015", "authors": "Kuhn CD, Wilusz JE, Zheng Y, Beal PA, Joshua-Tor L", "evidence": [ { "database": "Reactome", "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531" } ], "reference": [ { "type": "PubMed", "id": "25640237", "url": "https://glygen.org/publication/PubMed/25640237" } ] }, { "title": "Sumoylation of HDAC2 promotes NF-kappaB-dependent gene expression.", "journal": "Oncotarget", "date": "2015", "authors": "Wagner T, Kiweler N, Wolff K, Knauer SK, Brandl A, Hemmerich P, Dannenberg JH, Heinzel T, Schneider G, Kramer OH", "evidence": [ { "database": "Reactome", "id": "R-HSA-4551638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4551638" } ], "reference": [ { "type": "PubMed", "id": "25704882", "url": "https://glygen.org/publication/PubMed/25704882" } ] }, { "title": "The interaction of RNA helicase DDX3 with HIV-1 Rev-CRM1-RanGTP complex during the HIV replication cycle.", "journal": "PloS one", "date": "2015", "authors": "Mahboobi SH, Javanpour AA, Mofrad MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-165054", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-165054" } ], "reference": [ { "type": "PubMed", "id": "25723178", "url": "https://glygen.org/publication/PubMed/25723178" } ] }, { "title": "Domain movements during CCA-addition: a new function for motif C in the catalytic core of the human tRNA nucleotidyltransferases.", "journal": "RNA biology", "date": "2015", "authors": "Ernst FG, Rickert C, Bluschke A, Betat H, Steinhoff HJ, Morl M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531" } ], "reference": [ { "type": "PubMed", "id": "25849199", "url": "https://glygen.org/publication/PubMed/25849199" } ] }, { "title": "Cytomegalovirus latency and reactivation: recent insights into an age old problem.", "journal": "Reviews in medical virology", "date": "2016", "authors": "Dupont L, Reeves MB", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690" } ], "reference": [ { "type": "PubMed", "id": "26572645", "url": "https://glygen.org/publication/PubMed/26572645" } ] }, { "title": "Transcription Factor hDREF Is a Novel SUMO E3 Ligase of Mi2alpha.", "journal": "The Journal of biological chemistry", "date": "2016", "authors": "Yamashita D, Moriuchi T, Osumi T, Hirose F", "evidence": [ { "database": "Reactome", "id": "R-HSA-4551638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4551638" } ], "reference": [ { "type": "PubMed", "id": "27068747", "url": "https://glygen.org/publication/PubMed/27068747" } ] }, { "title": "Human Cytomegalovirus Latency: Approaching the Gordian Knot.", "journal": "Annual review of virology", "date": "2016", "authors": "Goodrum F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690" } ], "reference": [ { "type": "PubMed", "id": "27501258", "url": "https://glygen.org/publication/PubMed/27501258" } ] }, { "title": "Viral gene products actively promote latent infection by epigenetic silencing mechanisms.", "journal": "Current opinion in virology", "date": "2017", "authors": "Knipe DM, Raja P, Lee J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690" } ], "reference": [ { "type": "PubMed", "id": "28415052", "url": "https://glygen.org/publication/PubMed/28415052" } ] }, { "title": "Synthesis of a Highly Azide-Reactive and Thermosensitive Biofunctional Reagent for Efficient Enrichment and Large-Scale Identification of O-GlcNAc Proteins by Mass Spectrometry.", "journal": "Analytical chemistry", "date": "2017", "authors": "Zhang W, Liu T, Dong H, Bai H, Tian F, Shi Z, Chen M, Wang J, Qin W, Qian X", "evidence": [ { "database": "O-GlcNAc Database", "id": "O75694", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75694" } ], "reference": [ { "type": "PubMed", "id": "28510447", "url": "https://glygen.org/publication/PubMed/28510447" } ] }, { "title": "HCMV miRNA Targets Reveal Important Cellular Pathways for Viral Replication, Latency, and Reactivation.", "journal": "Non-coding RNA", "date": "2018", "authors": "Diggins NL, Hancock MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690" } ], "reference": [ { "type": "PubMed", "id": "30360396", "url": "https://glygen.org/publication/PubMed/30360396" } ] }, { "title": "A triarylphosphine-trimethylpiperidine reagent for the one-step derivatization and enrichment of protein post-translational modifications and identification by mass spectrometry.", "journal": "Chemical communications (Cambridge, England)", "date": "2018", "authors": "Huo B, Zhang W, Zhao X, Dong H, Yu Y, Wang J, Qian X, Qin W", "evidence": [ { "database": "O-GlcNAc Database", "id": "O75694", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75694" } ], "reference": [ { "type": "PubMed", "id": "30379171", "url": "https://glygen.org/publication/PubMed/30379171" } ] }, { "title": "Combinatorial regulation of hepatic cytoplasmic signaling and nuclear transcriptional events by the OGT/REV-ERBalpha complex.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2018", "authors": "Berthier A, Vinod M, Porez G, Steenackers A, Alexandre J, Yamakawa N, Gheeraert C, Ploton M, Marechal X, Dubois-Chevalier J, Hovasse A, Schaeffer-Reiss C, Cianferani S, Rolando C, Bray F, Duez H, Eeckhoute J, Lefebvre T, Staels B, Lefebvre P", "evidence": [ { "database": "O-GlcNAc Database", "id": "O75694", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75694" } ], "reference": [ { "type": "PubMed", "id": "30397120", "url": "https://glygen.org/publication/PubMed/30397120" } ] }, { "title": "Lamin A mutation impairs interaction with nucleoporin NUP155 and disrupts nucleocytoplasmic transport in atrial fibrillation.", "journal": "Human mutation", "date": "2019", "authors": "Han M, Zhao M, Cheng C, Huang Y, Han S, Li W, Tu X, Luo X, Yu X, Liu Y, Chen Q, Ren X, Wang QK, Ke T", "evidence": [ { "database": "RefSeq", "id": "NP_004289", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004289" } ], "reference": [ { "type": "PubMed", "id": "30488537", "url": "https://glygen.org/publication/PubMed/30488537" } ] }, { "title": "HCMV latency: what regulates the regulators?", "journal": "Medical microbiology and immunology", "date": "2019", "authors": "Elder E, Sinclair J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9609690", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690" } ], "reference": [ { "type": "PubMed", "id": "30761409", "url": "https://glygen.org/publication/PubMed/30761409" } ] }, { "title": "Nucleoporin Nup155 is part of the p53 network in liver cancer.", "journal": "Nature communications", "date": "2019", "authors": "Holzer K, Ori A, Cooke A, Dauch D, Drucker E, Riemenschneider P, Andres-Pons A, DiGuilio AL, Mackmull MT, Bassler J, Roessler S, Breuhahn K, Zender L, Glavy JS, Dombrowski F, Hurt E, Schirmacher P, Beck M, Singer S", "evidence": [ { "database": "RefSeq", "id": "NP_004289", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004289" } ], "reference": [ { "type": "PubMed", "id": "31089132", "url": "https://glygen.org/publication/PubMed/31089132" } ] }, { "title": "ZBP1 and TAK1: Master Regulators of NLRP3 Inflammasome/Pyroptosis, Apoptosis, and Necroptosis (PAN-optosis).", "journal": "Frontiers in cellular and infection microbiology", "date": "2019", "authors": "Malireddi RKS, Kesavardhana S, Kanneganti TD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "31850239", "url": "https://glygen.org/publication/PubMed/31850239" } ] }, { "title": "A SARS-CoV-2 protein interaction map reveals targets for drug repurposing.", "journal": "Nature", "date": "2020", "authors": "Gordon DE, Jang GM, Bouhaddou M, Xu J, Obernier K, White KM, O'Meara MJ, Rezelj VV, Guo JZ, Swaney DL, Tummino TA, Huttenhain R, Kaake RM, Richards AL, Tutuncuoglu B, Foussard H, Batra J, Haas K, Modak M, Kim M, Haas P, Polacco BJ, Braberg H, Fabius JM, Eckhardt M, Soucheray M, Bennett MJ, Cakir M, McGregor MJ, Li Q, Meyer B, Roesch F, Vallet T, Mac Kain A, Miorin L, Moreno E, Naing ZZC, Zhou Y, Peng S, Shi Y, Zhang Z, Shen W, Kirby IT, Melnyk JE, Chorba JS, Lou K, Dai SA, Barrio-Hernandez I, Memon D, Hernandez-Armenta C, Lyu J, Mathy CJP, Perica T, Pilla KB, Ganesan SJ, Saltzberg DJ, Rakesh R, Liu X, Rosenthal SB, Calviello L, Venkataramanan S, Liboy-Lugo J, Lin Y, Huang XP, Liu Y, Wankowicz SA, Bohn M, Safari M, Ugur FS, Koh C, Savar NS, Tran QD, Shengjuler D, Fletcher SJ, O'Neal MC, Cai Y, Chang JCJ, Broadhurst DJ, Klippsten S, Sharp PP, Wenzell NA, Kuzuoglu-Ozturk D, Wang HY, Trenker R, Young JM, Cavero DA, Hiatt J, Roth TL, Rathore U, Subramanian A, Noack J, Hubert M, Stroud RM, Frankel AD, Rosenberg OS, Verba KA, Agard DA, Ott M, Emerman M, Jura N, von Zastrow M, Verdin E, Ashworth A, Schwartz O, d'Enfert C, Mukherjee S, Jacobson M, Malik HS, Fujimori DG, Ideker T, Craik CS, Floor SN, Fraser JS, Gross JD, Sali A, Roth BL, Ruggero D, Taunton J, Kortemme T, Beltrao P, Vignuzzi M, Garcia-Sastre A, Shokat KM, Shoichet BK, Krogan NJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "32353859", "url": "https://glygen.org/publication/PubMed/32353859" } ] }, { "title": "Characterization and Noncovalent Inhibition of the Deubiquitinase and deISGylase Activity of SARS-CoV-2 Papain-Like Protease.", "journal": "ACS infectious diseases", "date": "2020", "authors": "Freitas BT, Durie IA, Murray J, Longo JE, Miller HC, Crich D, Hogan RJ, Tripp RA, Pegan SD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "32428392", "url": "https://glygen.org/publication/PubMed/32428392" } ] }, { "title": "The ORF6, ORF8 and nucleocapsid proteins of SARS-CoV-2 inhibit type I interferon signaling pathway.", "journal": "Virus research", "date": "2020", "authors": "Li JY, Liao CH, Wang Q, Tan YJ, Luo R, Qiu Y, Ge XY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "32589897", "url": "https://glygen.org/publication/PubMed/32589897" } ] }, { "title": "Papain-like protease regulates SARS-CoV-2 viral spread and innate immunity.", "journal": "Nature", "date": "2020", "authors": "Shin D, Mukherjee R, Grewe D, Bojkova D, Baek K, Bhattacharya A, Schulz L, Widera M, Mehdipour AR, Tascher G, Geurink PP, Wilhelm A, van der Heden van Noort GJ, Ovaa H, Muller S, Knobeloch KP, Rajalingam K, Schulman BA, Cinatl J, Hummer G, Ciesek S, Dikic I", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "32726803", "url": "https://glygen.org/publication/PubMed/32726803" } ] }, { "title": "SARS-CoV-2 Orf9b suppresses type I interferon responses by targeting TOM70.", "journal": "Cellular & molecular immunology", "date": "2020", "authors": "Jiang HW, Zhang HN, Meng QF, Xie J, Li Y, Chen H, Zheng YX, Wang XN, Qi H, Zhang J, Wang PH, Han ZG, Tao SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "32728199", "url": "https://glygen.org/publication/PubMed/32728199" } ] }, { "title": "SARS-CoV-2 N protein antagonizes type I interferon signaling by suppressing phosphorylation and nuclear translocation of STAT1 and STAT2.", "journal": "Cell discovery", "date": "2020", "authors": "Mu J, Fang Y, Yang Q, Shu T, Wang A, Huang M, Jin L, Deng F, Qiu Y, Zhou X", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "32953130", "url": "https://glygen.org/publication/PubMed/32953130" } ] }, { "title": "Evasion of Type I Interferon by SARS-CoV-2.", "journal": "Cell reports", "date": "2020", "authors": "Xia H, Cao Z, Xie X, Zhang X, Chen JY, Wang H, Menachery VD, Rajsbaum R, Shi PY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "32979938", "url": "https://glygen.org/publication/PubMed/32979938" } ] }, { "title": "Main protease of SARS-CoV-2 serves as a bifunctional molecule in restricting type I interferon antiviral signaling.", "journal": "Signal transduction and targeted therapy", "date": "2020", "authors": "Wu Y, Ma L, Zhuang Z, Cai S, Zhao Z, Zhou L, Zhang J, Wang PH, Zhao J, Cui J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33024073", "url": "https://glygen.org/publication/PubMed/33024073" } ] }, { "title": "Comparative host-coronavirus protein interaction networks reveal pan-viral disease mechanisms.", "journal": "Science (New York, N.Y.)", "date": "2020", "authors": "Gordon DE, Hiatt J, Bouhaddou M, Rezelj VV, Ulferts S, Braberg H, Jureka AS, Obernier K, Guo JZ, Batra J, Kaake RM, Weckstein AR, Owens TW, Gupta M, Pourmal S, Titus EW, Cakir M, Soucheray M, McGregor M, Cakir Z, Jang G, O'Meara MJ, Tummino TA, Zhang Z, Foussard H, Rojc A, Zhou Y, Kuchenov D, Huttenhain R, Xu J, Eckhardt M, Swaney DL, Fabius JM, Ummadi M, Tutuncuoglu B, Rathore U, Modak M, Haas P, Haas KM, Naing ZZC, Pulido EH, Shi Y, Barrio-Hernandez I, Memon D, Petsalaki E, Dunham A, Marrero MC, Burke D, Koh C, Vallet T, Silvas JA, Azumaya CM, Billesbolle C, Brilot AF, Campbell MG, Diallo A, Dickinson MS, Diwanji D, Herrera N, Hoppe N, Kratochvil HT, Liu Y, Merz GE, Moritz M, Nguyen HC, Nowotny C, Puchades C, Rizo AN, Schulze-Gahmen U, Smith AM, Sun M, Young ID, Zhao J, Asarnow D, Biel J, Bowen A, Braxton JR, Chen J, Chio CM, Chio US, Deshpande I, Doan L, Faust B, Flores S, Jin M, Kim K, Lam VL, Li F, Li J, Li YL, Li Y, Liu X, Lo M, Lopez KE, Melo AA, Moss FR 3rd, Nguyen P, Paulino J, Pawar KI, Peters JK, Pospiech TH Jr, Safari M, Sangwan S, Schaefer K, Thomas PV, Thwin AC, Trenker R, Tse E, Tsui TKM, Wang F, Whitis N, Yu Z, Zhang K, Zhang Y, Zhou F, Saltzberg D, Hodder AJ, Shun-Shion AS, Williams DM, White KM, Rosales R, Kehrer T, Miorin L, Moreno E, Patel AH, Rihn S, Khalid MM, Vallejo-Gracia A, Fozouni P, Simoneau CR, Roth TL, Wu D, Karim MA, Ghoussaini M, Dunham I, Berardi F, Weigang S, Chazal M, Park J, Logue J, McGrath M, Weston S, Haupt R, Hastie CJ, Elliott M, Brown F, Burness KA, Reid E, Dorward M, Johnson C, Wilkinson SG, Geyer A, Giesel DM, Baillie C, Raggett S, Leech H, Toth R, Goodman N, Keough KC, Lind AL, Klesh RJ, Hemphill KR, Carlson-Stevermer J, Oki J, Holden K, Maures T, Pollard KS, Sali A, Agard DA, Cheng Y, Fraser JS, Frost A, Jura N, Kortemme T, Manglik A, Southworth DR, Stroud RM, Alessi DR, Davies P, Frieman MB, Ideker T, Abate C, Jouvenet N, Kochs G, Shoichet B, Ott M, Palmarini M, Shokat KM, Garcia-Sastre A, Rassen JA, Grosse R, Rosenberg OS, Verba KA, Basler CF, Vignuzzi M, Peden AA, Beltrao P, Krogan NJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33060197", "url": "https://glygen.org/publication/PubMed/33060197" } ] }, { "title": "SARS-CoV-2 Orf6 hijacks Nup98 to block STAT nuclear import and antagonize interferon signaling.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2020", "authors": "Miorin L, Kehrer T, Sanchez-Aparicio MT, Zhang K, Cohen P, Patel RS, Cupic A, Makio T, Mei M, Moreno E, Danziger O, White KM, Rathnasinghe R, Uccellini M, Gao S, Aydillo T, Mena I, Yin X, Martin-Sancho L, Krogan NJ, Chanda SK, Schotsaert M, Wozniak RW, Ren Y, Rosenberg BR, Fontoura BMA, Garcia-Sastre A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33097660", "url": "https://glygen.org/publication/PubMed/33097660" } ] }, { "title": "SARS-CoV-2 membrane glycoprotein M antagonizes the MAVS-mediated innate antiviral response.", "journal": "Cellular & molecular immunology", "date": "2021", "authors": "Fu YZ, Wang SY, Zheng ZQ, Yi Huang, Li WW, Xu ZS, Wang YY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33110251", "url": "https://glygen.org/publication/PubMed/33110251" } ] }, { "title": "Proteomic profiling and genome-wide mapping of O-GlcNAc chromatin-associated proteins reveal an O-GlcNAc-regulated genotoxic stress response.", "journal": "Nature communications", "date": "2020", "authors": "Liu Y, Chen Q, Zhang N, Zhang K, Dou T, Cao Y, Liu Y, Li K, Hao X, Xie X, Li W, Ren Y, Zhang J", "evidence": [ { "database": "O-GlcNAc Database", "id": "O75694", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75694" } ], "reference": [ { "type": "PubMed", "id": "33214551", "url": "https://glygen.org/publication/PubMed/33214551" } ] }, { "title": "The SARS-CoV-2 RNA-protein interactome in infected human cells.", "journal": "Nature microbiology", "date": "2021", "authors": "Schmidt N, Lareau CA, Keshishian H, Ganskih S, Schneider C, Hennig T, Melanson R, Werner S, Wei Y, Zimmer M, Ade J, Kirschner L, Zielinski S, Dolken L, Lander ES, Caliskan N, Fischer U, Vogel J, Carr SA, Bodem J, Munschauer M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33349665", "url": "https://glygen.org/publication/PubMed/33349665" } ] }, { "title": "Overexpression of SARS-CoV-2 protein ORF6 dislocates RAE1 and NUP98 from the nuclear pore complex.", "journal": "Biochemical and biophysical research communications", "date": "2021", "authors": "Kato K, Ikliptikawati DK, Kobayashi A, Kondo H, Lim K, Hazawa M, Wong RW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33360543", "url": "https://glygen.org/publication/PubMed/33360543" } ] }, { "title": "Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) membrane (M) protein inhibits type I and III interferon production by targeting RIG-I/MDA-5 signaling.", "journal": "Signal transduction and targeted therapy", "date": "2020", "authors": "Zheng Y, Zhuang MW, Han L, Zhang J, Nan ML, Zhan P, Kang D, Liu X, Gao C, Wang PH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33372174", "url": "https://glygen.org/publication/PubMed/33372174" } ] }, { "title": "SARS-CoV-2 proteases PLpro and 3CLpro cleave IRF3 and critical modulators of inflammatory pathways (NLRP12 and TAB1): implications for disease presentation across species.", "journal": "Emerging microbes & infections", "date": "2021", "authors": "Moustaqil M, Ollivier E, Chiu HP, Van Tol S, Rudolffi-Soto P, Stevens C, Bhumkar A, Hunter DJB, Freiberg AN, Jacques D, Lee B, Sierecki E, Gambin Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33372854", "url": "https://glygen.org/publication/PubMed/33372854" } ] }, { "title": "SARS-CoV-2 Nucleocapsid Protein Interacts with RIG-I and Represses RIG-Mediated IFN-beta Production.", "journal": "Viruses", "date": "2020", "authors": "Chen K, Xiao F, Hu D, Ge W, Tian M, Wang W, Pan P, Wu K, Wu J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33396605", "url": "https://glygen.org/publication/PubMed/33396605" } ] }, { "title": "MDA5 Governs the Innate Immune Response to SARS-CoV-2 in Lung Epithelial Cells.", "journal": "Cell reports", "date": "2021", "authors": "Yin X, Riva L, Pu Y, Martin-Sancho L, Kanamune J, Yamamoto Y, Sakai K, Gotoh S, Miorin L, De Jesus PD, Yang CC, Herbert KM, Yoh S, Hultquist JF, Garcia-Sastre A, Chanda SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33440148", "url": "https://glygen.org/publication/PubMed/33440148" } ] }, { "title": "A new tandem enrichment strategy for the simultaneous profiling of O-GlcNAcylation and phosphorylation in RNA-binding proteome.", "journal": "The Analyst", "date": "2021", "authors": "Fan Z, Li J, Liu T, Zhang Z, Qin W, Qian X", "evidence": [ { "database": "O-GlcNAc Database", "id": "O75694", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75694" }, { "database": "O-GlcNAc Atlas", "id": "O75694", "url": "https://oglcnac.org/atlas/detail/O75694" } ], "reference": [ { "type": "PubMed", "id": "33465208", "url": "https://glygen.org/publication/PubMed/33465208" } ] }, { "title": "SARS-CoV-2 nucleocapsid protein undergoes liquid-liquid phase separation into stress granules through its N-terminal intrinsically disordered region.", "journal": "Cell discovery", "date": "2021", "authors": "Wang J, Shi C, Xu Q, Yin H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33479219", "url": "https://glygen.org/publication/PubMed/33479219" } ] }, { "title": "SARS-CoV-2 nucleocapsid protein phase separates with G3BPs to disassemble stress granules and facilitate viral production.", "journal": "Science bulletin", "date": "2021", "authors": "Luo L, Li Z, Zhao T, Ju X, Ma P, Jin B, Zhou Y, He S, Huang J, Xu X, Zou Y, Li P, Liang A, Liu J, Chi T, Huang X, Ding Q, Jin Z, Huang C, Zhang Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33495715", "url": "https://glygen.org/publication/PubMed/33495715" } ] }, { "title": "SARS-CoV-2 triggers an MDA-5-dependent interferon response which is unable to control replication in lung epithelial cells.", "journal": "Journal of virology", "date": "2021", "authors": "Rebendenne A, Valadao ALC, Tauziet M, Maarifi G, Bonaventure B, McKellar J, Planes R, Nisole S, Arnaud-Arnould M, Moncorge O, Goujon C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33514628", "url": "https://glygen.org/publication/PubMed/33514628" } ] }, { "title": "SARS-CoV-2 ORF9b inhibits RIG-I-MAVS antiviral signaling by interrupting K63-linked ubiquitination of NEMO.", "journal": "Cell reports", "date": "2021", "authors": "Wu J, Shi Y, Pan X, Wu S, Hou R, Zhang Y, Zhong T, Tang H, Du W, Wang L, Wo J, Mu J, Qiu Y, Yang K, Zhang LK, Ye BC, Qi N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33567255", "url": "https://glygen.org/publication/PubMed/33567255" } ] }, { "title": "SARS-CoV-2, SARS-CoV-1, and HIV-1 derived ssRNA sequences activate the NLRP3 inflammasome in human macrophages through a non-classical pathway.", "journal": "iScience", "date": "2021", "authors": "Campbell GR, To RK, Hanna J, Spector SA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33718825", "url": "https://glygen.org/publication/PubMed/33718825" } ] }, { "title": "Unique and complementary suppression of cGAS-STING and RNA sensing- triggered innate immune responses by SARS-CoV-2 proteins.", "journal": "Signal transduction and targeted therapy", "date": "2021", "authors": "Rui Y, Su J, Shen S, Hu Y, Huang D, Zheng W, Lou M, Shi Y, Wang M, Chen S, Zhao N, Dong Q, Cai Y, Xu R, Zheng S, Yu XF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33723219", "url": "https://glygen.org/publication/PubMed/33723219" } ] }, { "title": "ORF8 contributes to cytokine storm during SARS-CoV-2 infection by activating IL-17 pathway.", "journal": "iScience", "date": "2021", "authors": "Lin X, Fu B, Yin S, Li Z, Liu H, Zhang H, Xing N, Wang Y, Xue W, Xiong Y, Zhang S, Zhao Q, Xu S, Zhang J, Wang P, Nian W, Wang X, Wu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33723527", "url": "https://glygen.org/publication/PubMed/33723527" } ] }, { "title": "ISG15-dependent activation of the sensor MDA5 is antagonized by the SARS-CoV-2 papain-like protease to evade host innate immunity.", "journal": "Nature microbiology", "date": "2021", "authors": "Liu G, Lee JH, Parker ZM, Acharya D, Chiang JJ, van Gent M, Riedl W, Davis-Gardner ME, Wies E, Chiang C, Gack MU", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33727702", "url": "https://glygen.org/publication/PubMed/33727702" } ] }, { "title": "SARS-CoV-2 Nucleocapsid Protein Targets RIG-I-Like Receptor Pathways to Inhibit the Induction of Interferon Response.", "journal": "Cells", "date": "2021", "authors": "Oh SJ, Shin OS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33801464", "url": "https://glygen.org/publication/PubMed/33801464" } ] }, { "title": "CNBP Binds and Unfolds In Vitro G-Quadruplexes Formed in the SARS-CoV-2 Positive and Negative Genome Strands.", "journal": "International journal of molecular sciences", "date": "2021", "authors": "Bezzi G, Piga EJ, Binolfi A, Armas P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33807682", "url": "https://glygen.org/publication/PubMed/33807682" } ] }, { "title": "SARS-CoV-2 ORF6 Disrupts Bidirectional Nucleocytoplasmic Transport through Interactions with Rae1 and Nup98.", "journal": "mBio", "date": "2021", "authors": "Addetia A, Lieberman NAP, Phung Q, Hsiang TY, Xie H, Roychoudhury P, Shrestha L, Loprieno MA, Huang ML, Gale M Jr, Jerome KR, Greninger AL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33849972", "url": "https://glygen.org/publication/PubMed/33849972" } ] }, { "title": "RNA-induced liquid phase separation of SARS-CoV-2 nucleocapsid protein facilitates NF-kappaB hyper-activation and inflammation.", "journal": "Signal transduction and targeted therapy", "date": "2021", "authors": "Wu Y, Ma L, Cai S, Zhuang Z, Zhao Z, Jin S, Xie W, Zhou L, Zhang L, Zhao J, Cui J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33895773", "url": "https://glygen.org/publication/PubMed/33895773" } ] }, { "title": "TLR2 senses the SARS-CoV-2 envelope protein to produce inflammatory cytokines.", "journal": "Nature immunology", "date": "2021", "authors": "Zheng M, Karki R, Williams EP, Yang D, Fitzpatrick E, Vogel P, Jonsson CB, Kanneganti TD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33963333", "url": "https://glygen.org/publication/PubMed/33963333" } ] }, { "title": "The SARS-CoV-2 RNA interactome.", "journal": "Molecular cell", "date": "2021", "authors": "Lee S, Lee YS, Choi Y, Son A, Park Y, Lee KM, Kim J, Kim JS, Kim VN", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33989516", "url": "https://glygen.org/publication/PubMed/33989516" } ] }, { "title": "Crystal structure of SARS-CoV-2 Orf9b in complex with human TOM70 suggests unusual virus-host interactions.", "journal": "Nature communications", "date": "2021", "authors": "Gao X, Zhu K, Qin B, Olieric V, Wang M, Cui S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "33990585", "url": "https://glygen.org/publication/PubMed/33990585" } ] }, { "title": "O-GlcNAc modification regulates MTA1 transcriptional activity during breast cancer cell genotoxic adaptation.", "journal": "Biochimica et biophysica acta. General subjects", "date": "2021", "authors": "Xie X, Wu Q, Zhang K, Liu Y, Zhang N, Chen Q, Wang L, Li W, Zhang J, Liu Y", "evidence": [ { "database": "O-GlcNAc Database", "id": "O75694", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75694" } ], "reference": [ { "type": "PubMed", "id": "34019948", "url": "https://glygen.org/publication/PubMed/34019948" } ] }, { "title": "The ORF8 protein of SARS-CoV-2 mediates immune evasion through down-regulating MHC-Iota.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2021", "authors": "Zhang Y, Chen Y, Li Y, Huang F, Luo B, Yuan Y, Xia B, Ma X, Yang T, Yu F, Liu J, Liu B, Song Z, Chen J, Yan S, Wu L, Pan T, Zhang X, Li R, Huang W, He X, Xiao F, Zhang J, Zhang H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "34021074", "url": "https://glygen.org/publication/PubMed/34021074" } ] }, { "title": "Human Surfactant Protein D Binds Spike Protein and Acts as an Entry Inhibitor of SARS-CoV-2 Pseudotyped Viral Particles.", "journal": "Frontiers in immunology", "date": "2021", "authors": "Hsieh MH, Beirag N, Murugaiah V, Chou YC, Kuo WS, Kao HF, Madan T, Kishore U, Wang JY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "34054808", "url": "https://glygen.org/publication/PubMed/34054808" } ] }, { "title": "SARS-CoV-2 Membrane Protein Inhibits Type I Interferon Production Through Ubiquitin-Mediated Degradation of TBK1.", "journal": "Frontiers in immunology", "date": "2021", "authors": "Sui L, Zhao Y, Wang W, Wu P, Wang Z, Yu Y, Hou Z, Tan G, Liu Q", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "34084167", "url": "https://glygen.org/publication/PubMed/34084167" } ] }, { "title": "Conformational Dynamics in the Interaction of SARS-CoV-2 Papain-like Protease with Human Interferon-Stimulated Gene 15 Protein.", "journal": "The journal of physical chemistry letters", "date": "2021", "authors": "Leite WC, Weiss KL, Phillips G, Zhang Q, Qian S, Tsutakawa SE, Coates L, O'Neill H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "34110168", "url": "https://glygen.org/publication/PubMed/34110168" } ] }, { "title": "SARS-CoV-2 viral proteins NSP1 and NSP13 inhibit interferon activation through distinct mechanisms.", "journal": "PloS one", "date": "2021", "authors": "Vazquez C, Swanson SE, Negatu SG, Dittmar M, Miller J, Ramage HR, Cherry S, Jurado KA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "34166398", "url": "https://glygen.org/publication/PubMed/34166398" } ] }, { "title": "Targeting liquid-liquid phase separation of SARS-CoV-2 nucleocapsid protein promotes innate antiviral immunity by elevating MAVS activity.", "journal": "Nature cell biology", "date": "2021", "authors": "Wang S, Dai T, Qin Z, Pan T, Chu F, Lou L, Zhang L, Yang B, Huang H, Lu H, Zhou F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "34239064", "url": "https://glygen.org/publication/PubMed/34239064" } ] }, { "title": "Lectin Pathway Mediates Complement Activation by SARS-CoV-2 Proteins.", "journal": "Frontiers in immunology", "date": "2021", "authors": "Ali YM, Ferrari M, Lynch NJ, Yaseen S, Dudler T, Gragerov S, Demopulos G, Heeney JL, Schwaeble WJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "34290717", "url": "https://glygen.org/publication/PubMed/34290717" } ] }, { "title": "SARS-CoV-2 N protein promotes NLRP3 inflammasome activation to induce hyperinflammation.", "journal": "Nature communications", "date": "2021", "authors": "Pan P, Shen M, Yu Z, Ge W, Chen K, Tian M, Xiao F, Wang Z, Wang J, Jia Y, Wang W, Wan P, Zhang J, Chen W, Lei Z, Chen X, Luo Z, Zhang Q, Xu M, Li G, Li Y, Wu J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "34341353", "url": "https://glygen.org/publication/PubMed/34341353" } ] }, { "title": "SARS-CoV-2-associated ssRNAs activate inflammation and immunity via TLR7/8.", "journal": "JCI insight", "date": "2021", "authors": "Salvi V, Nguyen HO, Sozio F, Schioppa T, Gaudenzi C, Laffranchi M, Scapini P, Passari M, Barbazza I, Tiberio L, Tamassia N, Garlanda C, Del Prete A, Cassatella MA, Mantovani A, Sozzani S, Bosisio D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "34375313", "url": "https://glygen.org/publication/PubMed/34375313" } ] }, { "title": "Molecular determinants for regulation of G3BP1/2 phase separation by the SARS-CoV-2 nucleocapsid protein.", "journal": "Cell discovery", "date": "2021", "authors": "Huang W, Ju X, Tian M, Li X, Yu Y, Sun Q, Ding Q, Jia D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "34400613", "url": "https://glygen.org/publication/PubMed/34400613" } ] }, { "title": "Full-Length Recombinant hSP-D Binds and Inhibits SARS-CoV-2.", "journal": "Biomolecules", "date": "2021", "authors": "Arroyo R, Grant SN, Colombo M, Salvioni L, Corsi F, Truffi M, Ottolina D, Hurst B, Salzberg M, Prosperi D, Kingma PS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "34439781", "url": "https://glygen.org/publication/PubMed/34439781" } ] }, { "title": "SARS-CoV-2 N Protein Targets TRIM25-Mediated RIG-I Activation to Suppress Innate Immunity.", "journal": "Viruses", "date": "2021", "authors": "Gori Savellini G, Anichini G, Gandolfo C, Cusi MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "34452305", "url": "https://glygen.org/publication/PubMed/34452305" } ] }, { "title": "A dual-role of SARS-CoV-2 nucleocapsid protein in regulating innate immune response.", "journal": "Signal transduction and targeted therapy", "date": "2021", "authors": "Zhao Y, Sui L, Wu P, Wang W, Wang Z, Yu Y, Hou Z, Tan G, Liu Q, Wang G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "34471099", "url": "https://glygen.org/publication/PubMed/34471099" } ] }, { "title": "Phosphorylation of SARS-CoV-2 Orf9b Regulates Its Targeting to Two Binding Sites in TOM70 and Recruitment of Hsp90.", "journal": "International journal of molecular sciences", "date": "2021", "authors": "Brandherm L, Kobas AM, Klohn M, Bruggemann Y, Pfaender S, Rassow J, Kreimendahl S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "34502139", "url": "https://glygen.org/publication/PubMed/34502139" } ] }, { "title": "The proximal proteome of 17 SARS-CoV-2 proteins links to disrupted antiviral signaling and host translation.", "journal": "PLoS pathogens", "date": "2021", "authors": "Meyers JM, Ramanathan M, Shanderson RL, Beck A, Donohue L, Ferguson I, Guo MG, Rao DS, Miao W, Reynolds D, Yang X, Zhao Y, Yang YY, Blish C, Wang Y, Khavari PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "34597346", "url": "https://glygen.org/publication/PubMed/34597346" } ] }, { "title": "Truncation of the TPR domain of OGT alters substrate and glycosite selection.", "journal": "Analytical and bioanalytical chemistry", "date": "2021", "authors": "Ramirez DH, Yang B, D'Souza AK, Shen D, Woo CM", "evidence": [ { "database": "O-GlcNAc Database", "id": "O75694", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75694" } ], "reference": [ { "type": "PubMed", "id": "34725712", "url": "https://glygen.org/publication/PubMed/34725712" } ] }, { "title": "Comparative O-GlcNAc Proteomic Analysis Reveals a Role of O-GlcNAcylated SAM68 in Lung Cancer Aggressiveness.", "journal": "Cancers", "date": "2022", "authors": "Lin CH, Liao CC, Wang SY, Peng CY, Yeh YC, Chen MY, Chou TY", "evidence": [ { "database": "O-GlcNAc Database", "id": "O75694", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75694" } ], "reference": [ { "type": "PubMed", "id": "35008409", "url": "https://glygen.org/publication/PubMed/35008409" } ] }, { "title": "O-GlcNAcylation promotes fatty acid synthase activity under nutritional stress as a pro-survival mechanism in cancer cells.", "journal": "Proteomics", "date": "2022", "authors": "Wong YK, Wang J, Lim TK, Lin Q, Yap CT, Shen HM", "evidence": [ { "database": "O-GlcNAc Database", "id": "O75694", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75694" } ], "reference": [ { "type": "PubMed", "id": "35083852", "url": "https://glygen.org/publication/PubMed/35083852" } ] }, { "title": "Binding of SARS-CoV-2 protein ORF9b to mitochondrial translocase TOM70 prevents its interaction with chaperone HSP90.", "journal": "Biochimie", "date": "2022-09", "authors": "Ayinde Kehinde S, Pinheiro Glaucia M S, Ramos Carlos H I", "evidence": [ { "database": "Reactome", "id": "R-HSA-9705671", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671" } ], "reference": [ { "type": "PubMed", "id": "35643212", "url": "https://glygen.org/publication/PubMed/35643212" } ] }, { "title": "Studying the O-GlcNAcome of human placentas using banked tissue samples.", "journal": "Glycobiology", "date": "2024-01-22", "authors": "Luna Sarai, Malard Florian, Pereckas Michaela, Aoki Mayumi, Aoki Kazahiro, Olivier-Van Stichelen Stephanie", "evidence": [ { "database": "O-GlcNAc Database", "id": "O75694", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75694" } ], "reference": [ { "type": "PubMed", "id": "38253038", "url": "https://glygen.org/publication/PubMed/38253038" } ] }, { "title": "A unique cap(m7GpppXm)-dependent influenza virion endonuclease cleaves capped RNAs to generate the primers that initiate viral RNA transcription.", "journal": "Cell", "date": "1981", "authors": "Plotch SJ, Bouloy M, Ulmanen I, Krug RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-168325", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168325" } ], "reference": [ { "type": "PubMed", "id": "6261960", "url": "https://glygen.org/publication/PubMed/6261960" } ] }, { "title": "Specific RNA-cleaving activities from HeLa cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1980", "authors": "Ferrari S, Yehle CO, Robertson HD, Dickson E", "evidence": [ { "database": "Reactome", "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531" } ], "reference": [ { "type": "PubMed", "id": "6930639", "url": "https://glygen.org/publication/PubMed/6930639" } ] }, { "title": "Nuclear import of influenza virus RNA can be mediated by viral nucleoprotein and transport factors required for protein import.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "O'Neill RE, Jaskunas R, Blobel G, Palese P, Moroianu J", "evidence": [ { "database": "Reactome", "id": "R-HSA-168271", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168271" } ], "reference": [ { "type": "PubMed", "id": "7559393", "url": "https://glygen.org/publication/PubMed/7559393" } ] }, { "title": "Hip, a novel cochaperone involved in the eukaryotic Hsc70/Hsp40 reaction cycle.", "journal": "Cell", "date": "1995", "authors": "Hohfeld J, Minami Y, Hartl FU", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371453", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371453" } ], "reference": [ { "type": "PubMed", "id": "7585962", "url": "https://glygen.org/publication/PubMed/7585962" } ] }, { "title": "Human mitochondrial tRNA processing.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Rossmanith W, Tullo A, Potuschak T, Karwan R, Sbisa E", "evidence": [ { "database": "Reactome", "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531" } ], "reference": [ { "type": "PubMed", "id": "7759547", "url": "https://glygen.org/publication/PubMed/7759547" } ] }, { "title": "Differential activation of the influenza virus polymerase via template RNA binding.", "journal": "Journal of virology", "date": "1995", "authors": "Cianci C, Tiley L, Krystal M", "evidence": [ { "database": "Reactome", "id": "R-HSA-168325", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168325" } ], "reference": [ { "type": "PubMed", "id": "7769657", "url": "https://glygen.org/publication/PubMed/7769657" } ] }, { "title": "Substrate recognition by human RNase P: identification of small, model substrates for the enzyme.", "journal": "The EMBO journal", "date": "1995", "authors": "Yuan Y, Altman S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531" } ], "reference": [ { "type": "PubMed", "id": "7828588", "url": "https://glygen.org/publication/PubMed/7828588" } ] }, { "title": "Human RanGTPase-activating protein RanGAP1 is a homologue of yeast Rna1p involved in mRNA processing and transport.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Bischoff FR, Krebber H, Kempf T, Hermes I, Ponstingl H", "evidence": [ { "database": "Reactome", "id": "R-HSA-165054", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-165054" } ], "reference": [ { "type": "PubMed", "id": "7878053", "url": "https://glygen.org/publication/PubMed/7878053" } ] }, { "title": "The HIV-1 Rev trans-activator shuttles between the nucleus and the cytoplasm.", "journal": "Genes & development", "date": "1994", "authors": "Meyer BE, Malim MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-165054", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-165054" } ], "reference": [ { "type": "PubMed", "id": "7958838", "url": "https://glygen.org/publication/PubMed/7958838" } ] }, { "title": "A small percentage of influenza virus M1 protein contains zinc but zinc does not influence in vitro M1-RNA interaction.", "journal": "The Journal of general virology", "date": "1994", "authors": "Elster C, Fourest E, Baudin F, Larsen K, Cusack S, Ruigrok RW", "evidence": [ { "database": "Reactome", "id": "R-HSA-168333", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168333" } ], "reference": [ { "type": "PubMed", "id": "8113738", "url": "https://glygen.org/publication/PubMed/8113738" } ] }, { "title": "m3G cap hypermethylation of U1 small nuclear ribonucleoprotein (snRNP) in vitro: evidence that the U1 small nuclear RNA-(guanosine-N2)-methyltransferase is a non-snRNP cytoplasmic protein that requires a binding site on the Sm core domain.", "journal": "Molecular and cellular biology", "date": "1994", "authors": "Plessel G, Fischer U, Luhrmann R", "evidence": [ { "database": "Reactome", "id": "R-HSA-191859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-191859" } ], "reference": [ { "type": "PubMed", "id": "8196654", "url": "https://glygen.org/publication/PubMed/8196654" } ] }, { "title": "Influenza virus NS1 protein inhibits pre-mRNA splicing and blocks mRNA nucleocytoplasmic transport.", "journal": "The EMBO journal", "date": "1994", "authors": "Fortes P, Beloso A, Ortin J", "evidence": [ { "database": "Reactome", "id": "R-HSA-168276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168276" } ], "reference": [ { "type": "PubMed", "id": "8313914", "url": "https://glygen.org/publication/PubMed/8313914" } ] }, { "title": "Molecular cloning of human p48, a transient component of progesterone receptor complexes and an Hsp70-binding protein.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "1996", "authors": "Prapapanich V, Chen S, Nair SC, Rimerman RA, Smith DF", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371453", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371453" } ], "reference": [ { "type": "PubMed", "id": "8721986", "url": "https://glygen.org/publication/PubMed/8721986" } ] }, { "title": "HIV Rev uses a conserved cellular protein export pathway for the nucleocytoplasmic transport of viral RNAs.", "journal": "Current biology : CB", "date": "1996", "authors": "Fritz CC, Green MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-165054", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-165054" } ], "reference": [ { "type": "PubMed", "id": "8805303", "url": "https://glygen.org/publication/PubMed/8805303" } ] }, { "title": "Repression of human heat shock factor 1 activity at control temperature by phosphorylation.", "journal": "Genes & development", "date": "1996", "authors": "Knauf U, Newton EM, Kyriakis J, Kingston RE", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371453", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371453" } ], "reference": [ { "type": "PubMed", "id": "8946918", "url": "https://glygen.org/publication/PubMed/8946918" } ] }, { "title": "A small ubiquitin-related polypeptide involved in targeting RanGAP1 to nuclear pore complex protein RanBP2.", "journal": "Cell", "date": "1997", "authors": "Mahajan R, Delphin C, Guan T, Gerace L, Melchior F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9615933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9615933" } ], "reference": [ { "type": "PubMed", "id": "9019411", "url": "https://glygen.org/publication/PubMed/9019411" } ] }, { "title": "Nucleolar protein B23 stimulates nuclear import of the HIV-1 Rev protein and NLS-conjugated albumin.", "journal": "Biochemistry", "date": "1997", "authors": "Szebeni A, Mehrotra B, Baumann A, Adam SA, Wingfield PT, Olson MO", "evidence": [ { "database": "Reactome", "id": "R-HSA-180746", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180746" } ], "reference": [ { "type": "PubMed", "id": "9092824", "url": "https://glygen.org/publication/PubMed/9092824" } ] }, { "title": "A novel class of RanGTP binding proteins.", "journal": "The Journal of cell biology", "date": "1997", "authors": "Gorlich D, Dabrowski M, Bischoff FR, Kutay U, Bork P, Hartmann E, Prehn S, Izaurralde E", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "9214382", "url": "https://glygen.org/publication/PubMed/9214382" } ] }, { "title": "BAG-1 modulates the chaperone activity of Hsp70/Hsc70.", "journal": "The EMBO journal", "date": "1997", "authors": "Takayama S, Bimston DN, Matsuzawa S, Freeman BC, Aime-Sempe C, Xie Z, Morimoto RI, Reed JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371453", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371453" } ], "reference": [ { "type": "PubMed", "id": "9305631", "url": "https://glygen.org/publication/PubMed/9305631" } ] }, { "title": "Interactions between HIV Rev and nuclear import and export factors: the Rev nuclear localisation signal mediates specific binding to human importin-beta.", "journal": "Journal of molecular biology", "date": "1997", "authors": "Henderson BR, Percipalle P", "evidence": [ { "database": "Reactome", "id": "R-HSA-180746", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180746" } ], "reference": [ { "type": "PubMed", "id": "9405152", "url": "https://glygen.org/publication/PubMed/9405152" } ] }, { "title": "Evidence for covalent modification of the nuclear dot-associated proteins PML and Sp100 by PIC1/SUMO-1.", "journal": "The Journal of cell biology", "date": "1997", "authors": "Sternsdorf T, Jensen K, Will H", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "9412458", "url": "https://glygen.org/publication/PubMed/9412458" } ] }, { "title": "HIV-1 Vpr interacts with the nuclear transport pathway to promote macrophage infection.", "journal": "Genes & development", "date": "1998", "authors": "Vodicka MA, Koepp DM, Silver PA, Emerman M", "evidence": [ { "database": "Reactome", "id": "R-HSA-180910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180910" } ], "reference": [ { "type": "PubMed", "id": "9436978", "url": "https://glygen.org/publication/PubMed/9436978" } ] }, { "title": "Covalent modification of PML by the sentrin family of ubiquitin-like proteins.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Kamitani T, Nguyen HP, Kito K, Fukuda-Kamitani T, Yeh ET", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "9452416", "url": "https://glygen.org/publication/PubMed/9452416" } ] }, { "title": "Modification of Ran GTPase-activating protein by the small ubiquitin-related modifier SUMO-1 requires Ubc9, an E2-type ubiquitin-conjugating enzyme homologue.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Lee GW, Melchior F, Matunis MJ, Mahajan R, Tian Q, Anderson P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9615933", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9615933" } ], "reference": [ { "type": "PubMed", "id": "9497385", "url": "https://glygen.org/publication/PubMed/9497385" } ] }, { "title": "Identification of a nuclear export receptor for tRNA.", "journal": "Current biology : CB", "date": "1998", "authors": "Arts GJ, Fornerod M, Mattaj IW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531" } ], "reference": [ { "type": "PubMed", "id": "9512417", "url": "https://glygen.org/publication/PubMed/9512417" } ] }, { "title": "Ubiquitin is covalently attached to the p6Gag proteins of human immunodeficiency virus type 1 and simian immunodeficiency virus and to the p12Gag protein of Moloney murine leukemia virus.", "journal": "Journal of virology", "date": "1998", "authors": "Ott DE, Coren LV, Copeland TD, Kane BP, Johnson DG, Sowder RC 2nd, Yoshinaka Y, Oroszlan S, Arthur LO, Henderson LE", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "9525617", "url": "https://glygen.org/publication/PubMed/9525617" } ] }, { "title": "Viral protein R regulates docking of the HIV-1 preintegration complex to the nuclear pore complex.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Popov S, Rexach M, Ratner L, Blobel G, Bukrinsky M", "evidence": [ { "database": "Reactome", "id": "R-HSA-180910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180910" } ], "reference": [ { "type": "PubMed", "id": "9582382", "url": "https://glygen.org/publication/PubMed/9582382" } ] }, { "title": "The human homologue of Saccharomyces cerevisiae Gle1p is required for poly(A)+ RNA export.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Watkins JL, Murphy R, Emtage JL, Wente SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-159236", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159236" } ], "reference": [ { "type": "PubMed", "id": "9618489", "url": "https://glygen.org/publication/PubMed/9618489" } ] }, { "title": "Influenza virus NS1 protein interacts with the cellular 30 kDa subunit of CPSF and inhibits 3'end formation of cellular pre-mRNAs.", "journal": "Molecular cell", "date": "1998", "authors": "Nemeroff ME, Barabino SM, Li Y, Keller W, Krug RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-168276", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168276" } ], "reference": [ { "type": "PubMed", "id": "9651582", "url": "https://glygen.org/publication/PubMed/9651582" } ] }, { "title": "Identification of a tRNA-specific nuclear export receptor.", "journal": "Molecular cell", "date": "1998", "authors": "Kutay U, Lipowsky G, Izaurralde E, Bischoff FR, Schwarzmaier P, Hartmann E, Gorlich D", "evidence": [ { "database": "Reactome", "id": "R-HSA-6784531", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531" } ], "reference": [ { "type": "PubMed", "id": "9660920", "url": "https://glygen.org/publication/PubMed/9660920" } ] }, { "title": "TAP, the human homolog of Mex67p, mediates CTE-dependent RNA export from the nucleus.", "journal": "Molecular cell", "date": "1998", "authors": "Gruter P, Tabernero C, von Kobbe C, Schmitt C, Saavedra C, Bachi A, Wilm M, Felber BK, Izaurralde E", "evidence": [ { "database": "Reactome", "id": "R-HSA-159236", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159236" } ], "reference": [ { "type": "PubMed", "id": "9660949", "url": "https://glygen.org/publication/PubMed/9660949" } ] }, { "title": "RNA-dependent activation of primer RNA production by influenza virus polymerase: different regions of the same protein subunit constitute the two required RNA-binding sites.", "journal": "The EMBO journal", "date": "1998", "authors": "Li ML, Ramirez BC, Krug RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-168325", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168325" } ], "reference": [ { "type": "PubMed", "id": "9755184", "url": "https://glygen.org/publication/PubMed/9755184" } ] }, { "title": "Identification of three major sentrinization sites in PML.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Kamitani T, Kito K, Nguyen HP, Wada H, Fukuda-Kamitani T, Yeh ET", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "9756909", "url": "https://glygen.org/publication/PubMed/9756909" } ] }, { "title": "The specificity of the CRM1-Rev nuclear export signal interaction is mediated by RanGTP.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Askjaer P, Jensen TH, Nilsson J, Englmeier L, Kjems J", "evidence": [ { "database": "Reactome", "id": "R-HSA-165054", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-165054" } ], "reference": [ { "type": "PubMed", "id": "9837918", "url": "https://glygen.org/publication/PubMed/9837918" } ] }, { "title": "A novel function for SMN, the spinal muscular atrophy disease gene product, in pre-mRNA splicing.", "journal": "Cell", "date": "1998", "authors": "Pellizzoni L, Kataoka N, Charroux B, Dreyfuss G", "evidence": [ { "database": "Reactome", "id": "R-HSA-191859", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-191859" } ], "reference": [ { "type": "PubMed", "id": "9845364", "url": "https://glygen.org/publication/PubMed/9845364" } ] }, { "title": "An evolutionarily conserved family of Hsp70/Hsc70 molecular chaperone regulators.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Takayama S, Xie Z, Reed JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371453", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371453" } ], "reference": [ { "type": "PubMed", "id": "9873016", "url": "https://glygen.org/publication/PubMed/9873016" } ] }, { "title": "SUMO-1 modification of the acute promyelocytic leukaemia protein PML: implications for nuclear localisation.", "journal": "Journal of cell science", "date": "1999", "authors": "Duprez E, Saurin AJ, Desterro JM, Lallemand-Breitenbach V, Howe K, Boddy MN, Solomon E, de The H, Hay RT, Freemont PS", "evidence": [ { "database": "Reactome", "id": "R-HSA-3108214", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214" } ], "reference": [ { "type": "PubMed", "id": "9885291", "url": "https://glygen.org/publication/PubMed/9885291" } ] }, { "title": "The cellular inhibitor of the PKR protein kinase, P58(IPK), is an influenza virus-activated co-chaperone that modulates heat shock protein 70 activity.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Melville MW, Tan SL, Wambach M, Song J, Morimoto RI, Katze MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371453", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371453" } ], "reference": [ { "type": "PubMed", "id": "9920933", "url": "https://glygen.org/publication/PubMed/9920933" } ] } ], "pathway": [ { "id": "hsa:9631", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:9631", "resource": "KEGG Pathway" }, { "id": "R-HSA-1169408", "name": "ISG15 antiviral mechanism", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408", "resource": "Reactome", "description": "ISG15 antiviral mechanism" }, { "id": "R-HSA-159227", "name": "Transport of the SLBP independent Mature mRNA", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159227", "resource": "Reactome", "description": "Transport of the SLBP independent Mature mRNA" }, { "id": "R-HSA-159230", "name": "Transport of the SLBP Dependant Mature mRNA", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159230", "resource": "Reactome", "description": "Transport of the SLBP Dependant Mature mRNA" }, { "id": "R-HSA-159231", "name": "Transport of Mature mRNA Derived from an Intronless Transcript", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159231", "resource": "Reactome", "description": "Transport of Mature mRNA Derived from an Intronless Transcript" }, { "id": "R-HSA-159236", "name": "Transport of Mature mRNA derived from an Intron-Containing Transcript", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-159236", "resource": "Reactome", "description": "Transport of Mature mRNA derived from an Intron-Containing Transcript" }, { "id": "R-HSA-165054", "name": "Rev-mediated nuclear export of HIV RNA", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-165054", "resource": "Reactome", "description": "Rev-mediated nuclear export of HIV RNA" }, { "id": "R-HSA-168271", "name": "Transport of Ribonucleoproteins into the Host Nucleus", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168271", "resource": "Reactome", "description": "Transport of Ribonucleoproteins into the Host Nucleus" }, { "id": "R-HSA-168276", "name": "NS1 Mediated Effects on Host Pathways", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168276", "resource": "Reactome", "description": "NS1 Mediated Effects on Host Pathways" }, { "id": "R-HSA-168325", "name": "Viral Messenger RNA Synthesis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168325", "resource": "Reactome", "description": "Viral Messenger RNA Synthesis" }, { "id": "R-HSA-168333", "name": "NEP/NS2 Interacts with the Cellular Export Machinery", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168333", "resource": "Reactome", "description": "NEP/NS2 Interacts with the Cellular Export Machinery" }, { "id": "R-HSA-170822", "name": "Regulation of Glucokinase by Glucokinase Regulatory Protein", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-170822", "resource": "Reactome", "description": "Regulation of Glucokinase by Glucokinase Regulatory Protein" }, { "id": "R-HSA-180746", "name": "Nuclear import of Rev protein", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180746", "resource": "Reactome", "description": "Nuclear import of Rev protein" }, { "id": "R-HSA-180910", "name": "Vpr-mediated nuclear import of PICs", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180910", "resource": "Reactome", "description": "Vpr-mediated nuclear import of PICs" }, { "id": "R-HSA-191859", "name": "snRNP Assembly", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-191859", "resource": "Reactome", "description": "snRNP Assembly" }, { "id": "R-HSA-3108214", "name": "SUMOylation of DNA damage response and repair proteins", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3108214", "resource": "Reactome", "description": "SUMOylation of DNA damage response and repair proteins" }, { "id": "R-HSA-3232142", "name": "SUMOylation of ubiquitinylation proteins", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3232142", "resource": "Reactome", "description": "SUMOylation of ubiquitinylation proteins" }, { "id": "R-HSA-3301854", "name": "Nuclear Pore Complex (NPC) Disassembly", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3301854", "resource": "Reactome", "description": "Nuclear Pore Complex (NPC) Disassembly" }, { "id": "R-HSA-3371453", "name": "Regulation of HSF1-mediated heat shock response", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371453", "resource": "Reactome", "description": "Regulation of HSF1-mediated heat shock response" }, { "id": "R-HSA-4085377", "name": "SUMOylation of SUMOylation proteins", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4085377", "resource": "Reactome", "description": "SUMOylation of SUMOylation proteins" }, { "id": "R-HSA-4551638", "name": "SUMOylation of chromatin organization proteins", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4551638", "resource": "Reactome", "description": "SUMOylation of chromatin organization proteins" }, { "id": "R-HSA-4570464", "name": "SUMOylation of RNA binding proteins", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4570464", "resource": "Reactome", "description": "SUMOylation of RNA binding proteins" }, { "id": "R-HSA-4615885", "name": "SUMOylation of DNA replication proteins", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4615885", "resource": "Reactome", "description": "SUMOylation of DNA replication proteins" }, { "id": "R-HSA-5578749", "name": "Transcriptional regulation by small RNAs", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749", "resource": "Reactome", "description": "Transcriptional regulation by small RNAs" }, { "id": "R-HSA-5619107", "name": "Defective TPR may confer susceptibility towards thyroid papillary carcinoma (TPC)", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5619107", "resource": "Reactome", "description": "Defective TPR may confer susceptibility towards thyroid papillary carcinoma (TPC)" }, { "id": "R-HSA-6784531", "name": "tRNA processing in the nucleus", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6784531", "resource": "Reactome", "description": "tRNA processing in the nucleus" }, { "id": "R-HSA-9609690", "name": "HCMV Early Events", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9609690", "resource": "Reactome", "description": "HCMV Early Events" }, { "id": "R-HSA-9610379", "name": "HCMV Late Events", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9610379", "resource": "Reactome", "description": "HCMV Late Events" }, { "id": "R-HSA-9615933", "name": "Postmitotic nuclear pore complex (NPC) reformation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9615933", "resource": "Reactome", "description": "Postmitotic nuclear pore complex (NPC) reformation" }, { "id": "R-HSA-9705671", "name": "SARS-CoV-2 activates/modulates innate and adaptive immune responses", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9705671", "resource": "Reactome", "description": "SARS-CoV-2 activates/modulates innate and adaptive immune responses" } ], "orthologs": [ { "uniprot_canonical_ac": "P37199-1", "protein_name": "Nuclear pore complex protein Nup155", "gene_name": "Nup155", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MPSMLGSMMVASTSAPSLQEALENAGRLIDRQLQEDRMYPDLSELLMVSAPNSPTVSGMSDMDYPLQGPGLLSVPSLPEISTIRRVPLRLSWLNSLDTCSVTAMMGVFPPISRAWLTIDSDIFMWNYEDGGDLAYFDGLSETILAVGLVKPKAGIFQPHVRHLLVLATPVDIVILGLSYANVQTGSGILNDSVCGGLQLLPDPLYSLPTDNTYLLTITSTDNGRIFLAGKDGCLYEVAYQAEAGWFSQRCRKINHSKSSLSFLVPSLLQFTFSEDDPIVQIEIDNSRNILYTRSEKGVIQVYDLGHDGQGMSRVASVSQNAIVCAAGNIARTIDRSVFKPIVQIAVIENSESLDCQLLAVTHAGVRLYFSTCPFRQPLARPNTLTLVHVRLPPGFSASSTVEKPSKVHKALYSKGILLMTASENEDNDILWCVNHDTFPFQKPMMETQMTTRVDGHSWALSAIDELKVDKIITPLNKDHIPITDSPVVVQQHMLPPKKFVLLSAQGSLMFHKLRPVDQLRHLLVSNVGGDGEEIERFFKLHQEDQACATCLILACSTAACDREVSAWATRAFFRYGGEAQMRFPATLPTPSNVGPILGSPMYSSSPVPTGSPYPNPSSLGTPSHGAQPPTMSTPMSAVGNPAMQAASLSGLTGPEIVYSGKHNGICIYFSRIMGNIWDASLVVERVFKSSNREITAIESSVPIQLLESVLQELKGLQEFLDRNSQFSGGPLGNPNTTAKVQQRLLGVMRPENGNTQQMQQELQRKFHEAQLSEKISLQAIQQLVRKSYQALALWKLLCEHQFTVIVGELQKEFQEQLKITTFKDLVIREKEVTGALIASLINCYIRDNAAVDGISLHLQDTCPLLYSTDDAVCSKANELLQRSRQVQSKSERERMLRESLKEYQKISNQVDLPSVCAQYRQVRFYEGVVELSLTAAEKKDPQGLGLHFYKHGEPEEDVVGLQTFQERLNSYKCITDTLQELVNQSKAAPQSPSVPKKPGPPVLSSDPNMLSNEEAGHHFEQMLKLAQRSKDELFSIALYNWLIQADLADKLLQIASPFLEPHLVRMAKVDQNRVRYMDLLWRYYEKNRSFSSAARVLSKLADMHSTEISLQQRLEYIARAILSAKSSTAISSIAADGEFLHELEEKMEVARIQLQIQETLQRQYSHHSSVQDAISQLDSELMDITKLYGEFADPFKLAECKLAIIHCAGYSDPILVHTLWQDIIEKELSDSVTLSSSDRMHALSLKLVLLGKIYAGTPRFFPLDFIVQFLEQQVCTLNWDVGFVIQTMNEIGVPLPRLLEVYDQLFKSRDPFWNRVKSPLHLLDCIHVLLTRYVENPSLVLNCERRRFTNLCLDAVCGYLVELQSMSSSVAVQAITGNFKSLQAKLERLH", "length": 1390 }, "evidence": [ { "id": "45925144", "url": "http://www.informatics.jax.org/homology/45925144", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P38181-1", "protein_name": "Nucleoporin NUP170", "gene_name": "NUP170", "tax_id": 559292, "organism": "Saccharomyces cerevisiae S288C", "sequence": { "sequence": "MFQSFFHNNGPAAAGETFSDSRSYPLTNHQEVPRNGLNELASSATKAQQQPTHILNSYPITGSNPLMRASAMGATSGSINPNMSNMNEHIRVSGMGTSKPLDLAGKYIDHLQHKDSNTPVLDERSYYNSGVDYNFSREKNGLGAFTPFEKQDVFNIPDEILHEFSTSQTKTDMGIFPELNRCWITIDNKLILWNINNDNEYQVVDDMKHTIQKVALVRPKPNTFVPAVKHLLLISTTMELFMFAISLDKATNELSVFNTHLSVPVQGIDVIDIVSHERSGRIFFAGQASGLNIWELHYSGSDDWFNSKCSKVCLTKSALLSLLPTNMLSQIPGVDFIQALFEDNSNGNGGFSQETITQLTIDQQRGIIYSLSSKSTIRAYVITEKSLEGPMSIEPAYISRIIGTTTARAAPILGPKYLKIVKISSVAPEENNNLFLVALTVGGVRLYFNGSMGRFNIEALRLESIKFPPSSVTPEVIQQELLHQQQEQAKRSFPFFSNLMSSEPVLLKFQKKSSVLLETTKASTIISPGIFFSAVIKSSQQTHQQEKKENSSVTGTTATAGSKTVKQQPVTLQHKLFVSVPDYGILKTHGKYVENATFLETAGPVQQIIPLSGLFNATTKPQGFANEFATQYTSETLRVAVLTSTSIEIYKYRTPDEIFEDLIDNPLPFVLNYGAAEACSTALFVTCKSNKSEKLRSNALTFLTMGIPGVVDIKPVYNRYSVSTVSSLLSKPTLSTATTNLQQSITGFSKPSPANKEDFDLDDVILSPRFYGIALLITRLLRDIWGRHVFMTFTDNRVTSHAFISSSDPITPSINNLKSDEISQNRNIISKVSISKDCIEYYLSSINILNEFFITYGDSISQISAPYVLANNSNGRVIDKTEEVANQAESIAINAMIKMVQSIKEGLSFLNVLYEESEVEGFDNQYLGFKDIISFVSLDVQKDLVKLDFKDLFAPNDKTKSLIREILLSIINRNITKGASIEYTATALQERCGSFCSASDILGFRAIEHLRRAKEIGLRNYDSLNYHLKNATALLEQIVDDLSIEKLKEAVSMMLSVNYYPKSIEFLLNIANSMDKGKLACQYVANGFLENDDRKQYYDKRILVYDLVFDTLIKVDELAEKKQSSKTQNQISISNDDEVKLRQKSYEAALKYNDRLFHYHMYDWLVSQNREEKLLDIETPFILPYLMEKAGSSLKISNILWVYYSRRSKFFESAEILYRLATSNFDITLFERIEFLSRANGFCNSVSPLSQKQRIVQLASRIQDACEVAGIQGDILSLVYTDARIDSAIKDELIKTLDGKILSTSELFNDFAVPLSYHEIALFIFKIADFRDHEVIMAKWDELFQSLRMEFNNTGKKEDSMNFINLLSNVLIKIGKNVQDSEFIFPIFELFPIVCNFFYETLPKEHIVSGSIVSIFITAGVSFNKMYYILKELIETSDSDNSVFNKEMTWLIHEWYKSDRKFRDIISYNDIIHLKEYKIDNDPIEKYVKNSGNNLGICFYKE", "length": 1502 }, "evidence": [ { "id": "O75694", "url": "https://omabrowser.org/oma/group/O75694/", "database": "OMA" } ], "common_name": "Yeast" }, { "uniprot_canonical_ac": "Q99P88-1", "protein_name": "Nuclear pore complex protein Nup155", "gene_name": "Nup155", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MPSVLGSMMVASTSAAASLQEALENAGRLIDRQLQEDRMYPDLSELLMVSAPNSPTVSGMSDMDYPLQGPGLLSVPSLPEISTIRRVPLPPELVEQFGHMQCNCMMGVFPPISRAWLTIDSDIFMWNYEDGGDLAYFDGLSETILAVGLVKPKAGIFQPHVRHLLVLATPVDIVILGLSYANVQTGSGILNDSMCGGMQLLPDPLYSLPTDNTYLLTITSTDNGRIFLAGKDGCLYEVAYQAEAGWFSQRCRKINHSKSSLSFLVPSLLQFTFSEDDPIVQIEIDNSRNILYTRSEKGVIQVYDLGHDGQGMSRVASVSQNAIVSAAGNIARTIDRSVFKPIVQIAVIESSESLDCQLLAVTHAGVRLYFSTCPFRQPLARPNTLTLVHVRLPPGFSASSTVEKPSKVHKALYSKGILLMTASENEDNDILWCVNHDTFPFQKPMMETQMTTRVDGHSWALSAIDELKVDKIITPLNKDHIPITDSPVVVQQHMLPPKKFVLLSAQGSLMFHKLRPVDQLRHLLVSNVGGDGEEIERFFKLHQEDQACATCLILACSTAACDREVSAWATRAFFRYGGEAQMRFPATLPTPSNVGPILGSPMYSSSPVPSGSPYPNPSSLGTPSHGAQPPTMSTPMCAVGSPAMQAASMSGLTGPEIVYSGKHNGICIYFSRIMGNIWDASLVVERVFKSSNREITAIESSVPVQLLESVLQELKGLQEFLDRNSQFSGGPLGNPNTTARVQQRLVGFMRPENGNTQQMQQELQRKFQEAQLSEKISLQAIQQLVRKSYQALALWKLLCEHQFSVIVGELQKEFQEQLKITTFKDLVIRDKEVTGALIASLINCYIRDNAAVDGISLHLQDTCPLLYSTDDAVCSKANELLQRSRQVQSKTERERMLRESLKEYQKISNQVDLPSVCAQYRQVRFYEGVVELSLTAAEKKDPQGLGLHFYKHGEPEEDVVGLQTFQERLNSYKCITDTLQELVNQSKAAPQSPSVPKKPGPPVLSSDPNMLSNEEAGHHFEQMLKLAQRSKDELFSIALYNWLIQADLADKLLQIASPFLEPHLVRMARVDQNRVRYMDLLWRYYEKNRSFSSAARVLSKLADMHSTEISLQQRLEYIARAILSAKSSTAISSIAADGEFLHELEEKMEVARIQLQIQETLQRQYSHHSSVQDAISQLDSELMDITKLYGEFADPFKLAECKLAVIHCAGYSDPILVHTLWQDIIEKELNDSVALSSSDRMHALSLKLVLLGKIYAGTPRFFPLDFIVQFLEQQVCTLNWDVGFVIQTMNEIGVPLPRLLEVYDQLFKSRDPFWNRVKSPLHLLDCIHVLLTRYVENPSLVLNCERRRFTNLCLDAVCGYLVELQSMSSSVAVQAITGNFKSLQAKLERLH", "length": 1391 }, "evidence": [ { "id": "45925144", "url": "http://www.informatics.jax.org/homology/45925144", "database": "MGI" }, { "id": "O75694", "url": "https://omabrowser.org/oma/group/O75694/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9V463-1", "protein_name": "Nuclear pore complex protein Nup154", "gene_name": "Nup154", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MTLPQAQLDFFTTATSMLEWHYNLERNKPGLLELTGVSQHGRATMSGLNDYDYQSLSFLKSDRTHNLQQMRTVTKSAIPNEILEHFKHIKCHCTMGLFPEIGRAWLTIDSEIYIWTFNQTRDVAYYDGLSHLIVSVGLVKPKPGVFVQDVKYLLVLTTPIEVIVLGVTFGESSYNEMQLMNRPVFVIGTDNVSISVIKGTDDGRIFLGGRDGCLYEIYYQAESSWFGKRCKKINLSQGLVSYMVPSFLKVFSEVDPIEHIEIDNSRKLLYVLTEKGVIEAWDISTSYTTARRLGRITQNDITNQAVSLITTVDPSIFKSVKAICPLSADDADKLHLVAVTQCGVRLFFSTTSLNVKQQFGPAVPCSPGENTGFGQPAVQPPLSPNAEAPKGLYLLHVRLPPGYTPNATTNKPKQVHAAHYTEGTMLMITTQQHEQDLLWSLSSAPSVNFTYLVESTALESLDGVVWGLAEVHEPSTPQRKSPLNSARHARKVALLTNQGTHIIEVLKMVDVLRQILLSCNGPHHEEVKMFFQSQNQREACVTALLLATSDTYRGSDVALWAAQAFMLYGGEPCYQHQKFLNASNRNMANQTLGPNTTNVRERQSMFMSTPMPNSVANSPVGFPGSQFNQPISPIGNMQPPQVAVSNENSPIVFSAKHDGLYMYVSRMLHSVWQMRCVNEQFCSNLSQSECALLLSDLRSLRSFLEVHSVHDISSTTRVSFDNHLDRTNSYNTIMMGNTLLPIPEQRVLSEQAQVEETRSLSALNLFVKHACEVISLWNILNSHSFQLICVQLSPEHQKLLTCSTFRDLLITRSEVCAFLIISLINLYLKDAAGVSEVSKNLRENCPNLYRHEDDVTYKATELLMNAKNCTSATEKEHMLRTTLHMCKEAAPTLPLHSICMQFISADFFEGVIELSAVCASKSDPEEVGVHFYNNGEPADDREGYTCFATRMAYYKEVQLMLDHIYQRVCNKTHVQDKSINPLKGTAKASDAKNGATQTIPKIVAHTLKVKDPLIHITLYEWLLAHDMLKELLDVVEPSLGEFLRRSVSQNVDNVVLIDLLWKYYEKNSHHSQAAHILDNLAMTRSENINLEQRIEYLVRAVMCMRNGNVGSSLSNGIFLKELEDKLDIARVQKSVLAAMTELASDKLEAATAVKELNYALYDITQLYQHFAEPFDLWECQLSILNCSHHNDPLLIESVWGQIINSVVDKPGTTSERCNRLFTKIEILVREYGESGVCFPFAFLIRELEVKACQLRFPEGIVPEKLVSMNLDIELLLEYYSRMISMNERVWANEGNEWHLIQSVIRVVSLLADNAQSIWYRSKRRIVGKAQDIVAGCLNICYQKPDTNRLQHSLKELQSQLQRLLI", "length": 1365 }, "evidence": [ { "id": "O75694", "url": "https://omabrowser.org/oma/group/O75694/", "database": "OMA" } ], "common_name": "Fruit fly" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 6, "go_terms": [ { "name": "nuclear pore", "id": "GO:0005643", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005643", "evidence": [ { "database": "UniProtKB", "id": "O75694", "url": "https://www.uniprot.org/uniprot/O75694" } ], "pmid": "" }, { "name": "nuclear membrane", "id": "GO:0031965", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031965", "evidence": [ { "database": "UniProtKB", "id": "O75694", "url": "https://www.uniprot.org/uniprot/O75694" } ], "pmid": "" }, { "name": "nuclear envelope", "id": "GO:0005635", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005635", "evidence": [ { "database": "UniProtKB", "id": "O75694", "url": "https://www.uniprot.org/uniprot/O75694" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "O75694", "url": "https://www.uniprot.org/uniprot/O75694" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "O75694", "url": "https://www.uniprot.org/uniprot/O75694" } ], "pmid": "" }, { "name": "nuclear pore inner ring", "id": "GO:0044611", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044611", "evidence": [ { "database": "UniProtKB", "id": "O75694", "url": "https://www.uniprot.org/uniprot/O75694" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 10, "go_terms": [ { "name": "protein transport", "id": "GO:0015031", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015031", "evidence": [ { "database": "UniProtKB", "id": "O75694", "url": "https://www.uniprot.org/uniprot/O75694" } ], "pmid": "" }, { "name": "mRNA export from nucleus", "id": "GO:0006406", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006406", "evidence": [ { "database": "UniProtKB", "id": "O75694", "url": "https://www.uniprot.org/uniprot/O75694" } ], "pmid": "" }, { "name": "nucleocytoplasmic transport", "id": "GO:0006913", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006913", "evidence": [ { "database": "UniProtKB", "id": "O75694", "url": "https://www.uniprot.org/uniprot/O75694" } ], "pmid": "" }, { "name": "miRNA processing", "id": "GO:0035196", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035196", "evidence": [ { "database": "UniProtKB", "id": "O75694", "url": "https://www.uniprot.org/uniprot/O75694" } ], "pmid": "" }, { "name": "atrial cardiac muscle cell action potential", "id": "GO:0086014", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0086014", "evidence": [ { "database": "UniProtKB", "id": "O75694", "url": "https://www.uniprot.org/uniprot/O75694" } ], "pmid": "" }, { "name": "nuclear envelope organization", "id": "GO:0006998", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006998", "evidence": [ { "database": "UniProtKB", "id": "O75694", "url": "https://www.uniprot.org/uniprot/O75694" } ], "pmid": "" }, { "name": "protein localization to nuclear inner membrane", "id": "GO:0036228", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0036228", "evidence": [ { "database": "UniProtKB", "id": "O75694", "url": "https://www.uniprot.org/uniprot/O75694" } ], "pmid": "" }, { "name": "RNA export from nucleus", "id": "GO:0006405", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006405", "evidence": [ { "database": "UniProtKB", "id": "O75694", "url": "https://www.uniprot.org/uniprot/O75694" } ], "pmid": "" }, { "name": "transcription-dependent tethering of RNA polymerase II gene DNA at nuclear periphery", "id": "GO:0000972", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000972", "evidence": [ { "database": "UniProtKB", "id": "O75694", "url": "https://www.uniprot.org/uniprot/O75694" } ], "pmid": "" }, { "name": "protein import into nucleus", "id": "GO:0006606", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006606", "evidence": [ { "database": "UniProtKB", "id": "O75694", "url": "https://www.uniprot.org/uniprot/O75694" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "structural constituent of nuclear pore", "id": "GO:0017056", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0017056", "evidence": [ { "database": "UniProtKB", "id": "O75694", "url": "https://www.uniprot.org/uniprot/O75694" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 1088, "end_pos": 1090, "annotation": "n_glycosylation_sequon" }, { "start_pos": 191, "end_pos": 193, "annotation": "n_glycosylation_sequon" }, { "start_pos": 255, "end_pos": 257, "annotation": "n_glycosylation_sequon" }, { "start_pos": 648, "end_pos": 650, "annotation": "n_glycosylation_sequon" }, { "start_pos": 736, "end_pos": 738, "annotation": "n_glycosylation_sequon" }, { "start_pos": 889, "end_pos": 891, "annotation": "n_glycosylation_sequon" }, { "start_pos": 984, "end_pos": 986, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 526, 587, 976, 992, 994, 1258 ], "snv_sites": [ 55, 79, 335, 851, 976, 994, 1258, 1292, 1338, 1368 ], "glycation_sites": [], "phosphorylation_sites": [ 4, 13, 313, 504, 681, 992, 994, 1030, 1057 ], "sequon_annotation_sites": [ { "start_pos": 1088, "end_pos": 1090 }, { "start_pos": 191, "end_pos": 193 }, { "start_pos": 255, "end_pos": 257 }, { "start_pos": 648, "end_pos": 650 }, { "start_pos": 736, "end_pos": 738 }, { "start_pos": 889, "end_pos": 891 }, { "start_pos": 984, "end_pos": 986 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 6 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 6 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 5 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 9 }, { "field": "total_sites", "count": 9 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 12 }, { "field": "total_sites", "count": 10 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 6 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 416 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }