{ "uniprot_canonical_ac": "O75608-1", "uniprot_ac": "O75608", "uniprot_id": "LYPA1_HUMAN", "mass": { "chemical_mass": 24670.0, "monoisotopic_mass": 24670.0 }, "refseq": { "ac": "NP_001266289", "name": "acyl-protein thioesterase 1 isoform 6", "summary": "This gene encodes a member of the alpha/beta hydrolase superfamily. The encoded protein functions as a homodimer, exhibiting both depalmitoylating as well as lysophospholipase activity, and may be involved in Ras localization and signaling. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene have been defined on chromosomes 4, 6, and 7. [provided by RefSeq, Jul 2013].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001266289" }, "gene_names": [ { "name": "LYPLA1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O75608", "id": "O75608" }, { "name": "APT-1; APT1; hAPT1; LPL-I; LPL1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001266289", "id": "NP_001266289" }, { "name": "APT1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O75608", "id": "O75608" }, { "name": "LPL1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O75608", "id": "O75608" }, { "name": "LYPLA1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001266289", "id": "NP_001266289" } ], "protein_names": [ { "name": "Acyl-protein thioesterase 1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O75608" }, { "name": "3.1.2.-", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O75608" }, { "name": "3.1.2.22", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O75608" }, { "name": "APT-1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O75608" }, { "name": "LPL-I", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O75608" }, { "name": "LysoPLA I", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O75608" }, { "name": "Lysophospholipase 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O75608" }, { "name": "Lysophospholipase I", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O75608" }, { "name": "Palmitoyl-protein hydrolase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O75608" }, { "name": "acyl-protein thioesterase 1 isoform 6", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001266289", "id": "NP_001266289" }, { "name": "hAPT1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O75608" }, { "name": "lysophospholipid-specific lysophospholipase; acyl-protein thioesterase 1; palmitoyl-protein hydrolase; lysoPLA I; lysophospholipase I", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001266289", "id": "NP_001266289" } ], "function": [ { "annotation": "Acts as an acyl-protein thioesterase (PubMed:19439193, PubMed:20418879). Hydrolyzes fatty acids from S-acylated cysteine residues in proteins such as trimeric G alpha proteins or HRAS (PubMed:20418879). Has depalmitoylating activity toward KCNMA1 (PubMed:22399288). Could also depalmitoylate ADRB2 (PubMed:27481942). Acts as a lysophospholipase and hydrolyzes lysophosphatidylcholine (lyso-PC) (PubMed:19439193). Also hydrolyzes lysophosphatidylethanolamine (lyso-PE), lysophosphatidylinositol (lyso-PI) and lysophosphatidylserine (lyso-PS) (By similarity). Has much higher thioesterase activity than lysophospholipase activity (PubMed:19439193). Contributes to the production of lysophosphatidic acid (LPA) during blood coagulation by recognizing and cleaving plasma phospholipids to generate lysophospholipids which in turn act as substrates for ENPP2 to produce LPA (PubMed:21393252).", "evidence": [ { "database": "UniProtKB", "id": "O75608", "url": "https://www.uniprot.org/uniprot/O75608#function" }, { "database": "PubMed", "id": "20418879", "url": "https://glygen.org/publication/PubMed/20418879" }, { "database": "PubMed", "id": "19439193", "url": "https://glygen.org/publication/PubMed/19439193" }, { "database": "UniProtKB", "id": "P70470", "url": "https://www.uniprot.org/uniprot/P70470#function" }, { "database": "PubMed", "id": "27481942", "url": "https://glygen.org/publication/PubMed/27481942" }, { "database": "PubMed", "id": "22399288", "url": "https://glygen.org/publication/PubMed/22399288" }, { "database": "PubMed", "id": "21393252", "url": "https://glygen.org/publication/PubMed/21393252" } ] }, { "annotation": "LYPLA1 and LYPLA2 are each able to account for the loss of the other to maintain lipid homeostasis in cells Erratum:[J Lipid Res. 2019 Jul;60(7):1345. PMID: 31262966]", "evidence": [ { "database": "RefSeq", "id": "NP_001266289", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001266289" }, { "database": "PubMed", "id": "30482805", "url": "https://glygen.org/publication/PubMed/30482805" } ] }, { "annotation": "LncRNA LOXL1-AS1 Facilitates the Oncogenic Character in Cervical Cancer by the miR-526b-5p /LYPLA1 Axis. Erratum:[Biochem Genet. 2023 Feb;61(1):448. PMID: 36352082]", "evidence": [ { "database": "RefSeq", "id": "NP_001266289", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001266289" }, { "database": "PubMed", "id": "34984578", "url": "https://glygen.org/publication/PubMed/34984578" } ] }, { "annotation": "This gene encodes a member of the alpha/beta hydrolase superfamily. The encoded protein functions as a homodimer, exhibiting both depalmitoylating as well as lysophospholipase activity, and may be involved in Ras localization and signaling. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene have been defined on chromosomes 4, 6, and 7. [provided by RefSeq, Jul 2013].", "evidence": [ { "database": "RefSeq", "id": "NP_001266289", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001266289" } ] } ], "disease": [], "snv": [], "mutagenesis": [ { "start_pos": 119, "end_pos": 119, "sequence_org": "S", "sequence_mut": "A", "comment": "Loss of thioesterase and lysophospholipase activity.", "evidence": [ { "database": "UniProtKB", "id": "O75608", "url": "https://www.uniprot.org/uniprot/O75608" }, { "database": "PubMed", "id": "19439193", "url": "https://glygen.org/publication/PubMed/19439193" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "92.48", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000120992", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000120992" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "98.26", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000120992", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000120992" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "92.57", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000120992", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000120992" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "86.72", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000120992", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000120992" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "89.57", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000120992", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000120992" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "96.4", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000120992", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000120992" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "90.84", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000120992", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000120992" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "94.44", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000120992", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000120992" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "89.19", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000120992", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000120992" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "89.3", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000120992", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000120992" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "93.92", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000120992", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000120992" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "91.26", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000120992", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000120992" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "91.85", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000120992", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000120992" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O75608", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75608" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O75608", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75608" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O75608", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75608" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O75608", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75608" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O75608", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75608" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O75608", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75608" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O75608", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75608" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O75608", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75608" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O75608", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75608" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O75608", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75608" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O75608", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75608" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O75608", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75608" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75608", "url": "https://www.uniprot.org/uniprot/O75608" } ], "common_name": "Human" } ], "gene": [ { "name": "LYPLA1", "url": "https://www.uniprot.org/uniprot/O75608", "locus": { "chromosome": "8", "start_pos": 54046367, "end_pos": 54102017, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000120992", "url": "https://www.ensembl.org/id/ENSG00000120992" } ] } } ], "crossref": [ { "id": "ENSG00000120992", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000120992", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "3.1.2.22", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=3.1.2.22&UniProtAcc=O75608", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "CHEMBL1681631", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL1681631", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "LYPLA1", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=LYPLA1", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "10434", "url": "https://www.ncbi.nlm.nih.gov/gene/10434", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "6737", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=6737", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O75608", "url": "https://www.ebi.ac.uk/intact/interactors/id:O75608*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR003140", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003140", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029058", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029058", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:10434", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:10434", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "605599", "url": "http://www.omim.org/entry/605599", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O75608", "url": "https://www.nextprot.org/entry/NX_O75608", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "O75608", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75608", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "RARYEWA", "url": "https://omabrowser.org/oma/group/RARYEWA/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4670340at2759", "url": "http://www.orthodb.org/?query=4670340at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10655", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10655", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10655:SF22", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10655:SF22", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1FJ2", "url": "https://www.rcsb.org/structure/1FJ2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5SYM", "url": "https://www.rcsb.org/structure/5SYM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6QGN", "url": "https://www.rcsb.org/structure/6QGN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6QGO", "url": "https://www.rcsb.org/structure/6QGO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6QGQ", "url": "https://www.rcsb.org/structure/6QGQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6QGS", "url": "https://www.rcsb.org/structure/6QGS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF02230", "url": "http://pfam.xfam.org/family/PF02230", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O75608", "url": "https://pharos.nih.gov/targets/O75608", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O75608", "url": "http://purl.obolibrary.org/obo/PR_O75608", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001266289", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001266289", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "19233", "url": "https://www.rhea-db.org/rhea/19233", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "40435", "url": "https://www.rhea-db.org/rhea/40435", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "41720", "url": "https://www.rhea-db.org/rhea/41720", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A087X1K9", "url": "https://www.uniprot.org/uniprot/A0A087X1K9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A087X1K9-1", "url": "https://www.uniprot.org/uniprot/A0A087X1K9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B4DP64", "url": "https://www.uniprot.org/uniprot/B4DP64", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B4DP64-1", "url": "https://www.uniprot.org/uniprot/B4DP64-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E5RFT6", "url": "https://www.uniprot.org/uniprot/E5RFT6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E5RFT6-1", "url": "https://www.uniprot.org/uniprot/E5RFT6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E5RGR0", "url": "https://www.uniprot.org/uniprot/E5RGR0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E5RGR0-1", "url": "https://www.uniprot.org/uniprot/E5RGR0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E5RI35", "url": "https://www.uniprot.org/uniprot/E5RI35", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E5RI35-1", "url": "https://www.uniprot.org/uniprot/E5RI35-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E5RJ48", "url": "https://www.uniprot.org/uniprot/E5RJ48", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E5RJ48-1", "url": "https://www.uniprot.org/uniprot/E5RJ48-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O75608", "url": "https://www.uniprot.org/uniprot/O75608", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O75608-1", "url": "https://www.uniprot.org/uniprot/O75608-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O75608-2", "url": "https://www.uniprot.org/uniprot/O75608-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MCGNNMSTPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYICPHAPVRPVTLNMNVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFPQGPIGGANRDISILQCHGDCDPLVPLMFGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQEMMDVKQFIDKLLPPID", "length": 230, "header": "sp|O75608-1|LYPA1_HUMAN Isoform 1 of Acyl-protein thioesterase 1 OS=Homo sapiens OX=9606 GN=LYPLA1 PE=1 SV=1 CANONICAL=O75608-1" }, "isoforms": [ { "isoform_ac": "A0A087X1K9-1", "url": "", "sequence": { "sequence": "MNVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFPQGPIGGANRDISILQCHGDCDPLVPLMFGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQEMMDVKQFIDKLLPPID", "length": 166, "header": "tr|A0A087X1K9-1|A0A087X1K9_HUMAN Computationally mapped isoform of Acyl-protein thioesterase 1 OS=Homo sapiens OX=9606 GN=LYPLA1 PE=1 SV=1 CANONICAL=O75608-1" }, "locus": { "chromosome": "8", "start_pos": 54063350, "end_pos": 54048068, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000618741.1", "url": "https://www.ensembl.org/id/ENST00000618741.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000484280.1", "url": "https://www.ensembl.org/id/ENSP00000484280.1" } ] } }, { "isoform_ac": "B4DP64-1", "url": "", "sequence": { "sequence": "MCGNNMSTPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYICPHAPVRPVTLNMNVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGPIGGANRDISILQCHGDCDPLVPLMFGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQEMMDVKQFIDKLLPPID", "length": 196, "header": "tr|B4DP64-1|LYPA1_HUMAN Computationally mapped isoform of Acyl-protein thioesterase 1 OS=Homo sapiens OX=9606 GN=LYPLA1 PE=1 SV=1 CANONICAL=O75608-1" }, "locus": { "chromosome": "8", "start_pos": 54101823, "end_pos": 54048068, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000618914.4", "url": "https://www.ensembl.org/id/ENST00000618914.4" }, { "database": "Ensembl Peptide", "id": "ENSP00000482430.1", "url": "https://www.ensembl.org/id/ENSP00000482430.1" } ] } }, { "isoform_ac": "E5RFT6-1", "url": "", "sequence": { "sequence": "MCGNNMSTPLPAIVPAARKATAAVIFLHGLGDTGVLSVVLIEIFLFSSATGIVTLWFP", "length": 58, "header": "tr|E5RFT6-1|LYPA1_HUMAN Computationally mapped isoform of Acyl-protein thioesterase 1 OS=Homo sapiens OX=9606 GN=LYPLA1 PE=1 SV=1 CANONICAL=O75608-1" }, "locus": { "chromosome": "8", "start_pos": 54101823, "end_pos": 54051116, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000522007.5", "url": "https://www.ensembl.org/id/ENST00000522007.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000427967.1", "url": "https://www.ensembl.org/id/ENSP00000427967.1" } ] } }, { "isoform_ac": "E5RGR0-1", "url": "", "sequence": { "sequence": "MCGNNMSTPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYICPHAFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFPQGPIGGANRDISILQCHGDCDPLVPLMFGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQ", "length": 197, "header": "tr|E5RGR0-1|LYPA1_HUMAN Computationally mapped isoform of Acyl-protein thioesterase 1 OS=Homo sapiens OX=9606 GN=LYPLA1 PE=1 SV=1 CANONICAL=O75608-1" }, "locus": { "chromosome": "8", "start_pos": 54101823, "end_pos": 54051012, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000518546.5", "url": "https://www.ensembl.org/id/ENST00000518546.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000428729.1", "url": "https://www.ensembl.org/id/ENSP00000428729.1" } ] } }, { "isoform_ac": "E5RI35-1", "url": "", "sequence": { "sequence": "MCGNNMSTPLPAIVPAARKATAAVIFLHGLGDTGPVRPVTLNMNVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGALS", "length": 103, "header": "tr|E5RI35-1|LYPA1_HUMAN Computationally mapped isoform of Acyl-protein thioesterase 1 OS=Homo sapiens OX=9606 GN=LYPLA1 PE=1 SV=2 CANONICAL=O75608-1" }, "locus": { "chromosome": "8", "start_pos": 54101823, "end_pos": 54052742, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000521898.5", "url": "https://www.ensembl.org/id/ENST00000521898.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000430791.2", "url": "https://www.ensembl.org/id/ENSP00000430791.2" } ] } }, { "isoform_ac": "E5RJ48-1", "url": "", "sequence": { "sequence": "MNVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFPQ", "length": 90, "header": "tr|E5RJ48-1|LYPA1_HUMAN Computationally mapped isoform of Acyl-protein thioesterase 1 OS=Homo sapiens OX=9606 GN=LYPLA1 PE=1 SV=1 CANONICAL=O75608-1" }, "locus": { "chromosome": "8", "start_pos": 54063350, "end_pos": 54052655, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000521352.5", "url": "https://www.ensembl.org/id/ENST00000521352.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000428306.1", "url": "https://www.ensembl.org/id/ENSP00000428306.1" } ] } }, { "isoform_ac": "O75608-1", "url": "", "sequence": { "sequence": "MCGNNMSTPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYICPHAPVRPVTLNMNVAMPSWFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFPQGPIGGANRDISILQCHGDCDPLVPLMFGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQEMMDVKQFIDKLLPPID", "length": 230, "header": "sp|O75608-1|LYPA1_HUMAN Isoform 1 of Acyl-protein thioesterase 1 OS=Homo sapiens OX=9606 GN=LYPLA1 PE=1 SV=1 CANONICAL=O75608-1" }, "locus": { "chromosome": "8", "start_pos": 54101823, "end_pos": 54048068, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000316963.8", "url": "https://www.ensembl.org/id/ENST00000316963.8" }, { "database": "Ensembl Peptide", "id": "ENSP00000320043.3", "url": "https://www.ensembl.org/id/ENSP00000320043.3" } ] } }, { "isoform_ac": "O75608-2", "url": "", "sequence": { "sequence": "MCGNNMSTPLPAIVPAARKATAAVIFLHGLGDTGHGWAEAFAGIRSSHIKYICPHAFDIIGLSPDSQEDESGIKQAAENIKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFPQGPIGGANRDISILQCHGDCDPLVPLMFGSLTVEKLKTLVNPANVTFKTYEGMMHSSCQQEMMDVKQFIDKLLPPID", "length": 214, "header": "sp|O75608-2|LYPA1_HUMAN Isoform 2 of Acyl-protein thioesterase 1 OS=Homo sapiens OX=9606 GN=LYPLA1 PE=1 SV=1 CANONICAL=O75608-1" }, "locus": { "chromosome": "8", "start_pos": 54101823, "end_pos": 54048068, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000343231.10", "url": "https://www.ensembl.org/id/ENST00000343231.10" }, { "database": "Ensembl Peptide", "id": "ENSP00000344477.6", "url": "https://www.ensembl.org/id/ENSP00000344477.6" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "O75608", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75608" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "36580660", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36580660" } ] } ], "phosphorylation": [ { "start_pos": 209, "end_pos": 209, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75608", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75608" }, { "database": "PubMed", "id": "29648538", "url": "https://glygen.org/publication/PubMed/29648538" } ], "site_lbl": "Ser209" }, { "start_pos": 210, "end_pos": 210, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75608", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75608" }, { "database": "PubMed", "id": "29648538", "url": "https://glygen.org/publication/PubMed/29648538" } ], "site_lbl": "Ser210" } ], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Cloning and characterization of a mammalian prenyl protein-specific protease.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Otto JC, Kim E, Young SG, Casey PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "10085068", "url": "https://glygen.org/publication/PubMed/10085068" } ] }, { "title": "Disruption of the mouse Rce1 gene results in defective Ras processing and mislocalization of Ras within cells.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Kim E, Ambroziak P, Otto JC, Taylor B, Ashby M, Shannon K, Casey PJ, Young SG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "10085069", "url": "https://glygen.org/publication/PubMed/10085069" } ] }, { "title": "Regulation of endothelium-derived nitric oxide production by the protein kinase Akt.", "journal": "Nature", "date": "1999", "authors": "Fulton D, Gratton JP, McCabe TJ, Fontana J, Fujio Y, Walsh K, Franke TF, Papapetropoulos A, Sessa WC", "evidence": [ { "database": "Reactome", "id": "R-HSA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615" } ], "reference": [ { "type": "PubMed", "id": "10376602", "url": "https://glygen.org/publication/PubMed/10376602" } ] }, { "title": "Activation of nitric oxide synthase in endothelial cells by Akt-dependent phosphorylation.", "journal": "Nature", "date": "1999", "authors": "Dimmeler S, Fleming I, Fisslthaler B, Hermann C, Busse R, Zeiher AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615" } ], "reference": [ { "type": "PubMed", "id": "10376603", "url": "https://glygen.org/publication/PubMed/10376603" } ] }, { "title": "The Akt kinase signals directly to endothelial nitric oxide synthase.", "journal": "Current biology : CB", "date": "1999", "authors": "Michell BJ, Griffiths JE, Mitchelhill KI, Rodriguez-Crespo I, Tiganis T, Bozinovski S, de Montellano PR, Kemp BE, Pearson RB", "evidence": [ { "database": "Reactome", "id": "R-HSA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615" } ], "reference": [ { "type": "PubMed", "id": "10469573", "url": "https://glygen.org/publication/PubMed/10469573" } ] }, { "title": "Targeting and translocation of endothelial nitric oxide synthase.", "journal": "Brazilian journal of medical and biological research = Revista brasileira de pesquisas medicas e biologicas", "date": "1999", "authors": "Michel T", "evidence": [ { "database": "Reactome", "id": "R-HSA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615" } ], "reference": [ { "type": "PubMed", "id": "10559837", "url": "https://glygen.org/publication/PubMed/10559837" } ] }, { "title": "Selective inhibition of ras-transformed cell growth by a novel fatty acid-based chloromethyl ketone designed to target Ras endoprotease.", "journal": "Annals of the New York Academy of Sciences", "date": "1999", "authors": "Chen Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "10667208", "url": "https://glygen.org/publication/PubMed/10667208" } ] }, { "title": "Reconstitution of an endothelial nitric-oxide synthase (eNOS), hsp90, and caveolin-1 complex in vitro. Evidence that hsp90 facilitates calmodulin stimulated displacement of eNOS from caveolin-1.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Gratton JP, Fontana J, O'Connor DS, Garcia-Cardena G, McCabe TJ, Sessa WC", "evidence": [ { "database": "Reactome", "id": "R-HSA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615" } ], "reference": [ { "type": "PubMed", "id": "10781589", "url": "https://glygen.org/publication/PubMed/10781589" } ] }, { "title": "Human ras-converting enzyme (hRCE1) endoproteolytic activity on K-ras-derived peptides.", "journal": "Analytical biochemistry", "date": "2000", "authors": "Hollander I, Frommer E, Mallon R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "11038283", "url": "https://glygen.org/publication/PubMed/11038283" } ] }, { "title": "Crystal structure of the human acyl protein thioesterase I from a single X-ray data set to 1.5 A.", "journal": "Structure (London, England : 1993)", "date": "2000", "authors": "Devedjiev Y, Dauter Z, Kuznetsov SR, Jones TL, Derewenda ZS", "evidence": [ { "database": "UniProtKB", "id": "O75608", "url": "https://www.uniprot.org/uniprot/O75608" } ], "reference": [ { "type": "PubMed", "id": "11080636", "url": "https://glygen.org/publication/PubMed/11080636" } ] }, { "title": "The farnesyl transferase inhibitor SCH 66336 induces a G(2) --> M or G(1) pause in sensitive human tumor cell lines.", "journal": "Experimental cell research", "date": "2001", "authors": "Ashar HR, James L, Gray K, Carr D, McGuirk M, Maxwell E, Black S, Armstrong L, Doll RJ, Taveras AG, Bishop WR, Kirschmeier P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "11120601", "url": "https://glygen.org/publication/PubMed/11120601" } ] }, { "title": "Characterization of the antitumor effects of the selective farnesyl protein transferase inhibitor R115777 in vivo and in vitro.", "journal": "Cancer research", "date": "2001", "authors": "End DW, Smets G, Todd AV, Applegate TL, Fuery CJ, Angibaud P, Venet M, Sanz G, Poignet H, Skrzat S, Devine A, Wouters W, Bowden C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "11196150", "url": "https://glygen.org/publication/PubMed/11196150" } ] }, { "title": "Cellular regulation of endothelial nitric oxide synthase.", "journal": "American journal of physiology. Renal physiology", "date": "2001", "authors": "Govers R, Rabelink TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615" } ], "reference": [ { "type": "PubMed", "id": "11208594", "url": "https://glygen.org/publication/PubMed/11208594" } ] }, { "title": "Loss of caveolae, vascular dysfunction, and pulmonary defects in caveolin-1 gene-disrupted mice.", "journal": "Science (New York, N.Y.)", "date": "2001", "authors": "Drab M, Verkade P, Elger M, Kasper M, Lohn M, Lauterbach B, Menne J, Lindschau C, Mende F, Luft FC, Schedl A, Haller H, Kurzchalia TV", "evidence": [ { "database": "Reactome", "id": "R-HSA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615" } ], "reference": [ { "type": "PubMed", "id": "11498544", "url": "https://glygen.org/publication/PubMed/11498544" } ] }, { "title": "Calmodulin binds to K-Ras, but not to H- or N-Ras, and modulates its downstream signaling.", "journal": "Molecular and cellular biology", "date": "2001", "authors": "Villalonga P, Lopez-Alcala C, Bosch M, Chiloeches A, Rocamora N, Gil J, Marais R, Marshall CJ, Bachs O, Agell N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "11585916", "url": "https://glygen.org/publication/PubMed/11585916" } ] }, { "title": "Absence of the CAAX endoprotease Rce1: effects on cell growth and transformation.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Bergo MO, Ambroziak P, Gregory C, George A, Otto JC, Kim E, Nagase H, Casey PJ, Balmain A, Young SG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "11739732", "url": "https://glygen.org/publication/PubMed/11739732" } ] }, { "title": "The ratio between tetrahydrobiopterin and oxidized tetrahydrobiopterin analogues controls superoxide release from endothelial nitric oxide synthase: an EPR spin trapping study.", "journal": "The Biochemical journal", "date": "2002", "authors": "Vasquez-Vivar J, Martasek P, Whitsett J, Joseph J, Kalyanaraman B", "evidence": [ { "database": "Reactome", "id": "R-HSA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615" } ], "reference": [ { "type": "PubMed", "id": "11879202", "url": "https://glygen.org/publication/PubMed/11879202" } ] }, { "title": "A ubiquitously expressed human hexacoordinate hemoglobin.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Trent JT 3rd, Hargrove MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615" } ], "reference": [ { "type": "PubMed", "id": "11893755", "url": "https://glygen.org/publication/PubMed/11893755" } ] }, { "title": "Cytoglobin: a novel globin type ubiquitously expressed in vertebrate tissues.", "journal": "Molecular biology and evolution", "date": "2002", "authors": "Burmester T, Ebner B, Weich B, Hankeln T", "evidence": [ { "database": "Reactome", "id": "R-HSA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615" } ], "reference": [ { "type": "PubMed", "id": "11919282", "url": "https://glygen.org/publication/PubMed/11919282" } ] }, { "title": "Domain mapping studies reveal that the M domain of hsp90 serves as a molecular scaffold to regulate Akt-dependent phosphorylation of endothelial nitric oxide synthase and NO release.", "journal": "Circulation research", "date": "2002", "authors": "Fontana J, Fulton D, Chen Y, Fairchild TA, McCabe TJ, Fujita N, Tsuruo T, Sessa WC", "evidence": [ { "database": "Reactome", "id": "R-HSA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615" } ], "reference": [ { "type": "PubMed", "id": "11988487", "url": "https://glygen.org/publication/PubMed/11988487" } ] }, { "title": "Hematologic effects of inactivating the Ras processing enzyme Rce1.", "journal": "Blood", "date": "2003", "authors": "Aiyagari AL, Taylor BR, Aurora V, Young SG, Shannon KM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "12433685", "url": "https://glygen.org/publication/PubMed/12433685" } ] }, { "title": "Ca2+/calmodulin binds and dissociates K-RasB from membrane.", "journal": "Biochemical and biophysical research communications", "date": "2003", "authors": "Sidhu RS, Clough RR, Bhullar RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "12727204", "url": "https://glygen.org/publication/PubMed/12727204" } ] }, { "title": "Targeting Ras signaling through inhibition of carboxyl methylation: an unexpected property of methotrexate.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2003", "authors": "Winter-Vann AM, Kamen BA, Bergo MO, Young SG, Melnyk S, James SJ, Casey PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "12750467", "url": "https://glygen.org/publication/PubMed/12750467" } ] }, { "title": "Synergistic activation of endothelial nitric-oxide synthase (eNOS) by HSP90 and Akt: calcium-independent eNOS activation involves formation of an HSP90-Akt-CaM-bound eNOS complex.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Takahashi S, Mendelsohn ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615" } ], "reference": [ { "type": "PubMed", "id": "12799359", "url": "https://glygen.org/publication/PubMed/12799359" } ] }, { "title": "The redox state of the cell regulates the ligand binding affinity of human neuroglobin and cytoglobin.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Hamdane D, Kiger L, Dewilde S, Green BN, Pesce A, Uzan J, Burmester T, Hankeln T, Bolognesi M, Moens L, Marden MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615" } ], "reference": [ { "type": "PubMed", "id": "14530264", "url": "https://glygen.org/publication/PubMed/14530264" } ] }, { "title": "Photoreceptor cGMP phosphodiesterase delta subunit (PDEdelta) functions as a prenyl-binding protein.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Zhang H, Liu XH, Zhang K, Chen CK, Frederick JM, Prestwich GD, Baehr W", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "14561760", "url": "https://glygen.org/publication/PubMed/14561760" } ] }, { "title": "Carboxyl methylation of Ras regulates membrane targeting and effector engagement.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Chiu VK, Silletti J, Dinsell V, Wiener H, Loukeris K, Ou G, Philips MR, Pillinger MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "14660603", "url": "https://glygen.org/publication/PubMed/14660603" } ] }, { "title": "Inactivation of Icmt inhibits transformation by oncogenic K-Ras and B-Raf.", "journal": "The Journal of clinical investigation", "date": "2004", "authors": "Bergo MO, Gavino BJ, Hong C, Beigneux AP, McMahon M, Casey PJ, Young SG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "14966563", "url": "https://glygen.org/publication/PubMed/14966563" } ] }, { "title": "Allosteric regulation and temperature dependence of oxygen binding in human neuroglobin and cytoglobin. Molecular mechanisms and physiological significance.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Fago A, Hundahl C, Dewilde S, Gilany K, Moens L, Weber RE", "evidence": [ { "database": "Reactome", "id": "R-HSA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615" } ], "reference": [ { "type": "PubMed", "id": "15299006", "url": "https://glygen.org/publication/PubMed/15299006" } ] }, { "title": "Crystallographic analysis of CaaX prenyltransferases complexed with substrates defines rules of protein substrate selectivity.", "journal": "Journal of molecular biology", "date": "2004", "authors": "Reid TS, Terry KL, Casey PJ, Beese LS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "15451670", "url": "https://glygen.org/publication/PubMed/15451670" } ] }, { "title": "Nitric oxide dioxygenase function and mechanism of flavohemoglobin, hemoglobin, myoglobin and their associated reductases.", "journal": "Journal of inorganic biochemistry", "date": "2005", "authors": "Gardner PR", "evidence": [ { "database": "Reactome", "id": "R-HSA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615" } ], "reference": [ { "type": "PubMed", "id": "15598505", "url": "https://glygen.org/publication/PubMed/15598505" } ] }, { "title": "Postprenylation CAAX processing is required for proper localization of Ras but not Rho GTPases.", "journal": "Molecular biology of the cell", "date": "2005", "authors": "Michaelson D, Ali W, Chiu VK, Bergo M, Silletti J, Wright L, Young SG, Philips M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "15659645", "url": "https://glygen.org/publication/PubMed/15659645" } ] }, { "title": "DHHC9 and GCP16 constitute a human protein fatty acyltransferase with specificity for H- and N-Ras.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Swarthout JT, Lobo S, Farh L, Croke MR, Greentree WK, Deschenes RJ, Linder ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "16000296", "url": "https://glygen.org/publication/PubMed/16000296" } ] }, { "title": "Reversible intracellular translocation of KRas but not HRas in hippocampal neurons regulated by Ca2+/calmodulin.", "journal": "The Journal of cell biology", "date": "2005", "authors": "Fivaz M, Meyer T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "16043511", "url": "https://glygen.org/publication/PubMed/16043511" } ] }, { "title": "PKC regulates a farnesyl-electrostatic switch on K-Ras that promotes its association with Bcl-XL on mitochondria and induces apoptosis.", "journal": "Molecular cell", "date": "2006", "authors": "Bivona TG, Quatela SE, Bodemann BO, Ahearn IM, Soskis MJ, Mor A, Miura J, Wiener HH, Wright L, Saba SG, Yim D, Fein A, Perez de Castro I, Li C, Thompson CB, Cox AD, Philips MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "16483930", "url": "https://glygen.org/publication/PubMed/16483930" } ] }, { "title": "Subcellular targeting and trafficking of nitric oxide synthases.", "journal": "The Biochemical journal", "date": "2006", "authors": "Oess S, Icking A, Fulton D, Govers R, Muller-Esterl W", "evidence": [ { "database": "Reactome", "id": "R-HSA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615" } ], "reference": [ { "type": "PubMed", "id": "16722822", "url": "https://glygen.org/publication/PubMed/16722822" } ] }, { "title": "Identification of Golgi-localized acyl transferases that palmitoylate and regulate endothelial nitric oxide synthase.", "journal": "The Journal of cell biology", "date": "2006", "authors": "Fernandez-Hernando C, Fukata M, Bernatchez PN, Fukata Y, Lin MI, Bredt DS, Sessa WC", "evidence": [ { "database": "Reactome", "id": "R-HSA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615" } ], "reference": [ { "type": "PubMed", "id": "16864653", "url": "https://glygen.org/publication/PubMed/16864653" } ] }, { "title": "Mechanism of 4-HNE mediated inhibition of hDDAH-1: implications in no regulation.", "journal": "Biochemistry", "date": "2008", "authors": "Forbes SP, Druhan LJ, Guzman JE, Parinandi N, Zhang L, Green-Church KB, Cardounel AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615" } ], "reference": [ { "type": "PubMed", "id": "18171027", "url": "https://glygen.org/publication/PubMed/18171027" } ] }, { "title": "Identification of essential interacting elements in K-Ras/calmodulin binding and its role in K-Ras localization.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Lopez-Alcala C, Alvarez-Moya B, Villalonga P, Calvo M, Bachs O, Agell N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "18182391", "url": "https://glygen.org/publication/PubMed/18182391" } ] }, { "title": "NO dioxygenase activity in hemoglobins is ubiquitous in vitro, but limited by reduction in vivo.", "journal": "PloS one", "date": "2008", "authors": "Smagghe BJ, Trent JT 3rd, Hargrove MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615" } ], "reference": [ { "type": "PubMed", "id": "18446211", "url": "https://glygen.org/publication/PubMed/18446211" } ] }, { "title": "Inactivating Icmt ameliorates K-RAS-induced myeloproliferative disease.", "journal": "Blood", "date": "2008", "authors": "Wahlstrom AM, Cutts BA, Liu M, Lindskog A, Karlsson C, Sjogren AK, Andersson KM, Young SG, Bergo MO", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "18502828", "url": "https://glygen.org/publication/PubMed/18502828" } ] }, { "title": "Cytoglobin is expressed in the vasculature and regulates cell respiration and proliferation via nitric oxide dioxygenation.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Halligan KE, Jourd'heuil FL, Jourd'heuil D", "evidence": [ { "database": "Reactome", "id": "R-HSA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615" } ], "reference": [ { "type": "PubMed", "id": "19147491", "url": "https://glygen.org/publication/PubMed/19147491" } ] }, { "title": "USP17 regulates Ras activation and cell proliferation by blocking RCE1 activity.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Burrows JF, Kelvin AA, McFarlane C, Burden RE, McGrattan MJ, De la Vega M, Govender U, Quinn DJ, Dib K, Gadina M, Scott CJ, Johnston JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "19188362", "url": "https://glygen.org/publication/PubMed/19188362" } ] }, { "title": "Thioesterase activity and subcellular localization of acylprotein thioesterase 1/lysophospholipase 1.", "journal": "Biochimica et biophysica acta", "date": "2009", "authors": "Hirano T, Kishi M, Sugimoto H, Taguchi R, Obinata H, Ohshima N, Tatei K, Izumi T", "evidence": [ { "database": "UniProtKB", "id": "O75608", "url": "https://www.uniprot.org/uniprot/O75608" } ], "reference": [ { "type": "PubMed", "id": "19439193", "url": "https://glygen.org/publication/PubMed/19439193" } ] }, { "title": "Developing dual and specific inhibitors of dimethylarginine dimethylaminohydrolase-1 and nitric oxide synthase: toward a targeted polypharmacology to control nitric oxide.", "journal": "Biochemistry", "date": "2009", "authors": "Wang Y, Monzingo AF, Hu S, Schaller TH, Robertus JD, Fast W", "evidence": [ { "database": "Reactome", "id": "R-HSA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615" } ], "reference": [ { "type": "PubMed", "id": "19663506", "url": "https://glygen.org/publication/PubMed/19663506" } ] }, { "title": "The palmitoylation machinery is a spatially organizing system for peripheral membrane proteins.", "journal": "Cell", "date": "2010", "authors": "Rocks O, Gerauer M, Vartak N, Koch S, Huang ZP, Pechlivanis M, Kuhlmann J, Brunsveld L, Chandra A, Ellinger B, Waldmann H, Bastiaens PI", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "20416930", "url": "https://glygen.org/publication/PubMed/20416930" } ] }, { "title": "Small-molecule inhibition of APT1 affects Ras localization and signaling.", "journal": "Nature chemical biology", "date": "2010", "authors": "Dekker FJ, Rocks O, Vartak N, Menninger S, Hedberg C, Balamurugan R, Wetzel S, Renner S, Gerauer M, Scholermann B, Rusch M, Kramer JW, Rauh D, Coates GW, Brunsveld L, Bastiaens PI, Waldmann H", "evidence": [ { "database": "UniProtKB", "id": "O75608", "url": "https://www.uniprot.org/uniprot/O75608" }, { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "20418879", "url": "https://glygen.org/publication/PubMed/20418879" } ] }, { "title": "Inhibition of isoprenylcysteine carboxylmethyltransferase induces autophagic-dependent apoptosis and impairs tumor growth.", "journal": "Oncogene", "date": "2010", "authors": "Wang M, Hossain MS, Tan W, Coolman B, Zhou J, Liu S, Casey PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "20622895", "url": "https://glygen.org/publication/PubMed/20622895" } ] }, { "title": "K-Ras4B phosphorylation at Ser181 is inhibited by calmodulin and modulates K-Ras activity and function.", "journal": "Oncogene", "date": "2010", "authors": "Alvarez-Moya B, Lopez-Alcala C, Drosten M, Bachs O, Agell N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "20802526", "url": "https://glygen.org/publication/PubMed/20802526" } ] }, { "title": "Endocytic sorting and recycling require membrane phosphatidylserine asymmetry maintained by TAT-1/CHAT-1.", "journal": "PLoS genetics", "date": "2010", "authors": "Chen B, Jiang Y, Zeng S, Yan J, Li X, Zhang Y, Zou W, Wang X", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "21170358", "url": "https://glygen.org/publication/PubMed/21170358" } ] }, { "title": "The phospholipase A1 activity of lysophospholipase A-I links platelet activation to LPA production during blood coagulation.", "journal": "Journal of lipid research", "date": "2011-05", "authors": "Bolen Alyssa L, Naren Anjaparavanda P, Yarlagadda Sunitha, Beranova-Giorgianni Sarka, Chen Li, Norman Derek, Baker Daniel L, Rowland Meng M, Best Michael D, Sano Takamitsu, Tsukahara Tamotsu, Liliom Karoly, Igarashi Yasuyuki, Tigyi Gabor", "evidence": [ { "database": "UniProtKB", "id": "O75608", "url": "https://www.uniprot.org/uniprot/O75608" } ], "reference": [ { "type": "PubMed", "id": "21393252", "url": "https://glygen.org/publication/PubMed/21393252" } ] }, { "title": "Discovery and SAR of methylated tetrahydropyranyl derivatives as inhibitors of isoprenylcysteine carboxyl methyltransferase (ICMT).", "journal": "Journal of medicinal chemistry", "date": "2011", "authors": "Judd WR, Slattum PM, Hoang KC, Bhoite L, Valppu L, Alberts G, Brown B, Roth B, Ostanin K, Huang L, Wettstein D, Richards B, Willardsen JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "21661760", "url": "https://glygen.org/publication/PubMed/21661760" } ] }, { "title": "Therapeutic strategies for targeting ras proteins.", "journal": "Genes & cancer", "date": "2011", "authors": "Gysin S, Salt M, Young A, McCormick F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "21779505", "url": "https://glygen.org/publication/PubMed/21779505" } ] }, { "title": "Dimethylarginine dimethylaminohydrolase 2, a newly identified mitochondrial protein modulating nitric oxide synthesis in normal human chondrocytes.", "journal": "Arthritis and rheumatism", "date": "2012", "authors": "Cillero-Pastor B, Mateos J, Fernandez-Lopez C, Oreiro N, Ruiz-Romero C, Blanco FJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615" } ], "reference": [ { "type": "PubMed", "id": "21898353", "url": "https://glygen.org/publication/PubMed/21898353" } ] }, { "title": "Development of highly potent inhibitors of the Ras-targeting human acyl protein thioesterases based on substrate similarity design.", "journal": "Angewandte Chemie (International ed. in English)", "date": "2011", "authors": "Hedberg C, Dekker FJ, Rusch M, Renner S, Wetzel S, Vartak N, Gerding-Reimers C, Bon RS, Bastiaens PI, Waldmann H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "21905185", "url": "https://glygen.org/publication/PubMed/21905185" } ] }, { "title": "Identification of acyl protein thioesterases 1 and 2 as the cellular targets of the Ras-signaling modulators palmostatin B and M.", "journal": "Angewandte Chemie (International ed. in English)", "date": "2011", "authors": "Rusch M, Zimmermann TJ, Burger M, Dekker FJ, Gormer K, Triola G, Brockmeyer A, Janning P, Bottcher T, Sieber SA, Vetter IR, Hedberg C, Waldmann H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "21905186", "url": "https://glygen.org/publication/PubMed/21905186" } ] }, { "title": "Arl2-GTP and Arl3-GTP regulate a GDI-like transport system for farnesylated cargo.", "journal": "Nature chemical biology", "date": "2011", "authors": "Ismail SA, Chen YX, Rusinova A, Chandra A, Bierbaum M, Gremer L, Triola G, Waldmann H, Bastiaens PI, Wittinghofer A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "22002721", "url": "https://glygen.org/publication/PubMed/22002721" } ] }, { "title": "Inhibiting the palmitoylation/depalmitoylation cycle selectively reduces the growth of hematopoietic cells expressing oncogenic Nras.", "journal": "Blood", "date": "2012", "authors": "Xu J, Hedberg C, Dekker FJ, Li Q, Haigis KM, Hwang E, Waldmann H, Shannon K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "22144181", "url": "https://glygen.org/publication/PubMed/22144181" } ] }, { "title": "The GDI-like solubilizing factor PDEdelta sustains the spatial organization and signalling of Ras family proteins.", "journal": "Nature cell biology", "date": "2011", "authors": "Chandra A, Grecco HE, Pisupati V, Perera D, Cassidy L, Skoulidis F, Ismail SA, Hedberg C, Hanzal-Bayer M, Venkitaraman AR, Wittinghofer A, Bastiaens PI", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "22179043", "url": "https://glygen.org/publication/PubMed/22179043" } ] }, { "title": "Mechanism of isoprenylcysteine carboxyl methylation from the crystal structure of the integral membrane methyltransferase ICMT.", "journal": "Molecular cell", "date": "2011", "authors": "Yang J, Kulkarni K, Manolaridis I, Zhang Z, Dodd RB, Mas-Droux C, Barford D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "22195972", "url": "https://glygen.org/publication/PubMed/22195972" } ] }, { "title": "Comparative large-scale characterisation of plant vs. mammal proteins reveals similar and idiosyncratic N-alpha acetylation features.", "journal": "Mol. Cell. Proteomics", "date": "2012", "authors": "Bienvenut WV, Sumpton D, Martinez A, Lilla S, Espagne C, Meinnel T, Giglione C", "evidence": [ { "database": "UniProtKB", "id": "B4DP64", "url": "https://www.uniprot.org/uniprot/B4DP64" } ], "reference": [ { "type": "PubMed", "id": "22223895", "url": "https://glygen.org/publication/PubMed/22223895" } ] }, { "title": "Distinct acyl protein transferases and thioesterases control surface expression of calcium-activated potassium channels.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Tian L, McClafferty H, Knaus HG, Ruth P, Shipston MJ", "evidence": [ { "database": "UniProtKB", "id": "O75608", "url": "https://www.uniprot.org/uniprot/O75608" } ], "reference": [ { "type": "PubMed", "id": "22399288", "url": "https://glygen.org/publication/PubMed/22399288" } ] }, { "title": "A comprehensive survey of Ras mutations in cancer.", "journal": "Cancer research", "date": "2012", "authors": "Prior IA, Lewis PD, Mattos C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "22589270", "url": "https://glygen.org/publication/PubMed/22589270" } ] }, { "title": "Dissociation of the K-Ras4B/PDEdelta complex upon contact with lipid membranes: membrane delivery instead of extraction.", "journal": "Journal of the American Chemical Society", "date": "2012", "authors": "Weise K, Kapoor S, Werkmuller A, Mobitz S, Zimmermann G, Triola G, Waldmann H, Winter R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "22721555", "url": "https://glygen.org/publication/PubMed/22721555" } ] }, { "title": "Proteome wide purification and identification of O-GlcNAc-modified proteins using click chemistry and mass spectrometry.", "journal": "Journal of proteome research", "date": "2013", "authors": "Hahne H, Sobotzki N, Nyberg T, Helm D, Borodkin VS, van Aalten DM, Agnew B, Kuster B", "evidence": [ { "database": "O-GlcNAc Database", "id": "O75608", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75608" } ], "reference": [ { "type": "PubMed", "id": "23301498", "url": "https://glygen.org/publication/PubMed/23301498" } ] }, { "title": "Functionalized indoleamines as potent, drug-like inhibitors of isoprenylcysteine carboxyl methyltransferase (Icmt).", "journal": "European journal of medicinal chemistry", "date": "2013", "authors": "Ramanujulu PM, Yang T, Yap SQ, Wong FC, Casey PJ, Wang M, Go ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "23514631", "url": "https://glygen.org/publication/PubMed/23514631" } ] }, { "title": "Small molecule inhibition of the KRAS-PDEdelta interaction impairs oncogenic KRAS signalling.", "journal": "Nature", "date": "2013", "authors": "Zimmermann G, Papke B, Ismail S, Vartak N, Chandra A, Hoffmann M, Hahn SA, Triola G, Wittinghofer A, Bastiaens PI, Waldmann H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "23698361", "url": "https://glygen.org/publication/PubMed/23698361" } ] }, { "title": "Oncogenic K-ras segregates at spatially distinct plasma membrane signaling platforms according to its phosphorylation status.", "journal": "Journal of cell science", "date": "2013", "authors": "Barcelo C, Paco N, Beckett AJ, Alvarez-Moya B, Garrido E, Gelabert M, Tebar F, Jaumot M, Prior I, Agell N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "23943869", "url": "https://glygen.org/publication/PubMed/23943869" } ] }, { "title": "Marine natural products: bryostatins in preclinical and clinical studies.", "journal": "Pharmaceutical biology", "date": "2014", "authors": "Kollar P, Rajchard J, Balounova Z, Pazourek J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "24033119", "url": "https://glygen.org/publication/PubMed/24033119" } ] }, { "title": "KRas localizes to the plasma membrane by spatial cycles of solubilization, trapping and vesicular transport.", "journal": "Cell", "date": "2014", "authors": "Schmick M, Vartak N, Papke B, Kovacevic M, Truxius DC, Rossmannek L, Bastiaens PIH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "24725411", "url": "https://glygen.org/publication/PubMed/24725411" } ] }, { "title": "An improved isoprenylcysteine carboxylmethyltransferase inhibitor induces cancer cell death and attenuates tumor growth in vivo.", "journal": "Cancer biology & therapy", "date": "2014", "authors": "Lau HY, Ramanujulu PM, Guo D, Yang T, Wirawan M, Casey PJ, Go ML, Wang M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "24971579", "url": "https://glygen.org/publication/PubMed/24971579" } ] }, { "title": "Membrane protein transport in photoreceptors: the function of PDEdelta: the Proctor lecture.", "journal": "Investigative ophthalmology & visual science", "date": "2014", "authors": "Baehr W", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "25550383", "url": "https://glygen.org/publication/PubMed/25550383" } ] }, { "title": "Mechanisms of membrane binding of small GTPase K-Ras4B farnesylated hypervariable region.", "journal": "The Journal of biological chemistry", "date": "2015", "authors": "Jang H, Abraham SJ, Chavan TS, Hitchinson B, Khavrutskii L, Tarasova NI, Nussinov R, Gaponenko V", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "25713064", "url": "https://glygen.org/publication/PubMed/25713064" } ] }, { "title": "Ras moves to stay in place.", "journal": "Trends in cell biology", "date": "2015", "authors": "Schmick M, Kraemer A, Bastiaens PI", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "25759176", "url": "https://glygen.org/publication/PubMed/25759176" } ] }, { "title": "Ras activation revisited: role of GEF and GAP systems.", "journal": "Biological chemistry", "date": "2015", "authors": "Hennig A, Markwart R, Esparza-Franco MA, Ladds G, Rubio I", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "25781681", "url": "https://glygen.org/publication/PubMed/25781681" } ] }, { "title": "The Key Role of Calmodulin in KRAS-Driven Adenocarcinomas.", "journal": "Molecular cancer research : MCR", "date": "2015", "authors": "Nussinov R, Muratcioglu S, Tsai CJ, Jang H, Gursoy A, Keskin O", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "26085527", "url": "https://glygen.org/publication/PubMed/26085527" } ] }, { "title": "K-Ras Promotes Tumorigenicity through Suppression of Non-canonical Wnt Signaling.", "journal": "Cell", "date": "2015", "authors": "Wang MT, Holderfield M, Galeas J, Delrosario R, To MD, Balmain A, McCormick F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "26590425", "url": "https://glygen.org/publication/PubMed/26590425" } ] }, { "title": "All ras proteins are polyisoprenylated but only some are palmitoylated.", "journal": "Cell", "date": "1989", "authors": "Hancock JF, Magee AI, Childs JE, Marshall CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "2661017", "url": "https://glygen.org/publication/PubMed/2661017" } ] }, { "title": "ABHD17 proteins are novel protein depalmitoylases that regulate N-Ras palmitate turnover and subcellular localization.", "journal": "eLife", "date": "2015", "authors": "Lin DT, Conibear E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "26701913", "url": "https://glygen.org/publication/PubMed/26701913" } ] }, { "title": "Inhibition of isoprenylcysteine carboxylmethyltransferase augments BCR-ABL1 tyrosine kinase inhibition-induced apoptosis in chronic myeloid leukemia.", "journal": "Experimental hematology", "date": "2016", "authors": "Sun WT, Xiang W, Ng BL, Asari K, Bunte RM, Casey PJ, Wang M, Chuah C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "26706195", "url": "https://glygen.org/publication/PubMed/26706195" } ] }, { "title": "Acyl protein thioesterase 1 and 2 (APT-1, APT-2) inhibitors palmostatin B, ML348 and ML349 have different effects on NRAS mutant melanoma cells.", "journal": "Oncotarget", "date": "2016", "authors": "Vujic I, Sanlorenzo M, Esteve-Puig R, Vujic M, Kwong A, Tsumura A, Murphy R, Moy A, Posch C, Monshi B, Rappersberger K, Ortiz-Urda S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "26771141", "url": "https://glygen.org/publication/PubMed/26771141" } ] }, { "title": "p21ras is modified by a farnesyl isoprenoid.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1989", "authors": "Casey PJ, Solski PA, Der CJ, Buss JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "2682646", "url": "https://glygen.org/publication/PubMed/2682646" } ] }, { "title": "Identification of pyrazolopyridazinones as PDEdelta inhibitors.", "journal": "Nature communications", "date": "2016", "authors": "Papke B, Murarka S, Vogel HA, Martin-Gago P, Kovacevic M, Truxius DC, Fansa EK, Ismail S, Zimmermann G, Heinelt K, Schultz-Fademrecht C, Al Saabi A, Baumann M, Nussbaumer P, Wittinghofer A, Waldmann H, Bastiaens PI", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "27094677", "url": "https://glygen.org/publication/PubMed/27094677" } ] }, { "title": "Drugging Ras GTPase: a comprehensive mechanistic and signaling structural view.", "journal": "Chemical Society reviews", "date": "2016", "authors": "Lu S, Jang H, Gu S, Zhang J, Nussinov R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "27396271", "url": "https://glygen.org/publication/PubMed/27396271" } ] }, { "title": "Regulation of K-Ras4B Membrane Binding by Calmodulin.", "journal": "Biophysical journal", "date": "2016", "authors": "Sperlich B, Kapoor S, Waldmann H, Winter R, Weise K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "27410739", "url": "https://glygen.org/publication/PubMed/27410739" } ] }, { "title": "S-Palmitoylation of a Novel Site in the beta2-Adrenergic Receptor Associated with a Novel Intracellular Itinerary.", "journal": "The Journal of biological chemistry", "date": "2016", "authors": "Adachi N, Hess DT, McLaughlin P, Stamler JS", "evidence": [ { "database": "UniProtKB", "id": "O75608", "url": "https://www.uniprot.org/uniprot/O75608" } ], "reference": [ { "type": "PubMed", "id": "27481942", "url": "https://glygen.org/publication/PubMed/27481942" } ] }, { "title": "AMPK and Endothelial Nitric Oxide Synthase Signaling Regulates K-Ras Plasma Membrane Interactions via Cyclic GMP-Dependent Protein Kinase 2.", "journal": "Molecular and cellular biology", "date": "2016", "authors": "Cho KJ, Casteel DE, Prakash P, Tan L, van der Hoeven D, Salim AA, Kim C, Capon RJ, Lacey E, Cunha SR, Gorfe AA, Hancock JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "27697864", "url": "https://glygen.org/publication/PubMed/27697864" } ] }, { "title": "Structural basis of recognition of farnesylated and methylated KRAS4b by PDEdelta.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2016", "authors": "Dharmaiah S, Bindu L, Tran TH, Gillette WK, Frank PH, Ghirlando R, Nissley DV, Esposito D, McCormick F, Stephen AG, Simanshu DK", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "27791178", "url": "https://glygen.org/publication/PubMed/27791178" } ] }, { "title": "Inhibition of Isoprenylcysteine Carboxylmethyltransferase Induces Cell-Cycle Arrest and Apoptosis through p21 and p21-Regulated BNIP3 Induction in Pancreatic Cancer.", "journal": "Molecular cancer therapeutics", "date": "2017", "authors": "Manu KA, Chai TF, Teh JT, Zhu WL, Casey PJ, Wang M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "28167504", "url": "https://glygen.org/publication/PubMed/28167504" } ] }, { "title": "Targeting the Ras palmitoylation/depalmitoylation cycle in cancer.", "journal": "Biochemical Society transactions", "date": "2017", "authors": "Lin DTS, Davis NG, Conibear E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "28630138", "url": "https://glygen.org/publication/PubMed/28630138" } ] }, { "title": "RAS Proteins and Their Regulators in Human Disease.", "journal": "Cell", "date": "2017", "authors": "Simanshu DK, Nissley DV, McCormick F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "28666118", "url": "https://glygen.org/publication/PubMed/28666118" } ] }, { "title": "Targeting Ras with Macromolecules.", "journal": "Cold Spring Harbor perspectives in medicine", "date": "2018", "authors": "Pei D, Chen K, Liao H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "28778966", "url": "https://glygen.org/publication/PubMed/28778966" } ] }, { "title": "Posttranslational Modifications of RAS Proteins.", "journal": "Cold Spring Harbor perspectives in medicine", "date": "2018", "authors": "Ahearn I, Zhou M, Philips MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "29311131", "url": "https://glygen.org/publication/PubMed/29311131" } ] }, { "title": "Rce1: mechanism and inhibition.", "journal": "Critical reviews in biochemistry and molecular biology", "date": "2018", "authors": "Hampton SE, Dore TM, Schmidt WK", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "29424242", "url": "https://glygen.org/publication/PubMed/29424242" } ] }, { "title": "Wnt5a signaling induced phosphorylation increases APT1 activity and promotes melanoma metastatic behavior.", "journal": "eLife", "date": "2018", "authors": "Sadeghi RS, Kulej K, Kathayat RS, Garcia BA, Dickinson BC, Brady DC, Witze ES", "evidence": [ { "database": "iPTMnet", "id": "O75608", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75608" } ], "reference": [ { "type": "PubMed", "id": "29648538", "url": "https://glygen.org/publication/PubMed/29648538" } ] }, { "title": "Lysophospholipases cooperate to mediate lipid homeostasis and lysophospholipid signaling.", "journal": "Journal of lipid research", "date": "2019", "authors": "Wepy JA, Galligan JJ, Kingsley PJ, Xu S, Goodman MC, Tallman KA, Rouzer CA, Marnett LJ", "evidence": [ { "database": "RefSeq", "id": "NP_001266289", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001266289" } ], "reference": [ { "type": "PubMed", "id": "30482805", "url": "https://glygen.org/publication/PubMed/30482805" } ] }, { "title": "Growth Factor Receptor Signaling Inhibition Prevents SARS-CoV-2 Replication.", "journal": "Molecular cell", "date": "2020", "authors": "Klann K, Bojkova D, Tascher G, Ciesek S, Munch C, Cinatl J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "32877642", "url": "https://glygen.org/publication/PubMed/32877642" } ] }, { "title": "O-GlcNAc modification regulates MTA1 transcriptional activity during breast cancer cell genotoxic adaptation.", "journal": "Biochimica et biophysica acta. General subjects", "date": "2021", "authors": "Xie X, Wu Q, Zhang K, Liu Y, Zhang N, Chen Q, Wang L, Li W, Zhang J, Liu Y", "evidence": [ { "database": "O-GlcNAc Database", "id": "O75608", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75608" } ], "reference": [ { "type": "PubMed", "id": "34019948", "url": "https://glygen.org/publication/PubMed/34019948" } ] }, { "title": "LncRNA LOXL1-AS1 Facilitates the Oncogenic Character in Cervical Cancer by the miR-526b-5p /LYPLA1 Axis.", "journal": "Biochemical genetics", "date": "2022", "authors": "Zhang Y, Zheng M, Zhang L, Yuan P, Zhou J, Wang Y, Wang H", "evidence": [ { "database": "RefSeq", "id": "NP_001266289", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001266289" } ], "reference": [ { "type": "PubMed", "id": "34984578", "url": "https://glygen.org/publication/PubMed/34984578" } ] }, { "title": "Multi-comparative Thermal Proteome Profiling Uncovers New O-GlcNAc Proteins in a System-wide Method.", "journal": "Analytical chemistry", "date": "2022-12-29", "authors": "Wang Guoli, Li Yang, Wang Ting, Wang Jun, Yao Jun, Yan Guoquan, Zhang Ying, Lu Haojie", "evidence": [ { "database": "O-GlcNAc Database", "id": "O75608", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75608" } ], "reference": [ { "type": "PubMed", "id": "36580660", "url": "https://glygen.org/publication/PubMed/36580660" } ] }, { "title": "A multicentric consortium study demonstrates that dimethylarginine dimethylaminohydrolase 2 is not a dimethylarginine dimethylaminohydrolase.", "journal": "Nature communications", "date": "2023-06-09", "authors": "Ragavan Vinitha N, Nair Pramod C, Jarzebska Natalia, Angom Ramcharan Singh, Ruta Luana, Bianconi Elisa, Grottelli Silvia, Tararova Natalia D, Ryazanskiy Daniel, Lentz Steven R, Tommasi Sara, Martens-Lobenhoffer Jens, Suzuki-Yamamoto Toshiko, Kimoto Masumi, Rubets Elena, Chau Sarah, Chen Yingjie, Hu Xinli, Bernhardt Nadine, Spieth Peter M, Weiss Norbert, Bornstein Stefan R, Mukhopadhyay Debabrata, Bode-B\u00f6ger Stefanie M, Maas Renke, Wang Ying, Macchiarulo Antonio, Mangoni Arduino A, Cellini Barbara, Rodionov Roman N", "evidence": [ { "database": "Reactome", "id": "R-HSA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615" } ], "reference": [ { "type": "PubMed", "id": "37296100", "url": "https://glygen.org/publication/PubMed/37296100" } ] }, { "title": "Identification of covalently bound amino-terminal myristic acid in endothelial nitric oxide synthase.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Liu J, Sessa WC", "evidence": [ { "database": "Reactome", "id": "R-HSA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615" } ], "reference": [ { "type": "PubMed", "id": "7512951", "url": "https://glygen.org/publication/PubMed/7512951" } ] }, { "title": "Targeting of nitric oxide synthase to endothelial cell caveolae via palmitoylation: implications for nitric oxide signaling.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Garcia-Cardena G, Oh P, Liu J, Schnitzer JE, Sessa WC", "evidence": [ { "database": "Reactome", "id": "R-HSA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615" } ], "reference": [ { "type": "PubMed", "id": "8692835", "url": "https://glygen.org/publication/PubMed/8692835" } ] }, { "title": "Endothelial nitric oxide synthase targeting to caveolae. Specific interactions with caveolin isoforms in cardiac myocytes and endothelial cells.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Feron O, Belhassen L, Kobzik L, Smith TW, Kelly RA, Michel T", "evidence": [ { "database": "Reactome", "id": "R-HSA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615" } ], "reference": [ { "type": "PubMed", "id": "8798458", "url": "https://glygen.org/publication/PubMed/8798458" } ] }, { "title": "Reciprocal regulation of endothelial nitric-oxide synthase by Ca2+-calmodulin and caveolin.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Michel JB, Feron O, Sacks D, Michel T", "evidence": [ { "database": "Reactome", "id": "R-HSA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615" } ], "reference": [ { "type": "PubMed", "id": "9188442", "url": "https://glygen.org/publication/PubMed/9188442" } ] }, { "title": "Dissecting the interaction between nitric oxide synthase (NOS) and caveolin. Functional significance of the nos caveolin binding domain in vivo.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Garcia-Cardena G, Martasek P, Masters BS, Skidd PM, Couet J, Li S, Lisanti MP, Sessa WC", "evidence": [ { "database": "Reactome", "id": "R-HSA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615" } ], "reference": [ { "type": "PubMed", "id": "9325253", "url": "https://glygen.org/publication/PubMed/9325253" } ] }, { "title": "Establishment of a human pancreatic tumor xenograft model: potential application for preclinical evaluation of novel therapeutic agents.", "journal": "Pancreas", "date": "1998", "authors": "Mohammad RM, Dugan MC, Mohamed AN, Almatchy VP, Flake TM, Dergham ST, Shields AF, Al-Katib AA, Vaitkevicius VK, Sarkar FH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "9436858", "url": "https://glygen.org/publication/PubMed/9436858" } ] }, { "title": "Dynamic activation of endothelial nitric oxide synthase by Hsp90.", "journal": "Nature", "date": "1998", "authors": "Garcia-Cardena G, Fan R, Shah V, Sorrentino R, Cirino G, Papapetropoulos A, Sessa WC", "evidence": [ { "database": "Reactome", "id": "R-HSA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615" } ], "reference": [ { "type": "PubMed", "id": "9580552", "url": "https://glygen.org/publication/PubMed/9580552" } ] }, { "title": "Interaction between caveolin-1 and the reductase domain of endothelial nitric-oxide synthase. Consequences for catalysis.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Ghosh S, Gachhui R, Crooks C, Wu C, Lisanti MP, Stuehr DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-203615", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615" } ], "reference": [ { "type": "PubMed", "id": "9712842", "url": "https://glygen.org/publication/PubMed/9712842" } ] }, { "title": "Antitumor activity of SCH 66336, an orally bioavailable tricyclic inhibitor of farnesyl protein transferase, in human tumor xenograft models and wap-ras transgenic mice.", "journal": "Cancer research", "date": "1998", "authors": "Liu M, Bryant MS, Chen J, Lee S, Yaremko B, Lipari P, Malkowski M, Ferrari E, Nielsen L, Prioli N, Dell J, Sinha D, Syed J, Korfmacher WA, Nomeir AA, Lin CC, Wang L, Taveras AG, Doll RJ, Njoroge FG, Mallams AK, Remiszewski S, Catino JJ, Girijavallabhan VM, Bishop WR, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "9810004", "url": "https://glygen.org/publication/PubMed/9810004" } ] }, { "title": "(+)-4-[2-[4-(8-Chloro-3,10-dibromo-6,11-dihydro-5H-benzo[5, 6]cyclohepta[1,2-b]- pyridin-11(R)-yl)-1-piperidinyl]-2-oxo-ethyl]-1-piperidinecarboxamid e (SCH-66336): a very potent farnesyl protein transferase inhibitor as a novel antitumor agent.", "journal": "Journal of medicinal chemistry", "date": "1998", "authors": "Njoroge FG, Taveras AG, Kelly J, Remiszewski S, Mallams AK, Wolin R, Afonso A, Cooper AB, Rane DF, Liu YT, Wong J, Vibulbhan B, Pinto P, Deskus J, Alvarez CS, del Rosario J, Connolly M, Wang J, Desai J, Rossman RR, Bishop WR, Patton R, Wang L, Kirschmeier P, Ganguly AK, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "9822558", "url": "https://glygen.org/publication/PubMed/9822558" } ] }, { "title": "Inhibition of K-ras-transformed rodent and human cancer cell growth via induction of apoptosis by irreversible inhibitors of Ras endoprotease.", "journal": "Cancer letters", "date": "1998", "authors": "Chen Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648002", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002" } ], "reference": [ { "type": "PubMed", "id": "9851253", "url": "https://glygen.org/publication/PubMed/9851253" } ] } ], "pathway": [ { "id": "hsa:10434", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:10434", "resource": "KEGG Pathway" }, { "id": "R-HSA-203615", "name": "eNOS activation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203615", "resource": "Reactome", "description": "eNOS activation" }, { "id": "R-HSA-9648002", "name": "RAS processing", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648002", "resource": "Reactome", "description": "RAS processing" } ], "orthologs": [ { "uniprot_canonical_ac": "P70470-1", "protein_name": "Acyl-protein thioesterase 1", "gene_name": "Lypla1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MCGNNMSAPMPAVVPAARKATAAVIFLHGLGDTGHGWAEAFAGIKSSHIKYICPHAPVMPVTLNMSMMMPSWFDIIGLSPDSQEDESGIKQAAETVKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFSQGPINSANRDISVLQCHGDCDPLVPLMFGSLTVERLKGLVNPANVTFKVYEGMMHSSCQQEMMDVKYFIDKLLPPID", "length": 230 }, "evidence": [ { "id": "45929025", "url": "http://www.informatics.jax.org/homology/45929025", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P97823-1", "protein_name": "Acyl-protein thioesterase 1", "gene_name": "Lypla1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MCGNNMSAPMPAVVPAARKATAAVIFLHGLGDTGHGWAEAFAGIKSPHIKYICPHAPVMPVTLNMNMAMPSWFDIVGLSPDSQEDESGIKQAAETVKALIDQEVKNGIPSNRIILGGFSQGGALSLYTALTTQQKLAGVTALSCWLPLRASFSQGPINSANRDISVLQCHGDCDPLVPLMFGSLTVERLKALINPANVTFKIYEGMMHSSCQQEMMDVKHFIDKLLPPID", "length": 230 }, "evidence": [ { "id": "45929025", "url": "http://www.informatics.jax.org/homology/45929025", "database": "MGI" }, { "id": "O75608", "url": "https://omabrowser.org/oma/group/O75608/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 6, "go_terms": [ { "name": "hydrolase activity", "id": "GO:0016787", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016787", "evidence": [ { "database": "UniProtKB", "id": "O75608", "url": "https://www.uniprot.org/uniprot/O75608" } ], "pmid": "" }, { "name": "lipase activity", "id": "GO:0016298", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016298", "evidence": [ { "database": "UniProtKB", "id": "O75608", "url": "https://www.uniprot.org/uniprot/O75608" } ], "pmid": "" }, { "name": "carboxylic ester hydrolase activity", "id": "GO:0052689", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0052689", "evidence": [ { "database": "UniProtKB", "id": "O75608", "url": "https://www.uniprot.org/uniprot/O75608" } ], "pmid": "" }, { "name": "phospholipase activity", "id": "GO:0004620", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004620", "evidence": [ { "database": "UniProtKB", "id": "O75608", "url": "https://www.uniprot.org/uniprot/O75608" } ], "pmid": "" }, { "name": "lysophospholipase activity", "id": "GO:0004622", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004622", "evidence": [ { "database": "UniProtKB", "id": "O75608", "url": "https://www.uniprot.org/uniprot/O75608" } ], "pmid": "" }, { "name": "palmitoyl-(protein) hydrolase activity", "id": "GO:0008474", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008474", "evidence": [ { "database": "UniProtKB", "id": "O75608", "url": "https://www.uniprot.org/uniprot/O75608" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 9, "go_terms": [ { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "O75608", "url": "https://www.uniprot.org/uniprot/O75608" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "O75608", "url": "https://www.uniprot.org/uniprot/O75608" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "O75608", "url": "https://www.uniprot.org/uniprot/O75608" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "O75608", "url": "https://www.uniprot.org/uniprot/O75608" } ], "pmid": "" }, { "name": "endoplasmic reticulum", "id": "GO:0005783", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "evidence": [ { "database": "UniProtKB", "id": "O75608", "url": "https://www.uniprot.org/uniprot/O75608" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "O75608", "url": "https://www.uniprot.org/uniprot/O75608" } ], "pmid": "" }, { "name": "cell surface", "id": "GO:0009986", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009986", "evidence": [ { "database": "UniProtKB", "id": "O75608", "url": "https://www.uniprot.org/uniprot/O75608" } ], "pmid": "" }, { "name": "nuclear membrane", "id": "GO:0031965", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031965", "evidence": [ { "database": "UniProtKB", "id": "O75608", "url": "https://www.uniprot.org/uniprot/O75608" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "O75608", "url": "https://www.uniprot.org/uniprot/O75608" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "fatty acid metabolic process", "id": "GO:0006631", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006631", "evidence": [ { "database": "UniProtKB", "id": "O75608", "url": "https://www.uniprot.org/uniprot/O75608" } ], "pmid": "" }, { "name": "fatty acid transport", "id": "GO:0015908", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015908", "evidence": [ { "database": "UniProtKB", "id": "O75608", "url": "https://www.uniprot.org/uniprot/O75608" } ], "pmid": "" }, { "name": "negative regulation of Golgi to plasma membrane protein transport", "id": "GO:0042997", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042997", "evidence": [ { "database": "UniProtKB", "id": "O75608", "url": "https://www.uniprot.org/uniprot/O75608" } ], "pmid": "" }, { "name": "protein depalmitoylation", "id": "GO:0002084", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002084", "evidence": [ { "database": "UniProtKB", "id": "O75608", "url": "https://www.uniprot.org/uniprot/O75608" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 197, "end_pos": 199, "annotation": "n_glycosylation_sequon" }, { "start_pos": 5, "end_pos": 7, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "19233", "name": "", "equation": "H2O + S-hexadecanoyl-L-cysteinyl-[protein] = H(+) + hexadecanoate + L-cysteinyl-[protein]", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "B5DFK7-1", "Q5XIJ5-1", "Q6AY17-1", "P45479-1", "Q5I0K5-1", "P70470-1", "Q9QYL8-1", "F1LN46-1", "Q5VST6-1", "Q6PCB6-1", "Q96GS6-1", "P50897-1", "Q9NUJ1-1", "Q5VWZ2-1", "O95372-1", "O75608-1", "Q8TCG5-1", "Q99JW1-1", "Q8VCV1-1", "Q7M759-1", "O88531-1", "Q6PE15-1", "Q9WTL7-1", "Q3UFF7-1", "P97823-1", "Q8BGD5-1", "Q12354-1", "Q54T49-1", "Q55FK4-1", "Q54CM0-1", "Q9W3C7-1" ], "evidence": [ { "id": "19233", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/19233" } ] }, { "id": "40435", "name": "", "equation": "1-hexadecanoyl-sn-glycero-3-phosphocholine + H2O = H(+) + hexadecanoate + sn-glycerol 3-phosphocholine", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P07882-1", "O88202-1", "P97570-1", "O54728-1", "P50393-1", "P70470-1", "P07867-1", "Q5BK26-1", "Q675A5-1", "Q9QYL8-1", "D3ZRC4-1", "D3Z9B7-1", "D4A1I6-1", "D3ZQH6-1", "F1LPY6-1", "D4A328-1", "P19835-1", "Q86U10-1", "P0C869-1", "Q6P1J6-1", "P11150-1", "Q7L5L3-2", "O95372-1", "O75608-1", "O60733-1", "P47712-1", "Q68DD2-1", "Q3MJ16-3", "Q8IY17-4", "Q8NCC3-1", "Q9UP65-1", "Q6ZV29-1", "Q9NP80-1", "P47713-1", "P0C871-1", "Q64285-1", "A0JNU3-1", "Q50L43-1", "Q9WTL7-1", "P97823-1", "Q8VEB4-1", "Q8K1N1-1", "A2AJ88-1", "P97819-1", "Q50L41-1", "Q50L42-1", "Q3TRM4-1", "Q3TTY0-1", "Q99LY2-1", "P27656-1", "Q64GA5-1", "P39105-1", "Q03674-1", "Q9VMM8-1" ], "evidence": [ { "id": "40435", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/40435" } ] }, { "id": "41720", "name": "", "equation": "a 1-(9Z-octadecenoyl)-2-acyl-sn-glycero-3-phosphocholine + H2O = (9Z)-octadecenoate + a 2-acyl-sn-glycero-3-phosphocholine + H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P70470-1", "D4A328-1", "O75608-1", "P97823-1" ], "evidence": [ { "id": "41720", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/41720" } ] }, { "id": "R-HSA-203613", "name": "depalmitoylation of eNOS", "equation": "", "summary": "Increases in intracellular calcium and calmodulin stimulate depalmitoylation of eNOS by acyl protein thioesterase 1, which displaces eNOS from the membrane. This might be a mechanism to downregulate NO production following intense stimuli.", "cellular_location": "cytosol, plasma membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P29474-1", "O75608-1" ], "evidence": [ { "id": "R-HSA-203613", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203613" } ] }, { "id": "R-HSA-9647991", "name": "Palmostatin B binds RAS depalmitoylases", "equation": "", "summary": "Palmostatin B binds to acylthioesterases and inhibits their activity, resulting in RAS proteins that are stably palmitoylated (Dekker et al, 2010; Lin and Conibear, 2015; reviewed in Lin et al, 2017). Although this inhibition might be predicted to promote sustained RAS-dependent signaling, in fact interruption of the palmitoylation-depalmitoylation cycle results in generalized redistribution of RAS proteins to all cellular membranes, impairing function (Dekker et al, 2010). Consistent with this, Inhibition of RAS acyl protein thioesterases has been shown to have some use in restricting the proliferation of NRAS-driven melanomas (Rusch et al, 2011; Hedberg et al, 2011; Xu et al, 2012; Vujic et al, 2016).", "cellular_location": "plasma membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q5VST6-1", "Q6PCB6-1", "Q96GS6-1", "O75608-1" ], "evidence": [ { "id": "R-HSA-9647991", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9647991" } ] }, { "id": "R-HSA-9647994", "name": "RAS proteins are depalmitoylated", "equation": "", "summary": "RAS proteins undergo a dynamic palmitoylation and depalmitoylation cycle that regulates their association with membranes and thus their localization and function (Hancock et al, 1989; Swarthout et al, 2005; reviewed in Gysin et al, 2011; Lin et al, 2017; Ahearn et al, 2018). Depalmitoylation is catalyzed by the acyl-protein thioesterase LYPLA1, also known as APT1, or by members of the ABHD17 family (Dekker et al, 2010; Lin and Conibear, 2015; reviewed in Lin et al, 2017).", "cellular_location": "plasma membrane", "input_participant_list": [], "output_participant_list": [ "R-ALL-8848337" ], "enzyme_list": [ "P01111-1", "Q5VST6-1", "Q6PCB6-1", "Q96GS6-1", "P01112-1", "O75608-1" ], "evidence": [ { "id": "R-HSA-9647994", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9647994" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-8848337", "participant_name": "PALM(-) [cytosol]", "crossref": [ { "id": "7896", "database": "ChEBI", "url": "" }, { "id": "000006072466", "database": "ZINC", "url": "" }, { "id": "000006072466", "database": "ZINC", "url": "" }, { "id": "7896", "database": "ChEBI", "url": "" }, { "id": "7896", "database": "ChEBI", "url": "" }, { "id": "000006072466", "database": "ZINC", "url": "" }, { "id": "000006072466", "database": "ZINC", "url": "" }, { "id": "7896", "database": "ChEBI", "url": "" }, { "id": "7896", "database": "ChEBI", "url": "" }, { "id": "000006072466", "database": "ZINC", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "A0JNU3", "gene_name": "Aspg", "activity": [ { "ec_number": "3.5.1.1", "activity": "H2O + L-asparagine = L-aspartate + NH4(+).", "evidence": [ { "id": "A0JNU3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0JNU3" } ] }, { "ec_number": "3.1.1.5", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine.", "evidence": [ { "id": "A0JNU3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0JNU3" } ] }, { "ec_number": "3.1.1.47", "activity": "a 1-O-alkyl-2-acetyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + acetate + H(+).", "evidence": [ { "id": "A0JNU3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0JNU3" } ] }, { "ec_number": "3.1.1.5", "activity": "", "evidence": [ { "id": "A0JNU3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0JNU3" } ] }, { "ec_number": "3.5.1.1", "activity": "", "evidence": [ { "id": "A0JNU3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0JNU3" } ] } ] }, { "uniprot_ac": "A2AJ88", "gene_name": "Pnpla7", "activity": [ { "ec_number": "3.1.1.-", "activity": "", "evidence": [ { "id": "A2AJ88", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2AJ88" } ] }, { "ec_number": "3.1.1.5", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine.", "evidence": [ { "id": "A2AJ88", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2AJ88" } ] }, { "ec_number": "3.1.1.5", "activity": "", "evidence": [ { "id": "A2AJ88", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2AJ88" } ] } ] }, { "uniprot_ac": "B5DFK7", "gene_name": "Abhd17c", "activity": [ { "ec_number": "3.1.2.22", "activity": "H2O + S-hexadecanoyl-L-cysteinyl-[protein] = H(+) + hexadecanoate + L-cysteinyl-[protein].", "evidence": [ { "id": "B5DFK7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B5DFK7" } ] }, { "ec_number": "3.1.2.22", "activity": "", "evidence": [ { "id": "B5DFK7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B5DFK7" } ] } ] }, { "uniprot_ac": "D3Z9B7", "gene_name": "Pla2g4f", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "D3Z9B7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3Z9B7" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "D3Z9B7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3Z9B7" } ] } ] }, { "uniprot_ac": "D3ZQH6", "gene_name": "Pla2g4d", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "D3ZQH6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZQH6" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "D3ZQH6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZQH6" } ] } ] }, { "uniprot_ac": "D3ZRC4", "gene_name": "Pnpla8", "activity": [ { "ec_number": "3.1.1.-", "activity": "", "evidence": [ { "id": "D3ZRC4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZRC4" } ] }, { "ec_number": "3.1.1.5", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine.", "evidence": [ { "id": "D3ZRC4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZRC4" } ] }, { "ec_number": "3.1.1.5", "activity": "", "evidence": [ { "id": "D3ZRC4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZRC4" } ] } ] }, { "uniprot_ac": "D4A1I6", "gene_name": "Pla2g4b", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "D4A1I6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4A1I6" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "D4A1I6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4A1I6" } ] } ] }, { "uniprot_ac": "D4A328", "gene_name": "LOC120099997", "activity": [ { "ec_number": "3.1.2.22", "activity": "H2O + S-hexadecanoyl-L-cysteinyl-[protein] = H(+) + hexadecanoate + L-cysteinyl-[protein].", "evidence": [ { "id": "D4A328", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4A328" } ] }, { "ec_number": "3.1.2.22", "activity": "", "evidence": [ { "id": "D4A328", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4A328" } ] } ] }, { "uniprot_ac": "F1LN46", "gene_name": "Cpt1c", "activity": [ { "ec_number": "3.1.2.22", "activity": "H2O + S-hexadecanoyl-L-cysteinyl-[protein] = H(+) + hexadecanoate + L-cysteinyl-[protein].", "evidence": [ { "id": "F1LN46", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1LN46" } ] }, { "ec_number": "3.1.2.22", "activity": "", "evidence": [ { "id": "F1LN46", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1LN46" } ] }, { "ec_number": "2.3.1.21", "activity": "(R)-carnitine + hexadecanoyl-CoA = CoA + O-hexadecanoyl-(R)-carnitine.", "evidence": [ { "id": "F1LN46", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1LN46" } ] }, { "ec_number": "2.3.1.21", "activity": "", "evidence": [ { "id": "F1LN46", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1LN46" } ] } ] }, { "uniprot_ac": "F1LPY6", "gene_name": "Pla2g4e", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "F1LPY6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1LPY6" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "F1LPY6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1LPY6" } ] } ] }, { "uniprot_ac": "O54728", "gene_name": "Plb1", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "O54728", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54728" } ] }, { "ec_number": "3.1.1.3", "activity": "a triacylglycerol + H2O = a diacylglycerol + a fatty acid + H(+).", "evidence": [ { "id": "O54728", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54728" } ] }, { "ec_number": "3.1.1.5", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine.", "evidence": [ { "id": "O54728", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54728" } ] }, { "ec_number": "3.1.1.3", "activity": "", "evidence": [ { "id": "O54728", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54728" } ] }, { "ec_number": "3.1.1.5", "activity": "", "evidence": [ { "id": "O54728", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54728" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "O54728", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54728" } ] } ] }, { "uniprot_ac": "O60733", "gene_name": "PLA2G6", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "O60733", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60733" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "O60733", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60733" } ] }, { "ec_number": "3.1.2.2", "activity": "H2O + hexadecanoyl-CoA = CoA + H(+) + hexadecanoate.", "evidence": [ { "id": "O60733", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60733" } ] }, { "ec_number": "3.1.1.5", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine.", "evidence": [ { "id": "O60733", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60733" } ] } ] }, { "uniprot_ac": "O75608", "gene_name": "LYPLA1", "activity": [ { "ec_number": "3.1.2.22", "activity": "H2O + S-hexadecanoyl-L-cysteinyl-[protein] = H(+) + hexadecanoate + L-cysteinyl-[protein].", "evidence": [ { "id": "O75608", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75608" } ] }, { "ec_number": "3.1.2.22", "activity": "", "evidence": [ { "id": "O75608", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75608" } ] }, { "ec_number": "3.1.2.-", "activity": "", "evidence": [ { "id": "O75608", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75608" } ] } ] }, { "uniprot_ac": "O88202", "gene_name": "Aspg", "activity": [ { "ec_number": "3.1.1.47", "activity": "a 1-O-alkyl-2-acetyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + acetate + H(+).", "evidence": [ { "id": "O88202", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88202" } ] }, { "ec_number": "3.5.1.1", "activity": "H2O + L-asparagine = L-aspartate + NH4(+).", "evidence": [ { "id": "O88202", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88202" } ] }, { "ec_number": "3.1.1.5", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine.", "evidence": [ { "id": "O88202", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88202" } ] }, { "ec_number": "3.1.1.5", "activity": "", "evidence": [ { "id": "O88202", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88202" } ] }, { "ec_number": "3.5.1.1", "activity": "", "evidence": [ { "id": "O88202", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88202" } ] } ] }, { "uniprot_ac": "O88531", "gene_name": "Ppt1", "activity": [ { "ec_number": "3.1.2.22", "activity": "H2O + S-hexadecanoyl-L-cysteinyl-[protein] = H(+) + hexadecanoate + L-cysteinyl-[protein].", "evidence": [ { "id": "O88531", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88531" } ] }, { "ec_number": "3.1.2.22", "activity": "", "evidence": [ { "id": "O88531", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88531" } ] } ] }, { "uniprot_ac": "O95372", "gene_name": "LYPLA2", "activity": [ { "ec_number": "3.1.2.22", "activity": "H2O + S-hexadecanoyl-L-cysteinyl-[protein] = H(+) + hexadecanoate + L-cysteinyl-[protein].", "evidence": [ { "id": "O95372", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95372" } ] }, { "ec_number": "3.1.2.22", "activity": "", "evidence": [ { "id": "O95372", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95372" } ] }, { "ec_number": "3.1.2.-", "activity": "", "evidence": [ { "id": "O95372", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O95372" } ] } ] }, { "uniprot_ac": "P01111", "gene_name": "NRAS", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P01111", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01111" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P01111", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01111" } ] } ] }, { "uniprot_ac": "P01112", "gene_name": "HRAS", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P01112", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01112" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P01112", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P01112" } ] } ] }, { "uniprot_ac": "P07867", "gene_name": "Lipc", "activity": [ { "ec_number": "3.1.1.32", "activity": "a 1,2-diacyl-sn-glycero-3-phosphocholine + H2O = a 2-acyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "P07867", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07867" } ] }, { "ec_number": "3.1.1.3", "activity": "a triacylglycerol + H2O = a diacylglycerol + a fatty acid + H(+).", "evidence": [ { "id": "P07867", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07867" } ] }, { "ec_number": "3.1.1.5", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine.", "evidence": [ { "id": "P07867", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07867" } ] }, { "ec_number": "3.1.1.3", "activity": "", "evidence": [ { "id": "P07867", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07867" } ] }, { "ec_number": "3.1.1.5", "activity": "", "evidence": [ { "id": "P07867", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07867" } ] }, { "ec_number": "3.1.1.32", "activity": "", "evidence": [ { "id": "P07867", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07867" } ] } ] }, { "uniprot_ac": "P07882", "gene_name": "Cel", "activity": [ { "ec_number": "3.1.1.-", "activity": "", "evidence": [ { "id": "P07882", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07882" } ] }, { "ec_number": "3.1.1.13", "activity": "a cholesterol ester + H2O = a fatty acid + cholesterol + H(+).", "evidence": [ { "id": "P07882", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07882" } ] }, { "ec_number": "3.1.1.3", "activity": "a triacylglycerol + H2O = a diacylglycerol + a fatty acid + H(+).", "evidence": [ { "id": "P07882", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07882" } ] }, { "ec_number": "3.1.1.6", "activity": "an acetyl ester + H2O = acetate + an aliphatic alcohol + H(+).", "evidence": [ { "id": "P07882", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07882" } ] }, { "ec_number": "3.1.1.13", "activity": "", "evidence": [ { "id": "P07882", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07882" } ] }, { "ec_number": "3.1.1.3", "activity": "", "evidence": [ { "id": "P07882", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07882" } ] }, { "ec_number": "3.1.1.6", "activity": "", "evidence": [ { "id": "P07882", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07882" } ] } ] }, { "uniprot_ac": "P0C869", "gene_name": "PLA2G4B", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "P0C869", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C869" } ] }, { "ec_number": "3.1.1.5", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine.", "evidence": [ { "id": "P0C869", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C869" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "P0C869", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C869" } ] } ] }, { "uniprot_ac": "P0C871", "gene_name": "Pla2g4b", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "P0C871", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C871" } ] }, { "ec_number": "3.1.1.5", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine.", "evidence": [ { "id": "P0C871", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C871" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "P0C871", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C871" } ] } ] }, { "uniprot_ac": "P11150", "gene_name": "LIPC", "activity": [ { "ec_number": "3.1.1.32", "activity": "a 1,2-diacyl-sn-glycero-3-phosphocholine + H2O = a 2-acyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "P11150", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11150" } ] }, { "ec_number": "3.1.1.5", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine.", "evidence": [ { "id": "P11150", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11150" } ] }, { "ec_number": "3.1.1.5", "activity": "", "evidence": [ { "id": "P11150", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11150" } ] }, { "ec_number": "3.1.1.32", "activity": "", "evidence": [ { "id": "P11150", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11150" } ] }, { "ec_number": "3.1.1.3", "activity": "a triacylglycerol + H2O = a diacylglycerol + a fatty acid + H(+).", "evidence": [ { "id": "P11150", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11150" } ] }, { "ec_number": "3.1.1.3", "activity": "", "evidence": [ { "id": "P11150", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11150" } ] } ] }, { "uniprot_ac": "P19835", "gene_name": "CEL", "activity": [ { "ec_number": "3.1.1.13", "activity": "a cholesterol ester + H2O = a fatty acid + cholesterol + H(+).", "evidence": [ { "id": "P19835", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19835" } ] }, { "ec_number": "3.1.1.3", "activity": "a triacylglycerol + H2O = a diacylglycerol + a fatty acid + H(+).", "evidence": [ { "id": "P19835", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19835" } ] }, { "ec_number": "3.1.1.6", "activity": "an acetyl ester + H2O = acetate + an aliphatic alcohol + H(+).", "evidence": [ { "id": "P19835", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19835" } ] }, { "ec_number": "3.1.1.13", "activity": "", "evidence": [ { "id": "P19835", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19835" } ] }, { "ec_number": "3.1.1.6", "activity": "", "evidence": [ { "id": "P19835", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19835" } ] }, { "ec_number": "3.1.1.3", "activity": "", "evidence": [ { "id": "P19835", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19835" } ] } ] }, { "uniprot_ac": "P27656", "gene_name": "Lipc", "activity": [ { "ec_number": "3.1.1.32", "activity": "a 1,2-diacyl-sn-glycero-3-phosphocholine + H2O = a 2-acyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "P27656", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P27656" } ] }, { "ec_number": "3.1.1.3", "activity": "a triacylglycerol + H2O = a diacylglycerol + a fatty acid + H(+).", "evidence": [ { "id": "P27656", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P27656" } ] }, { "ec_number": "3.1.1.5", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine.", "evidence": [ { "id": "P27656", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P27656" } ] }, { "ec_number": "3.1.1.3", "activity": "", "evidence": [ { "id": "P27656", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P27656" } ] }, { "ec_number": "3.1.1.5", "activity": "", "evidence": [ { "id": "P27656", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P27656" } ] }, { "ec_number": "3.1.1.32", "activity": "", "evidence": [ { "id": "P27656", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P27656" } ] } ] }, { "uniprot_ac": "P29474", "gene_name": "NOS3", "activity": [ { "ec_number": "1.14.13.39", "activity": "H(+) + 2 L-arginine + 3 NADPH + 4 O2 = 4 H2O + 2 L-citrulline + 3 NADP(+) + 2 nitric oxide.", "evidence": [ { "id": "P29474", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P29474" } ] }, { "ec_number": "1.14.13.39", "activity": "", "evidence": [ { "id": "P29474", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P29474" } ] } ] }, { "uniprot_ac": "P39105", "gene_name": "PLB1", "activity": [ { "ec_number": "3.1.1.5", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine.", "evidence": [ { "id": "P39105", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39105" } ] }, { "ec_number": "3.1.1.5", "activity": "", "evidence": [ { "id": "P39105", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39105" } ] } ] }, { "uniprot_ac": "P45479", "gene_name": "Ppt1", "activity": [ { "ec_number": "3.1.2.22", "activity": "H2O + S-hexadecanoyl-L-cysteinyl-[protein] = H(+) + hexadecanoate + L-cysteinyl-[protein].", "evidence": [ { "id": "P45479", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P45479" } ] }, { "ec_number": "3.1.2.22", "activity": "", "evidence": [ { "id": "P45479", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P45479" } ] } ] }, { "uniprot_ac": "P47712", "gene_name": "PLA2G4A", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "P47712", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47712" } ] }, { "ec_number": "3.1.1.5", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine.", "evidence": [ { "id": "P47712", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47712" } ] } ] }, { "uniprot_ac": "P47713", "gene_name": "Pla2g4a", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "P47713", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47713" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "P47713", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47713" } ] }, { "ec_number": "3.1.1.5", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine.", "evidence": [ { "id": "P47713", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47713" } ] } ] }, { "uniprot_ac": "P50393", "gene_name": "Pla2g4a", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "P50393", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50393" } ] }, { "ec_number": "3.1.1.5", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine.", "evidence": [ { "id": "P50393", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50393" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "P50393", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50393" } ] } ] }, { "uniprot_ac": "P50897", "gene_name": "PPT1", "activity": [ { "ec_number": "3.1.2.22", "activity": "H2O + S-hexadecanoyl-L-cysteinyl-[protein] = H(+) + hexadecanoate + L-cysteinyl-[protein].", "evidence": [ { "id": "P50897", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50897" } ] }, { "ec_number": "3.1.2.22", "activity": "", "evidence": [ { "id": "P50897", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P50897" } ] } ] }, { "uniprot_ac": "P70470", "gene_name": "Lypla1", "activity": [ { "ec_number": "3.1.2.22", "activity": "H2O + S-hexadecanoyl-L-cysteinyl-[protein] = H(+) + hexadecanoate + L-cysteinyl-[protein].", "evidence": [ { "id": "P70470", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70470" } ] }, { "ec_number": "3.1.2.22", "activity": "", "evidence": [ { "id": "P70470", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70470" } ] }, { "ec_number": "3.1.2.-", "activity": "", "evidence": [ { "id": "P70470", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70470" } ] } ] }, { "uniprot_ac": "P97570", "gene_name": "Pla2g6", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "P97570", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97570" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "P97570", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97570" } ] }, { "ec_number": "3.1.2.2", "activity": "H2O + hexadecanoyl-CoA = CoA + H(+) + hexadecanoate.", "evidence": [ { "id": "P97570", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97570" } ] }, { "ec_number": "3.1.1.5", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine.", "evidence": [ { "id": "P97570", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97570" } ] } ] }, { "uniprot_ac": "P97819", "gene_name": "Pla2g6", "activity": [ { "ec_number": "3.1.2.2", "activity": "H2O + hexadecanoyl-CoA = CoA + H(+) + hexadecanoate.", "evidence": [ { "id": "P97819", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97819" } ] }, { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "P97819", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97819" } ] }, { "ec_number": "3.1.1.5", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine.", "evidence": [ { "id": "P97819", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97819" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "P97819", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97819" } ] } ] }, { "uniprot_ac": "P97823", "gene_name": "Lypla1", "activity": [ { "ec_number": "3.1.2.22", "activity": "H2O + S-hexadecanoyl-L-cysteinyl-[protein] = H(+) + hexadecanoate + L-cysteinyl-[protein].", "evidence": [ { "id": "P97823", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97823" } ] }, { "ec_number": "3.1.2.22", "activity": "", "evidence": [ { "id": "P97823", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97823" } ] }, { "ec_number": "3.1.2.-", "activity": "", "evidence": [ { "id": "P97823", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97823" } ] } ] }, { "uniprot_ac": "Q03674", "gene_name": "PLB2", "activity": [ { "ec_number": "3.1.1.5", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine.", "evidence": [ { "id": "Q03674", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03674" } ] }, { "ec_number": "3.1.1.5", "activity": "", "evidence": [ { "id": "Q03674", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03674" } ] } ] }, { "uniprot_ac": "Q12354", "gene_name": "", "activity": [ { "ec_number": "3.1.2.22", "activity": "H2O + S-hexadecanoyl-L-cysteinyl-[protein] = H(+) + hexadecanoate + L-cysteinyl-[protein].", "evidence": [ { "id": "Q12354", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12354" } ] }, { "ec_number": "3.1.2.-", "activity": "", "evidence": [ { "id": "Q12354", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12354" } ] } ] }, { "uniprot_ac": "Q3MJ16", "gene_name": "PLA2G4E", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q3MJ16", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3MJ16" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "Q3MJ16", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3MJ16" } ] } ] }, { "uniprot_ac": "Q3TRM4", "gene_name": "Pnpla6", "activity": [ { "ec_number": "3.1.1.5", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine.", "evidence": [ { "id": "Q3TRM4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3TRM4" } ] } ] }, { "uniprot_ac": "Q3TTY0", "gene_name": "Plb1", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q3TTY0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3TTY0" } ] }, { "ec_number": "3.1.1.3", "activity": "a triacylglycerol + H2O = a diacylglycerol + a fatty acid + H(+).", "evidence": [ { "id": "Q3TTY0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3TTY0" } ] }, { "ec_number": "3.1.1.5", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine.", "evidence": [ { "id": "Q3TTY0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3TTY0" } ] } ] }, { "uniprot_ac": "Q3UFF7", "gene_name": "Lyplal1", "activity": [ { "ec_number": "3.1.2.22", "activity": "H2O + S-hexadecanoyl-L-cysteinyl-[protein] = H(+) + hexadecanoate + L-cysteinyl-[protein].", "evidence": [ { "id": "Q3UFF7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UFF7" } ] }, { "ec_number": "3.1.2.22", "activity": "", "evidence": [ { "id": "Q3UFF7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UFF7" } ] } ] }, { "uniprot_ac": "Q50L41", "gene_name": "Pla2g4f", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q50L41", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q50L41" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "Q50L41", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q50L41" } ] } ] }, { "uniprot_ac": "Q50L42", "gene_name": "Pla2g4e", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q50L42", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q50L42" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "Q50L42", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q50L42" } ] } ] }, { "uniprot_ac": "Q50L43", "gene_name": "Pla2g4d", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q50L43", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q50L43" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "Q50L43", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q50L43" } ] } ] }, { "uniprot_ac": "Q54CM0", "gene_name": "ppt3", "activity": [ { "ec_number": "3.1.2.22", "activity": "H2O + S-hexadecanoyl-L-cysteinyl-[protein] = H(+) + hexadecanoate + L-cysteinyl-[protein].", "evidence": [ { "id": "Q54CM0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54CM0" } ] }, { "ec_number": "3.1.2.22", "activity": "", "evidence": [ { "id": "Q54CM0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54CM0" } ] } ] }, { "uniprot_ac": "Q54T49", "gene_name": "", "activity": [ { "ec_number": "3.1.2.22", "activity": "H2O + S-hexadecanoyl-L-cysteinyl-[protein] = H(+) + hexadecanoate + L-cysteinyl-[protein].", "evidence": [ { "id": "Q54T49", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54T49" } ] }, { "ec_number": "3.1.2.-", "activity": "", "evidence": [ { "id": "Q54T49", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54T49" } ] } ] }, { "uniprot_ac": "Q55FK4", "gene_name": "", "activity": [ { "ec_number": "3.1.2.22", "activity": "H2O + S-hexadecanoyl-L-cysteinyl-[protein] = H(+) + hexadecanoate + L-cysteinyl-[protein].", "evidence": [ { "id": "Q55FK4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55FK4" } ] }, { "ec_number": "3.1.2.-", "activity": "", "evidence": [ { "id": "Q55FK4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55FK4" } ] } ] }, { "uniprot_ac": "Q5BK26", "gene_name": "Pnpla7", "activity": [ { "ec_number": "3.1.1.-", "activity": "", "evidence": [ { "id": "Q5BK26", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5BK26" } ] }, { "ec_number": "3.1.1.5", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine.", "evidence": [ { "id": "Q5BK26", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5BK26" } ] }, { "ec_number": "3.1.1.5", "activity": "", "evidence": [ { "id": "Q5BK26", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5BK26" } ] } ] }, { "uniprot_ac": "Q5I0K5", "gene_name": "Abhd10", "activity": [ { "ec_number": "3.1.2.22", "activity": "H2O + S-hexadecanoyl-L-cysteinyl-[protein] = H(+) + hexadecanoate + L-cysteinyl-[protein].", "evidence": [ { "id": "Q5I0K5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5I0K5" } ] }, { "ec_number": "3.1.1.93", "activity": "H2O + mycophenolic acid O-acyl-beta-D-glucuronide = D-glucuronate + H(+) + mycophenolate.", "evidence": [ { "id": "Q5I0K5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5I0K5" } ] }, { "ec_number": "3.1.1.93", "activity": "", "evidence": [ { "id": "Q5I0K5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5I0K5" } ] }, { "ec_number": "3.1.2.22", "activity": "", "evidence": [ { "id": "Q5I0K5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5I0K5" } ] } ] }, { "uniprot_ac": "Q5VST6", "gene_name": "ABHD17B", "activity": [ { "ec_number": "3.1.2.22", "activity": "H2O + S-hexadecanoyl-L-cysteinyl-[protein] = H(+) + hexadecanoate + L-cysteinyl-[protein].", "evidence": [ { "id": "Q5VST6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5VST6" } ] }, { "ec_number": "3.1.2.22", "activity": "", "evidence": [ { "id": "Q5VST6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5VST6" } ] } ] }, { "uniprot_ac": "Q5VWZ2", "gene_name": "LYPLAL1", "activity": [ { "ec_number": "3.1.2.22", "activity": "H2O + S-hexadecanoyl-L-cysteinyl-[protein] = H(+) + hexadecanoate + L-cysteinyl-[protein].", "evidence": [ { "id": "Q5VWZ2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5VWZ2" } ] }, { "ec_number": "3.1.2.22", "activity": "", "evidence": [ { "id": "Q5VWZ2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5VWZ2" } ] } ] }, { "uniprot_ac": "Q5XIJ5", "gene_name": "Abhd17a", "activity": [ { "ec_number": "3.1.2.22", "activity": "H2O + S-hexadecanoyl-L-cysteinyl-[protein] = H(+) + hexadecanoate + L-cysteinyl-[protein].", "evidence": [ { "id": "Q5XIJ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5XIJ5" } ] }, { "ec_number": "3.1.2.22", "activity": "", "evidence": [ { "id": "Q5XIJ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5XIJ5" } ] } ] }, { "uniprot_ac": "Q64285", "gene_name": "Cel", "activity": [ { "ec_number": "3.1.1.13", "activity": "a cholesterol ester + H2O = a fatty acid + cholesterol + H(+).", "evidence": [ { "id": "Q64285", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64285" } ] }, { "ec_number": "3.1.1.3", "activity": "a triacylglycerol + H2O = a diacylglycerol + a fatty acid + H(+).", "evidence": [ { "id": "Q64285", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64285" } ] }, { "ec_number": "3.1.1.6", "activity": "an acetyl ester + H2O = acetate + an aliphatic alcohol + H(+).", "evidence": [ { "id": "Q64285", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64285" } ] }, { "ec_number": "3.1.1.13", "activity": "", "evidence": [ { "id": "Q64285", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64285" } ] }, { "ec_number": "3.1.1.6", "activity": "", "evidence": [ { "id": "Q64285", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64285" } ] }, { "ec_number": "3.1.1.3", "activity": "", "evidence": [ { "id": "Q64285", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64285" } ] } ] }, { "uniprot_ac": "Q64GA5", "gene_name": "Pla2g4c", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q64GA5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64GA5" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q64GA5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64GA5" } ] }, { "ec_number": "3.1.1.5", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine.", "evidence": [ { "id": "Q64GA5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64GA5" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "Q64GA5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64GA5" } ] } ] }, { "uniprot_ac": "Q675A5", "gene_name": "Pla2g15", "activity": [ { "ec_number": "3.1.1.32", "activity": "a 1,2-diacyl-sn-glycero-3-phosphocholine + H2O = a 2-acyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q675A5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q675A5" } ] }, { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q675A5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q675A5" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q675A5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q675A5" } ] }, { "ec_number": "3.1.1.5", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine.", "evidence": [ { "id": "Q675A5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q675A5" } ] } ] }, { "uniprot_ac": "Q68DD2", "gene_name": "PLA2G4F", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q68DD2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q68DD2" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "Q68DD2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q68DD2" } ] } ] }, { "uniprot_ac": "Q6AY17", "gene_name": "Abhd17b", "activity": [ { "ec_number": "3.1.2.22", "activity": "H2O + S-hexadecanoyl-L-cysteinyl-[protein] = H(+) + hexadecanoate + L-cysteinyl-[protein].", "evidence": [ { "id": "Q6AY17", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AY17" } ] }, { "ec_number": "3.1.2.22", "activity": "", "evidence": [ { "id": "Q6AY17", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AY17" } ] } ] }, { "uniprot_ac": "Q6P1J6", "gene_name": "PLB1", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q6P1J6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P1J6" } ] }, { "ec_number": "3.1.1.3", "activity": "a triacylglycerol + H2O = a diacylglycerol + a fatty acid + H(+).", "evidence": [ { "id": "Q6P1J6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P1J6" } ] }, { "ec_number": "3.1.1.5", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine.", "evidence": [ { "id": "Q6P1J6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P1J6" } ] }, { "ec_number": "3.1.1.5", "activity": "", "evidence": [ { "id": "Q6P1J6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P1J6" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "Q6P1J6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P1J6" } ] }, { "ec_number": "3.1.1.3", "activity": "", "evidence": [ { "id": "Q6P1J6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P1J6" } ] } ] }, { "uniprot_ac": "Q6PCB6", "gene_name": "ABHD17C", "activity": [ { "ec_number": "3.1.2.22", "activity": "H2O + S-hexadecanoyl-L-cysteinyl-[protein] = H(+) + hexadecanoate + L-cysteinyl-[protein].", "evidence": [ { "id": "Q6PCB6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6PCB6" } ] }, { "ec_number": "3.1.2.22", "activity": "", "evidence": [ { "id": "Q6PCB6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6PCB6" } ] } ] }, { "uniprot_ac": "Q6PE15", "gene_name": "Abhd10", "activity": [ { "ec_number": "3.1.2.22", "activity": "H2O + S-hexadecanoyl-L-cysteinyl-[protein] = H(+) + hexadecanoate + L-cysteinyl-[protein].", "evidence": [ { "id": "Q6PE15", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6PE15" } ] }, { "ec_number": "3.1.1.93", "activity": "H2O + mycophenolic acid O-acyl-beta-D-glucuronide = D-glucuronate + H(+) + mycophenolate.", "evidence": [ { "id": "Q6PE15", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6PE15" } ] }, { "ec_number": "3.1.2.22", "activity": "", "evidence": [ { "id": "Q6PE15", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6PE15" } ] } ] }, { "uniprot_ac": "Q6ZV29", "gene_name": "PNPLA7", "activity": [ { "ec_number": "3.1.1.-", "activity": "", "evidence": [ { "id": "Q6ZV29", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6ZV29" } ] }, { "ec_number": "3.1.1.5", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine.", "evidence": [ { "id": "Q6ZV29", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6ZV29" } ] }, { "ec_number": "3.1.1.5", "activity": "", "evidence": [ { "id": "Q6ZV29", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6ZV29" } ] } ] }, { "uniprot_ac": "Q7L5L3", "gene_name": "GDPD3", "activity": [ { "ec_number": "3.1.4.-", "activity": "", "evidence": [ { "id": "Q7L5L3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7L5L3" } ] } ] }, { "uniprot_ac": "Q7M759", "gene_name": "Abhd17b", "activity": [ { "ec_number": "3.1.2.22", "activity": "H2O + S-hexadecanoyl-L-cysteinyl-[protein] = H(+) + hexadecanoate + L-cysteinyl-[protein].", "evidence": [ { "id": "Q7M759", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7M759" } ] }, { "ec_number": "3.1.2.22", "activity": "", "evidence": [ { "id": "Q7M759", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7M759" } ] } ] }, { "uniprot_ac": "Q86U10", "gene_name": "ASPG", "activity": [ { "ec_number": "3.5.1.1", "activity": "H2O + L-asparagine = L-aspartate + NH4(+).", "evidence": [ { "id": "Q86U10", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86U10" } ] }, { "ec_number": "3.1.1.5", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine.", "evidence": [ { "id": "Q86U10", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86U10" } ] }, { "ec_number": "3.1.1.47", "activity": "a 1-O-alkyl-2-acetyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + acetate + H(+).", "evidence": [ { "id": "Q86U10", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86U10" } ] }, { "ec_number": "3.1.1.5", "activity": "", "evidence": [ { "id": "Q86U10", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86U10" } ] }, { "ec_number": "3.5.1.1", "activity": "", "evidence": [ { "id": "Q86U10", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86U10" } ] } ] }, { "uniprot_ac": "Q8BGD5", "gene_name": "Cpt1c", "activity": [ { "ec_number": "3.1.2.22", "activity": "H2O + S-hexadecanoyl-L-cysteinyl-[protein] = H(+) + hexadecanoate + L-cysteinyl-[protein].", "evidence": [ { "id": "Q8BGD5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BGD5" } ] }, { "ec_number": "3.1.2.22", "activity": "", "evidence": [ { "id": "Q8BGD5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BGD5" } ] } ] }, { "uniprot_ac": "Q8IY17", "gene_name": "PNPLA6", "activity": [ { "ec_number": "3.1.1.5", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine.", "evidence": [ { "id": "Q8IY17", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IY17" } ] }, { "ec_number": "3.1.1.5", "activity": "", "evidence": [ { "id": "Q8IY17", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IY17" } ] } ] }, { "uniprot_ac": "Q8K1N1", "gene_name": "Pnpla8", "activity": [ { "ec_number": "3.1.1.-", "activity": "", "evidence": [ { "id": "Q8K1N1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K1N1" } ] }, { "ec_number": "3.1.1.5", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine.", "evidence": [ { "id": "Q8K1N1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K1N1" } ] }, { "ec_number": "3.1.1.5", "activity": "", "evidence": [ { "id": "Q8K1N1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K1N1" } ] } ] }, { "uniprot_ac": "Q8NCC3", "gene_name": "PLA2G15", "activity": [ { "ec_number": "3.1.1.32", "activity": "a 1,2-diacyl-sn-glycero-3-phosphocholine + H2O = a 2-acyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q8NCC3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NCC3" } ] }, { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q8NCC3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NCC3" } ] }, { "ec_number": "3.1.1.5", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine.", "evidence": [ { "id": "Q8NCC3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NCC3" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "Q8NCC3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NCC3" } ] }, { "ec_number": "3.1.1.5", "activity": "", "evidence": [ { "id": "Q8NCC3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NCC3" } ] }, { "ec_number": "3.1.1.32", "activity": "", "evidence": [ { "id": "Q8NCC3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NCC3" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q8NCC3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NCC3" } ] } ] }, { "uniprot_ac": "Q8TCG5", "gene_name": "CPT1C", "activity": [ { "ec_number": "3.1.2.22", "activity": "H2O + S-hexadecanoyl-L-cysteinyl-[protein] = H(+) + hexadecanoate + L-cysteinyl-[protein].", "evidence": [ { "id": "Q8TCG5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8TCG5" } ] }, { "ec_number": "3.1.2.22", "activity": "", "evidence": [ { "id": "Q8TCG5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8TCG5" } ] } ] }, { "uniprot_ac": "Q8VCV1", "gene_name": "Abhd17c", "activity": [ { "ec_number": "3.1.2.22", "activity": "H2O + S-hexadecanoyl-L-cysteinyl-[protein] = H(+) + hexadecanoate + L-cysteinyl-[protein].", "evidence": [ { "id": "Q8VCV1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VCV1" } ] }, { "ec_number": "3.1.2.22", "activity": "", "evidence": [ { "id": "Q8VCV1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VCV1" } ] } ] }, { "uniprot_ac": "Q8VEB4", "gene_name": "Pla2g15", "activity": [ { "ec_number": "3.1.1.32", "activity": "a 1,2-diacyl-sn-glycero-3-phosphocholine + H2O = a 2-acyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q8VEB4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VEB4" } ] }, { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q8VEB4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VEB4" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q8VEB4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VEB4" } ] }, { "ec_number": "3.1.1.5", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine.", "evidence": [ { "id": "Q8VEB4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VEB4" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "Q8VEB4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VEB4" } ] }, { "ec_number": "3.1.1.5", "activity": "", "evidence": [ { "id": "Q8VEB4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VEB4" } ] }, { "ec_number": "3.1.1.32", "activity": "", "evidence": [ { "id": "Q8VEB4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VEB4" } ] } ] }, { "uniprot_ac": "Q96GS6", "gene_name": "ABHD17A", "activity": [ { "ec_number": "3.1.2.22", "activity": "H2O + S-hexadecanoyl-L-cysteinyl-[protein] = H(+) + hexadecanoate + L-cysteinyl-[protein].", "evidence": [ { "id": "Q96GS6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96GS6" } ] }, { "ec_number": "3.1.2.22", "activity": "", "evidence": [ { "id": "Q96GS6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96GS6" } ] } ] }, { "uniprot_ac": "Q99JW1", "gene_name": "Abhd17a", "activity": [ { "ec_number": "3.1.2.22", "activity": "H2O + S-hexadecanoyl-L-cysteinyl-[protein] = H(+) + hexadecanoate + L-cysteinyl-[protein].", "evidence": [ { "id": "Q99JW1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99JW1" } ] }, { "ec_number": "3.1.2.22", "activity": "", "evidence": [ { "id": "Q99JW1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99JW1" } ] } ] }, { "uniprot_ac": "Q99LY2", "gene_name": "Gdpd3", "activity": [ { "ec_number": "3.1.4.-", "activity": "", "evidence": [ { "id": "Q99LY2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99LY2" } ] } ] }, { "uniprot_ac": "Q9NP80", "gene_name": "PNPLA8", "activity": [ { "ec_number": "3.1.1.-", "activity": "", "evidence": [ { "id": "Q9NP80", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NP80" } ] }, { "ec_number": "3.1.1.5", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine.", "evidence": [ { "id": "Q9NP80", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NP80" } ] }, { "ec_number": "3.1.1.5", "activity": "", "evidence": [ { "id": "Q9NP80", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NP80" } ] } ] }, { "uniprot_ac": "Q9NUJ1", "gene_name": "ABHD10", "activity": [ { "ec_number": "3.1.2.22", "activity": "H2O + S-hexadecanoyl-L-cysteinyl-[protein] = H(+) + hexadecanoate + L-cysteinyl-[protein].", "evidence": [ { "id": "Q9NUJ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NUJ1" } ] }, { "ec_number": "3.1.1.93", "activity": "H2O + mycophenolic acid O-acyl-beta-D-glucuronide = D-glucuronate + H(+) + mycophenolate.", "evidence": [ { "id": "Q9NUJ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NUJ1" } ] }, { "ec_number": "3.1.2.22", "activity": "", "evidence": [ { "id": "Q9NUJ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NUJ1" } ] } ] }, { "uniprot_ac": "Q9QYL8", "gene_name": "Lypla2", "activity": [ { "ec_number": "3.1.2.22", "activity": "H2O + S-hexadecanoyl-L-cysteinyl-[protein] = H(+) + hexadecanoate + L-cysteinyl-[protein].", "evidence": [ { "id": "Q9QYL8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QYL8" } ] }, { "ec_number": "3.1.2.22", "activity": "", "evidence": [ { "id": "Q9QYL8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QYL8" } ] }, { "ec_number": "3.1.2.-", "activity": "", "evidence": [ { "id": "Q9QYL8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QYL8" } ] } ] }, { "uniprot_ac": "Q9UP65", "gene_name": "PLA2G4C", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q9UP65", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UP65" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q9UP65", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UP65" } ] }, { "ec_number": "3.1.1.5", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine.", "evidence": [ { "id": "Q9UP65", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UP65" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "Q9UP65", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UP65" } ] } ] }, { "uniprot_ac": "Q9VMM8", "gene_name": "Dmel\\CG11029", "activity": [ { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q9VMM8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VMM8" } ] }, { "ec_number": "3.1.1.3", "activity": "a triacylglycerol + H2O = a diacylglycerol + a fatty acid + H(+).", "evidence": [ { "id": "Q9VMM8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VMM8" } ] }, { "ec_number": "3.1.1.5", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a fatty acid + H(+) + sn-glycerol 3-phosphocholine.", "evidence": [ { "id": "Q9VMM8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VMM8" } ] }, { "ec_number": "3.1.1.3", "activity": "", "evidence": [ { "id": "Q9VMM8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VMM8" } ] }, { "ec_number": "3.1.1.4", "activity": "", "evidence": [ { "id": "Q9VMM8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VMM8" } ] }, { "ec_number": "3.1.1.5", "activity": "", "evidence": [ { "id": "Q9VMM8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VMM8" } ] } ] }, { "uniprot_ac": "Q9W3C7", "gene_name": "Ppt1", "activity": [ { "ec_number": "3.1.2.22", "activity": "H2O + S-hexadecanoyl-L-cysteinyl-[protein] = H(+) + hexadecanoate + L-cysteinyl-[protein].", "evidence": [ { "id": "Q9W3C7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W3C7" } ] }, { "ec_number": "3.1.2.22", "activity": "", "evidence": [ { "id": "Q9W3C7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W3C7" } ] } ] }, { "uniprot_ac": "Q9WTL7", "gene_name": "Lypla2", "activity": [ { "ec_number": "3.1.2.22", "activity": "H2O + S-hexadecanoyl-L-cysteinyl-[protein] = H(+) + hexadecanoate + L-cysteinyl-[protein].", "evidence": [ { "id": "Q9WTL7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WTL7" } ] }, { "ec_number": "3.1.2.-", "activity": "", "evidence": [ { "id": "Q9WTL7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WTL7" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [ 209, 210 ], "sequon_annotation_sites": [ { "start_pos": 197, "end_pos": 199 }, { "start_pos": 5, "end_pos": 7 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 112 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }