{ "uniprot_canonical_ac": "O75503-1", "uniprot_ac": "O75503", "uniprot_id": "CLN5_HUMAN", "mass": { "chemical_mass": 41497.0, "monoisotopic_mass": 41497.0 }, "refseq": { "ac": "NP_006484", "name": "ceroid-lipofuscinosis neuronal protein 5 isoform 1", "summary": "This gene is one of eight which have been associated with neuronal ceroid lipofuscinoses (NCL). Also referred to as Batten disease, NCL comprises a class of autosomal recessive, neurodegenerative disorders affecting children. The genes responsible likely encode proteins involved in the degradation of post-translationally modified proteins in lysosomes. The primary defect in NCL disorders is thought to be associated with lysosomal storage function.[provided by RefSeq, Oct 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006484" }, "gene_names": [ { "name": "CLN5", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O75503", "id": "O75503" }, { "name": "CLN5", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006484", "id": "NP_006484" } ], "protein_names": [ { "name": "Ceroid-lipofuscinosis neuronal protein 5", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O75503" }, { "name": "Protein CLN5", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O75503" }, { "name": "ceroid-lipofuscinosis neuronal protein 5 isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006484", "id": "NP_006484" }, { "name": "ceroid-lipofuscinosis neuronal protein 5; ceroid-lipofuscinosis, neuronal 5", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006484", "id": "NP_006484" } ], "function": [ { "annotation": "Cln5 represents a new type of cysteine-based S-depalmitoylase linked to neurodegeneration.", "evidence": [ { "database": "RefSeq", "id": "NP_006484", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006484" }, { "database": "PubMed", "id": "35427157", "url": "https://glygen.org/publication/PubMed/35427157" } ] }, { "annotation": "Deficiency of the Lysosomal Protein CLN5 Alters Lysosomal Function and Movement. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_006484", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006484" }, { "database": "PubMed", "id": "34680045", "url": "https://glygen.org/publication/PubMed/34680045" } ] }, { "annotation": "Lysosomal dysfunction, autophagic defects, and CLN5 accumulation underlie the pathogenesis of KCTD7-mutated neuronal ceroid lipofuscinoses.", "evidence": [ { "database": "RefSeq", "id": "NP_006484", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006484" }, { "database": "PubMed", "id": "36368077", "url": "https://glygen.org/publication/PubMed/36368077" } ] }, { "annotation": "Plays a role in influencing the retrograde trafficking of lysosomal sorting receptors SORT1 and IGF2R from the endosomes to the trans-Golgi network by controlling the recruitment of retromer complex to the endosomal membrane. Regulates the localization and activation of RAB7A which is required to recruit the retromer complex to the endosomal membrane (PubMed:22431521).", "evidence": [ { "database": "UniProtKB", "id": "O75503", "url": "https://www.uniprot.org/uniprot/O75503#function" }, { "database": "PubMed", "id": "22431521", "url": "https://glygen.org/publication/PubMed/22431521" } ] }, { "annotation": "The Batten disease gene product CLN5 is the lysosomal bis(monoacylglycero)phosphate synthase.", "evidence": [ { "database": "RefSeq", "id": "NP_006484", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006484" }, { "database": "PubMed", "id": "37708259", "url": "https://glygen.org/publication/PubMed/37708259" } ] }, { "annotation": "This gene is one of eight which have been associated with neuronal ceroid lipofuscinoses (NCL). Also referred to as Batten disease, NCL comprises a class of autosomal recessive, neurodegenerative disorders affecting children. The genes responsible likely encode proteins involved in the degradation of post-translationally modified proteins in lysosomes. The primary defect in NCL disorders is thought to be associated with lysosomal storage function.[provided by RefSeq, Oct 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_006484", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006484" } ] } ], "disease": [ { "disease_id": "DOID:0110728", "recommended_name": { "id": "DOID:0110728", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110728", "name": "neuronal ceroid lipofuscinosis 5", "description": "A neuronal ceroid lipofuscinosis that is characterized by lipopigment patterns with mixed combinations of 'granular,' 'curvilinear,' and 'fingerprint' profiles, progressive dementia, seizures, and progressive visual failure and has_material_basis_in homozygous or compound heterozygous mutation in the CLN5 gene on chromosome 13q22." }, "synonyms": [ { "id": "DOID:0110728", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110728", "name": "CLN5", "description": "" }, { "id": "DOID:0110728", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110728", "name": "neuronal ceroid lipofuscinosis 5 variable age of onset", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "neuronal ceroid lipofuscinosis 5", "description": "Neuronal ceroid lipofuscinosis 5 (CLN5-NCL) is a rare condition that affects the nervous system. Signs and symptoms of the condition generally develop between ages 4.5 and 7 years, although later onset cases have been reported. Affected people may experience loss of muscle coordination (ataxia), seizures that do not respond to medications, muscle twitches (myoclonus), visual impairment, and cognitive/motor decline. It occurs predominantly in the Finnish population. CLN5-NCL is caused by changes (mutations) in the CLN5 gene and is inherited in an autosomal recessive manner. Treatment options are limited to therapies that can help relieve some of the symptoms." }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "CLN5", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "CLN5 neuronal ceroid lipofuscinosis", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "ceroid lipofuscinosis, neuronal, type 5", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "neuronal ceroid lipofuscinosis 5 variable age of onset", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "neuronal ceroid lipofuscinosis caused by mutation in CLN5", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "neuronal ceroid lipofuscinosis type 5", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "CLN5 disease", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "CLN5 disease, adult", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "CLN5 disease, juvenile", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "CLN5 disease, late infantile (subtype)", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "Finnish Vlincl", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "ceroid lipofuscinosis, neuronal, 5", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "ceroid lipofuscinosis, neuronal, 5, variable Age at onset", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "neuronal ceroid lipofuscinosis Finnish variant", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "neuronal ceroid lipofuscinosis, late infantile, Finnish variant", "description": "" }, { "id": "MIM:256731", "resource": "MIM", "url": "https://www.omim.org/entry/256731", "name": "Ceroid lipofuscinosis, neuronal, 5", "description": "Ceroid lipofuscinosis, neuronal, 5" } ], "evidence": [ { "id": "256731", "database": "MIM", "url": "https://www.omim.org/entry/256731" } ] } ], "snv": [ { "evidence": [ { "id": "rs1305273453", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1305273453" }, { "id": "rs1305273453", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1305273453#frequency_tab" }, { "id": "rs1305273453", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1305273453" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 132, "end_pos": 132, "sequence_org": "T", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->NYK).", "chr_id": "13", "chr_pos": "76995957", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T132", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1203597595", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1203597595" }, { "id": "rs1203597595", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1203597595" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 132, "end_pos": 132, "sequence_org": "T", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->NYP).", "chr_id": "13", "chr_pos": "76996118", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T132", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs386833975", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs386833975" }, { "id": "rs386833975", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs386833975" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 143, "end_pos": 143, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->SCT).", "chr_id": "13", "chr_pos": "76995990", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N143", "disease": [ { "disease_id": "DOID:0110728", "recommended_name": { "id": "DOID:0110728", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110728", "name": "neuronal ceroid lipofuscinosis 5", "description": "A neuronal ceroid lipofuscinosis that is characterized by lipopigment patterns with mixed combinations of 'granular,' 'curvilinear,' and 'fingerprint' profiles, progressive dementia, seizures, and progressive visual failure and has_material_basis_in homozygous or compound heterozygous mutation in the CLN5 gene on chromosome 13q22." }, "synonyms": [ { "id": "DOID:0110728", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110728", "name": "CLN5", "description": "" }, { "id": "DOID:0110728", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110728", "name": "neuronal ceroid lipofuscinosis 5 variable age of onset", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "neuronal ceroid lipofuscinosis 5", "description": "Neuronal ceroid lipofuscinosis 5 (CLN5-NCL) is a rare condition that affects the nervous system. Signs and symptoms of the condition generally develop between ages 4.5 and 7 years, although later onset cases have been reported. Affected people may experience loss of muscle coordination (ataxia), seizures that do not respond to medications, muscle twitches (myoclonus), visual impairment, and cognitive/motor decline. It occurs predominantly in the Finnish population. CLN5-NCL is caused by changes (mutations) in the CLN5 gene and is inherited in an autosomal recessive manner. Treatment options are limited to therapies that can help relieve some of the symptoms." }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "CLN5", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "CLN5 neuronal ceroid lipofuscinosis", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "ceroid lipofuscinosis, neuronal, type 5", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "neuronal ceroid lipofuscinosis 5 variable age of onset", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "neuronal ceroid lipofuscinosis caused by mutation in CLN5", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "neuronal ceroid lipofuscinosis type 5", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "CLN5 disease", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "CLN5 disease, adult", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "CLN5 disease, juvenile", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "CLN5 disease, late infantile (subtype)", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "Finnish Vlincl", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "ceroid lipofuscinosis, neuronal, 5", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "ceroid lipofuscinosis, neuronal, 5, variable Age at onset", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "neuronal ceroid lipofuscinosis Finnish variant", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "neuronal ceroid lipofuscinosis, late infantile, Finnish variant", "description": "" }, { "id": "MIM:256731", "resource": "MIM", "url": "https://www.omim.org/entry/256731", "name": "Ceroid lipofuscinosis, neuronal, 5", "description": "Ceroid lipofuscinosis, neuronal, 5" } ] } ], "keywords": [ "ebi", "germline", "disease" ] }, { "evidence": [ { "id": "rs1300275242", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1300275242" }, { "id": "rs1300275242", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1300275242" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 145, "end_pos": 145, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->NCA).", "chr_id": "13", "chr_pos": "76995995", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T145", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs113944597", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs113944597" }, { "id": "rs113944597", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs113944597" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 145, "end_pos": 145, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->NCI).", "chr_id": "13", "chr_pos": "76995996", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T145", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs759460716", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs759460716" }, { "id": "rs759460716", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs759460716" }, { "id": "rs759460716", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs759460716" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 178, "end_pos": 178, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->HGT).", "chr_id": "13", "chr_pos": "76996094", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N178", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs759460716", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs759460716" }, { "id": "rs759460716", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs759460716" }, { "id": "rs759460716", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs759460716" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 178, "end_pos": 178, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->YGT).", "chr_id": "13", "chr_pos": "76996094", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N178", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs28940280", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs28940280" }, { "id": "rs28940280", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs28940280" }, { "id": "rs28940280", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs28940280#frequency_tab" }, { "id": "rs28940280", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs28940280" }, { "id": "9662406", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/9662406" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 230, "end_pos": 230, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DCS->NCS).", "chr_id": "13", "chr_pos": "77000580", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D230", "disease": [ { "disease_id": "DOID:0110728", "recommended_name": { "id": "DOID:0110728", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110728", "name": "neuronal ceroid lipofuscinosis 5", "description": "A neuronal ceroid lipofuscinosis that is characterized by lipopigment patterns with mixed combinations of 'granular,' 'curvilinear,' and 'fingerprint' profiles, progressive dementia, seizures, and progressive visual failure and has_material_basis_in homozygous or compound heterozygous mutation in the CLN5 gene on chromosome 13q22." }, "synonyms": [ { "id": "DOID:0110728", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110728", "name": "CLN5", "description": "" }, { "id": "DOID:0110728", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110728", "name": "neuronal ceroid lipofuscinosis 5 variable age of onset", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "neuronal ceroid lipofuscinosis 5", "description": "Neuronal ceroid lipofuscinosis 5 (CLN5-NCL) is a rare condition that affects the nervous system. Signs and symptoms of the condition generally develop between ages 4.5 and 7 years, although later onset cases have been reported. Affected people may experience loss of muscle coordination (ataxia), seizures that do not respond to medications, muscle twitches (myoclonus), visual impairment, and cognitive/motor decline. It occurs predominantly in the Finnish population. CLN5-NCL is caused by changes (mutations) in the CLN5 gene and is inherited in an autosomal recessive manner. Treatment options are limited to therapies that can help relieve some of the symptoms." }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "CLN5", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "CLN5 neuronal ceroid lipofuscinosis", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "ceroid lipofuscinosis, neuronal, type 5", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "neuronal ceroid lipofuscinosis 5 variable age of onset", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "neuronal ceroid lipofuscinosis caused by mutation in CLN5", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "neuronal ceroid lipofuscinosis type 5", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "CLN5 disease", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "CLN5 disease, adult", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "CLN5 disease, juvenile", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "CLN5 disease, late infantile (subtype)", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "Finnish Vlincl", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "ceroid lipofuscinosis, neuronal, 5", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "ceroid lipofuscinosis, neuronal, 5, variable Age at onset", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "neuronal ceroid lipofuscinosis Finnish variant", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "neuronal ceroid lipofuscinosis, late infantile, Finnish variant", "description": "" }, { "id": "MIM:256731", "resource": "MIM", "url": "https://www.omim.org/entry/256731", "name": "Ceroid lipofuscinosis, neuronal, 5", "description": "Ceroid lipofuscinosis, neuronal, 5" } ] } ], "keywords": [ "ebi", "germline", "disease" ] }, { "evidence": [ { "id": "rs1566221492", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1566221492" }, { "id": "rs1566221492", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1566221492" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 255, "end_pos": 255, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->KYT).", "chr_id": "13", "chr_pos": "77000657", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N255", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs929479143", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs929479143" }, { "id": "rs929479143", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs929479143#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 255, "end_pos": 255, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYT->TYT).", "chr_id": "13", "chr_pos": "77000656", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N255", "keywords": [ "ebi", "germline", "disease" ], "disease": [ { "disease_id": "DOID:0110728", "recommended_name": { "id": "DOID:0110728", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110728", "name": "neuronal ceroid lipofuscinosis 5", "description": "A neuronal ceroid lipofuscinosis that is characterized by lipopigment patterns with mixed combinations of 'granular,' 'curvilinear,' and 'fingerprint' profiles, progressive dementia, seizures, and progressive visual failure and has_material_basis_in homozygous or compound heterozygous mutation in the CLN5 gene on chromosome 13q22." }, "synonyms": [ { "id": "DOID:0110728", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110728", "name": "CLN5", "description": "" }, { "id": "DOID:0110728", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110728", "name": "neuronal ceroid lipofuscinosis 5 variable age of onset", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "neuronal ceroid lipofuscinosis 5", "description": "Neuronal ceroid lipofuscinosis 5 (CLN5-NCL) is a rare condition that affects the nervous system. Signs and symptoms of the condition generally develop between ages 4.5 and 7 years, although later onset cases have been reported. Affected people may experience loss of muscle coordination (ataxia), seizures that do not respond to medications, muscle twitches (myoclonus), visual impairment, and cognitive/motor decline. It occurs predominantly in the Finnish population. CLN5-NCL is caused by changes (mutations) in the CLN5 gene and is inherited in an autosomal recessive manner. Treatment options are limited to therapies that can help relieve some of the symptoms." }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "CLN5", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "CLN5 neuronal ceroid lipofuscinosis", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "ceroid lipofuscinosis, neuronal, type 5", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "neuronal ceroid lipofuscinosis 5 variable age of onset", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "neuronal ceroid lipofuscinosis caused by mutation in CLN5", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "neuronal ceroid lipofuscinosis type 5", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "CLN5 disease", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "CLN5 disease, adult", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "CLN5 disease, juvenile", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "CLN5 disease, late infantile (subtype)", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "Finnish Vlincl", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "ceroid lipofuscinosis, neuronal, 5", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "ceroid lipofuscinosis, neuronal, 5, variable Age at onset", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "neuronal ceroid lipofuscinosis Finnish variant", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "neuronal ceroid lipofuscinosis, late infantile, Finnish variant", "description": "" }, { "id": "MIM:256731", "resource": "MIM", "url": "https://www.omim.org/entry/256731", "name": "Ceroid lipofuscinosis, neuronal, 5", "description": "Ceroid lipofuscinosis, neuronal, 5" } ] } ] }, { "evidence": [ { "id": "rs199609750", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs199609750" }, { "id": "rs199609750", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs199609750" }, { "id": "rs199609750", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs199609750" }, { "id": "rs199609750", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs199609750#frequency_tab" }, { "id": "rs199609750", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs199609750" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 271, "end_pos": 271, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->SET).", "chr_id": "13", "chr_pos": "77000704", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "N271", "keywords": [ "ebi", "germline", "disease" ], "disease": [ { "disease_id": "DOID:0110728", "recommended_name": { "id": "DOID:0110728", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110728", "name": "neuronal ceroid lipofuscinosis 5", "description": "A neuronal ceroid lipofuscinosis that is characterized by lipopigment patterns with mixed combinations of 'granular,' 'curvilinear,' and 'fingerprint' profiles, progressive dementia, seizures, and progressive visual failure and has_material_basis_in homozygous or compound heterozygous mutation in the CLN5 gene on chromosome 13q22." }, "synonyms": [ { "id": "DOID:0110728", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110728", "name": "CLN5", "description": "" }, { "id": "DOID:0110728", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110728", "name": "neuronal ceroid lipofuscinosis 5 variable age of onset", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "neuronal ceroid lipofuscinosis 5", "description": "Neuronal ceroid lipofuscinosis 5 (CLN5-NCL) is a rare condition that affects the nervous system. Signs and symptoms of the condition generally develop between ages 4.5 and 7 years, although later onset cases have been reported. Affected people may experience loss of muscle coordination (ataxia), seizures that do not respond to medications, muscle twitches (myoclonus), visual impairment, and cognitive/motor decline. It occurs predominantly in the Finnish population. CLN5-NCL is caused by changes (mutations) in the CLN5 gene and is inherited in an autosomal recessive manner. Treatment options are limited to therapies that can help relieve some of the symptoms." }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "CLN5", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "CLN5 neuronal ceroid lipofuscinosis", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "ceroid lipofuscinosis, neuronal, type 5", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "neuronal ceroid lipofuscinosis 5 variable age of onset", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "neuronal ceroid lipofuscinosis caused by mutation in CLN5", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "neuronal ceroid lipofuscinosis type 5", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "CLN5 disease", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "CLN5 disease, adult", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "CLN5 disease, juvenile", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "CLN5 disease, late infantile (subtype)", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "Finnish Vlincl", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "ceroid lipofuscinosis, neuronal, 5", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "ceroid lipofuscinosis, neuronal, 5, variable Age at onset", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "neuronal ceroid lipofuscinosis Finnish variant", "description": "" }, { "id": "MONDO:0009745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009745", "name": "neuronal ceroid lipofuscinosis, late infantile, Finnish variant", "description": "" }, { "id": "MIM:256731", "resource": "MIM", "url": "https://www.omim.org/entry/256731", "name": "Ceroid lipofuscinosis, neuronal, 5", "description": "Ceroid lipofuscinosis, neuronal, 5" } ] } ] }, { "evidence": [ { "id": "rs2034346369", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2034346369" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 283, "end_pos": 283, "sequence_org": "T", "sequence_mut": "null", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NKT->NKnull).", "chr_id": "13", "chr_pos": "77000736_77000737", "ref_nt": "p", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T283", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [ { "start_pos": 130, "end_pos": 130, "sequence_org": "N", "sequence_mut": "Q", "comment": "Loss of glycosylation. Retained in the endoplasmic reticulum rather than reaching the lysosome.", "evidence": [ { "database": "UniProtKB", "id": "O75503", "url": "https://www.uniprot.org/uniprot/O75503" }, { "database": "PubMed", "id": "24058541", "url": "https://glygen.org/publication/PubMed/24058541" } ] }, { "start_pos": 143, "end_pos": 143, "sequence_org": "N", "sequence_mut": "Q", "comment": "Loss of glycosylation. Effectively transported to the lysosome.", "evidence": [ { "database": "UniProtKB", "id": "O75503", "url": "https://www.uniprot.org/uniprot/O75503" }, { "database": "PubMed", "id": "24058541", "url": "https://glygen.org/publication/PubMed/24058541" } ] }, { "start_pos": 178, "end_pos": 178, "sequence_org": "N", "sequence_mut": "Q", "comment": "Loss of glycosylation. Effectively transported to the lysosome.", "evidence": [ { "database": "UniProtKB", "id": "O75503", "url": "https://www.uniprot.org/uniprot/O75503" }, { "database": "PubMed", "id": "24058541", "url": "https://glygen.org/publication/PubMed/24058541" } ] }, { "start_pos": 203, "end_pos": 203, "sequence_org": "N", "sequence_mut": "Q", "comment": "Loss of glycosylation. Retained in the endoplasmic reticulum rather than reaching the lysosome.", "evidence": [ { "database": "UniProtKB", "id": "O75503", "url": "https://www.uniprot.org/uniprot/O75503" }, { "database": "PubMed", "id": "24058541", "url": "https://glygen.org/publication/PubMed/24058541" } ] }, { "start_pos": 255, "end_pos": 255, "sequence_org": "N", "sequence_mut": "Q", "comment": "Loss of glycosylation. Retained in the endoplasmic reticulum rather than reaching the lysosome.", "evidence": [ { "database": "UniProtKB", "id": "O75503", "url": "https://www.uniprot.org/uniprot/O75503" }, { "database": "PubMed", "id": "24058541", "url": "https://glygen.org/publication/PubMed/24058541" } ] }, { "start_pos": 271, "end_pos": 271, "sequence_org": "N", "sequence_mut": "Q", "comment": "Loss of glycosylation. Retained in the endoplasmic reticulum rather than reaching the lysosome.", "evidence": [ { "database": "UniProtKB", "id": "O75503", "url": "https://www.uniprot.org/uniprot/O75503" }, { "database": "PubMed", "id": "24058541", "url": "https://glygen.org/publication/PubMed/24058541" } ] }, { "start_pos": 281, "end_pos": 281, "sequence_org": "N", "sequence_mut": "Q", "comment": "Loss of glycosylation. Partially retained in the endoplasmic reticulum.", "evidence": [ { "database": "UniProtKB", "id": "O75503", "url": "https://www.uniprot.org/uniprot/O75503" }, { "database": "PubMed", "id": "24058541", "url": "https://glygen.org/publication/PubMed/24058541" } ] }, { "start_pos": 352, "end_pos": 352, "sequence_org": "N", "sequence_mut": "Q", "comment": "Loss of glycosylation. Retained in the Golgi apparatus rather than reaching the lysosome.", "evidence": [ { "database": "UniProtKB", "id": "O75503", "url": "https://www.uniprot.org/uniprot/O75503" }, { "database": "PubMed", "id": "24058541", "url": "https://glygen.org/publication/PubMed/24058541" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "87.79", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000102805", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000102805" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "81.32", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000102805", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000102805" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "82.35", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000102805", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000102805" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "59.34", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000102805", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000102805" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "93.3", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000102805", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000102805" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "90.31", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000102805", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000102805" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "70.3", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000102805", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000102805" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "86.07", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000102805", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000102805" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "95.74", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000102805", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000102805" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "68.87", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000102805", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000102805" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "84.73", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000102805", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000102805" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "87.1", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000102805", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000102805" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "89.36", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000102805", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000102805" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O75503", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75503" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O75503", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75503" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O75503", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75503" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O75503", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75503" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O75503", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75503" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O75503", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75503" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O75503", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75503" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O75503", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75503" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O75503", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75503" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O75503", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75503" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O75503", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75503" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O75503", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75503" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75503", "url": "https://www.uniprot.org/uniprot/O75503" } ], "common_name": "Human" } ], "gene": [ { "name": "CLN5", "url": "https://www.uniprot.org/uniprot/O75503", "locus": { "chromosome": "13", "start_pos": 15594, "end_pos": 5001, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "LRG_692", "url": "https://www.ensembl.org/id/LRG_692" } ] } } ], "crossref": [ { "id": "ENSG00000102805", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000102805", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "CLN5", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=CLN5", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "1203", "url": "https://www.ncbi.nlm.nih.gov/gene/1203", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "1108", "url": "https://glyconnect.expasy.org/browser/proteins/1108", "database": "GlyConnect", "categories": [ "Glycoproteomics", "Glycan" ] }, { "id": "2076", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=2076", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O75503", "url": "https://www.ebi.ac.uk/intact/interactors/id:O75503*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR026138", "url": "https://www.ebi.ac.uk/interpro/entry/IPR026138", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:1203", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:1203", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "256731", "url": "http://www.omim.org/entry/256731", "database": "MIM", "categories": [ "Other" ] }, { "id": "608102", "url": "http://www.omim.org/entry/608102", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O75503", "url": "https://www.nextprot.org/entry/NX_O75503", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "O75503", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75503", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "FRPHQSF", "url": "https://omabrowser.org/oma/group/FRPHQSF/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2938611at2759", "url": "http://www.orthodb.org/?query=2938611at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR15380", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15380", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR15380:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15380:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF15014", "url": "http://pfam.xfam.org/family/PF15014", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O75503", "url": "https://pharos.nih.gov/targets/O75503", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR:000050839", "url": "https://proconsortium.org/app/entry/PR:000050839", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR_O75503", "url": "http://purl.obolibrary.org/obo/PR_O75503", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_006484", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006484", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "O75503", "url": "DISABLED", "database": "UniCarbKB", "categories": [ "Glycoproteomics" ] }, { "id": "A0A087WZY0", "url": "https://www.uniprot.org/uniprot/A0A087WZY0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A087WZY0-1", "url": "https://www.uniprot.org/uniprot/A0A087WZY0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1B0GTR6", "url": "https://www.uniprot.org/uniprot/A0A1B0GTR6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1B0GTR6-1", "url": "https://www.uniprot.org/uniprot/A0A1B0GTR6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1B0GTV7", "url": "https://www.uniprot.org/uniprot/A0A1B0GTV7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1B0GTV7-1", "url": "https://www.uniprot.org/uniprot/A0A1B0GTV7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1B0GU14", "url": "https://www.uniprot.org/uniprot/A0A1B0GU14", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1B0GU14-1", "url": "https://www.uniprot.org/uniprot/A0A1B0GU14-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1B0GUE8", "url": "https://www.uniprot.org/uniprot/A0A1B0GUE8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1B0GUE8-1", "url": "https://www.uniprot.org/uniprot/A0A1B0GUE8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1B0GV94", "url": "https://www.uniprot.org/uniprot/A0A1B0GV94", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1B0GV94-1", "url": "https://www.uniprot.org/uniprot/A0A1B0GV94-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1B0GVL0", "url": "https://www.uniprot.org/uniprot/A0A1B0GVL0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1B0GVL0-1", "url": "https://www.uniprot.org/uniprot/A0A1B0GVL0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1B0GWI2", "url": "https://www.uniprot.org/uniprot/A0A1B0GWI2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1B0GWI2-1", "url": "https://www.uniprot.org/uniprot/A0A1B0GWI2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1C7CYZ2", "url": "https://www.uniprot.org/uniprot/A0A1C7CYZ2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1C7CYZ2-1", "url": "https://www.uniprot.org/uniprot/A0A1C7CYZ2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O75503", "url": "https://www.uniprot.org/uniprot/O75503", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O75503-1", "url": "https://www.uniprot.org/uniprot/O75503-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAQEVDTAQGAEMRRGAGAARGRASWCWALALLWLAVVPGWSRVSGIPSRRHWPVPYKRFDFRPKPDPYCQAKYTFCPTGSPIPVMEGDDDIEVFRLQAPVWEFKYGDLLGHLKIMHDAIGFRSTLTGKNYTMEWYELFQLGNCTFPHLRPEMDAPFWCNQGAACFFEGIDDVHWKENGTLVQVATISGNMFNQMAKWVKQDNETGIYYETWNVKASPEKGAETWFDSYDCSKFVLRTFNKLAEFGAEFKNIETNYTRIFLYSGEPTYLGNETSVFGPTGNKTLGLAIKRFYYPFKPHLPTKEFLLSLLQIFDAVIVHKQFYLFYNFEYWFLPMKFPFIKITYEEIPLPIRNKTLSGL", "length": 358, "header": "sp|O75503-1|CLN5_HUMAN Isoform 1 of Ceroid-lipofuscinosis neuronal protein 5 OS=Homo sapiens OX=9606 GN=CLN5 PE=1 SV=2 CANONICAL=O75503-1" }, "isoforms": [ { "isoform_ac": "A0A087WZY0-1", "url": "", "sequence": { "sequence": "MAQEVDTAQGAEMRRGAGAARGRASWCWALALLWLAVVPGWSRVSGIPSRRHWPVPYKRFDFRPKPDPYCQAKYTFCPTGSPIPVMEGDDDIEVFRLQAPVWEFKYGDLLGHLKIMHDAIGFRSTLTGKNYTMEWYELFQLGNCTFPHLRPEMDAPFWCNQGAACFFEGIDDVHWKENGTLVQVATISGKL", "length": 191, "header": "tr|A0A087WZY0-1|CLN5_HUMAN Computationally mapped isoform of Ceroid-lipofuscinosis neuronal protein 5 OS=Homo sapiens OX=9606 GN=CLN5 PE=1 SV=3 CANONICAL=O75503-1" }, "locus": { "chromosome": "13", "start_pos": 76996135, "end_pos": 76992099, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000485938.4", "url": "https://www.ensembl.org/id/ENST00000485938.4" }, { "database": "Ensembl Peptide", "id": "ENSP00000482959.3", "url": "https://www.ensembl.org/id/ENSP00000482959.3" } ] } }, { "isoform_ac": "A0A1B0GTR6-1", "url": "", "sequence": { "sequence": "MAQEVDTAQGAEMRRGAGAARGRASWCWALALLWLAVVPGWSRVSGIPSRRHWPVPYKRFDFRPKPDPYCQAKYTFCPTGSPIPVMEGDDDIEVFRLQAPVWEFKYGDLLGHLKIMHDAIGFRSTLTGKNYTMEWYELFQLGNCTFPHLRPEMDAPFWCNQGAACFFEGIDDVHWKENGTLVQVATISDGETEAQRG", "length": 197, "header": "tr|A0A1B0GTR6-1|CLN5_HUMAN Computationally mapped isoform of Ceroid-lipofuscinosis neuronal protein 5 OS=Homo sapiens OX=9606 GN=CLN5 PE=1 SV=2 CANONICAL=O75503-1" }, "locus": { "chromosome": "13", "start_pos": 76998068, "end_pos": 76992099, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000637537.2", "url": "https://www.ensembl.org/id/ENST00000637537.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000489711.2", "url": "https://www.ensembl.org/id/ENSP00000489711.2" } ] } }, { "isoform_ac": "A0A1B0GTV7-1", "url": "", "sequence": { "sequence": "MAQEVDTAQGAEMRRGAGAARGRASWCWALALLWLAVVPGWSRVSGIPSRRHWPVPYKRFDFRPKPDPYCQAKYTFCPTGSPIPVMEGDDDIEVFRLQAPVWEFKYGDLLGHLKIMHDAIGFRSTLTGKNYTMEWYELFQLGNCTFPHLRPEMDAPFWCNQGAACFFEGIDDVHWKENGTLVQVATISGFHHVGQDSIELRTSSDPPILASQSAGITDVSHCTRPTIRILPQRGTLYYLRWVLLCCPG", "length": 248, "header": "tr|A0A1B0GTV7-1|CLN5_HUMAN Computationally mapped isoform of Ceroid-lipofuscinosis neuronal protein 5 OS=Homo sapiens OX=9606 GN=CLN5 PE=1 SV=2 CANONICAL=O75503-1" }, "locus": { "chromosome": "13", "start_pos": 77016743, "end_pos": 76992099, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000636767.2", "url": "https://www.ensembl.org/id/ENST00000636767.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000489855.2", "url": "https://www.ensembl.org/id/ENSP00000489855.2" } ] } }, { "isoform_ac": "A0A1B0GU14-1", "url": "", "sequence": { "sequence": "MEGDDDIEVFRLQAPVWEFKYGDLLGHLLLYLAPGR", "length": 36, "header": "tr|A0A1B0GU14-1|CLN5_HUMAN Computationally mapped isoform of Ceroid-lipofuscinosis neuronal protein 5 OS=Homo sapiens OX=9606 GN=CLN5 PE=1 SV=1 CANONICAL=O75503-1" }, "locus": { "chromosome": "13", "start_pos": 76995480, "end_pos": 76995145, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000636681.1", "url": "https://www.ensembl.org/id/ENST00000636681.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000489922.1", "url": "https://www.ensembl.org/id/ENSP00000489922.1" } ] } }, { "isoform_ac": "A0A1B0GUE8-1", "url": "", "sequence": { "sequence": "MAQEVDTAQGAEMRRGAGAARGRASWCWALALLWLAVVPGWSRVSGIPSRRHWPVPYKRFDFRPKPDPYCQAKYTFCPTGSPIPVMEGDDDIEVFRLQAPVWEFKYGDLLGHLKIMHDAIGFRSTLTGKNYTMEWYELFQLGNCTFPHLRPEMDAPFWCNQGAACFFEGIDDVHWKENGTLVQVATISGFHHVGQDSIELRTSSDPPILASQSAGITDVSHCTRPTIRILPQRGTLYYLLWTKTFLLCSLQFSWDFQNIATPYFNLLPKP", "length": 270, "header": "tr|A0A1B0GUE8-1|CLN5_HUMAN Computationally mapped isoform of Ceroid-lipofuscinosis neuronal protein 5 OS=Homo sapiens OX=9606 GN=CLN5 PE=1 SV=2 CANONICAL=O75503-1" }, "locus": { "chromosome": "13", "start_pos": 77017142, "end_pos": 76992099, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000636525.2", "url": "https://www.ensembl.org/id/ENST00000636525.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000490078.2", "url": "https://www.ensembl.org/id/ENSP00000490078.2" } ] } }, { "isoform_ac": "A0A1B0GV94-1", "url": "", "sequence": { "sequence": "MAQEVDTAQGAEMRRGAGAARGRASWCWALALLWLAVVPGWSRVSGIPSRRHWPVPYKRFDFRPKPDPYCQAKYTFCPTGSPIPVMEGDDDIEVFRLQAPVWEFKYGDLLGHLKIMHDAIGFRSTLTGKNYTMEWYELFQLGNCTFPHLRPEMDAPFWCNQGAACFFEGIDDVHWKENGTLVQVATISGFHHVGQDSIELRTSSDPPILASQSAGITDVSHCTRPTIRILPQRGTLYYLSLALLPGWSTVVRPRLTATSASRIQTIFLPQPPK", "length": 273, "header": "tr|A0A1B0GV94-1|CLN5_HUMAN Computationally mapped isoform of Ceroid-lipofuscinosis neuronal protein 5 OS=Homo sapiens OX=9606 GN=CLN5 PE=1 SV=2 CANONICAL=O75503-1" }, "locus": { "chromosome": "13", "start_pos": 77012902, "end_pos": 76992099, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000637397.2", "url": "https://www.ensembl.org/id/ENST00000637397.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000490422.2", "url": "https://www.ensembl.org/id/ENSP00000490422.2" } ] } }, { "isoform_ac": "A0A1B0GVL0-1", "url": "", "sequence": { "sequence": "XGRASWCWALALLWLAVVPGWSRVSGIPSRRHWPVPYKRFDFRPKPDPYCQAKYTFCPTGSPIPVMEGDDDIEVFRLQAPVWEFKYGDLLGHLVTWTHGCVTVAFIHVLSLHRKLCMMPLDSEVH", "length": 125, "header": "tr|A0A1B0GVL0-1|CLN5_HUMAN Computationally mapped isoform of Ceroid-lipofuscinosis neuronal protein 5 OS=Homo sapiens OX=9606 GN=CLN5 PE=1 SV=1 CANONICAL=O75503-1" }, "locus": { "chromosome": "13", "start_pos": 76995939, "end_pos": 76992160, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000635915.1", "url": "https://www.ensembl.org/id/ENST00000635915.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000490560.1", "url": "https://www.ensembl.org/id/ENSP00000490560.1" } ] } }, { "isoform_ac": "A0A1B0GWI2-1", "url": "", "sequence": { "sequence": "XGYKRFDFRPKPDPYCQAKYTFCPTGSPIPVMEGDDDIEVFRLQAPVWEFKYGDLLGHLKIMHDAIGFRSTLTGKNYTMEWYELFQLGNCTFPHLRPEMDAPFWCNQGAACFFEGIDDVHWKENGTLVQVATISGNMFNQMAKWVKQDNETGIYYETWNVKASPEKGAETWFDSYDCSKFVLRTFNKLAEFGAEFKNIETNYTRIFLYSGEPTYLGNETSVFGPTGNKTLGLAIKRFYYPFKPHLPTKEFLLSLLQIFDAVIVHKQFYLFYNFEYWFLPMKFPFIKITYEEIPLPIRNKTLSGL", "length": 304, "header": "tr|A0A1B0GWI2-1|A0A1B0GWI2_HUMAN Computationally mapped isoform of CLN5 intracellular trafficking protein OS=Homo sapiens OX=9606 GN=CLN5 PE=1 SV=1 CANONICAL=O75503-1" }, "locus": { "chromosome": "13", "start_pos": 77000968, "end_pos": 76992573, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000636705.1", "url": "https://www.ensembl.org/id/ENST00000636705.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000490937.1", "url": "https://www.ensembl.org/id/ENSP00000490937.1" } ] } }, { "isoform_ac": "A0A1C7CYZ2-1", "url": "", "sequence": { "sequence": "MAQEVDTAQGAEMRRGAGAARGRASWCWALALLWLAVVPGWSRVSGIPSRRHWPVPYKRFDFRPKPDPYCQAKYTFCPTGSPIPVMEGDDDIEVFRLQAPVWEFKYGDLLGHLKIMHDAIGFRSTLTGKNYTMEWYELFQLGNCTFPHLRPEMDAPFWCNQGAACFFEGIDDVHWKENGTLVQVATISEISCALKNGIKLAELGFLL", "length": 207, "header": "tr|A0A1C7CYZ2-1|CLN5_HUMAN Computationally mapped isoform of Ceroid-lipofuscinosis neuronal protein 5 OS=Homo sapiens OX=9606 GN=CLN5 PE=1 SV=2 CANONICAL=O75503-1" }, "locus": { "chromosome": "13", "start_pos": 76999985, "end_pos": 76992099, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000616833.6", "url": "https://www.ensembl.org/id/ENST00000616833.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000479547.3", "url": "https://www.ensembl.org/id/ENSP00000479547.3" } ] } }, { "isoform_ac": "O75503-1", "url": "", "sequence": { "sequence": "MAQEVDTAQGAEMRRGAGAARGRASWCWALALLWLAVVPGWSRVSGIPSRRHWPVPYKRFDFRPKPDPYCQAKYTFCPTGSPIPVMEGDDDIEVFRLQAPVWEFKYGDLLGHLKIMHDAIGFRSTLTGKNYTMEWYELFQLGNCTFPHLRPEMDAPFWCNQGAACFFEGIDDVHWKENGTLVQVATISGNMFNQMAKWVKQDNETGIYYETWNVKASPEKGAETWFDSYDCSKFVLRTFNKLAEFGAEFKNIETNYTRIFLYSGEPTYLGNETSVFGPTGNKTLGLAIKRFYYPFKPHLPTKEFLLSLLQIFDAVIVHKQFYLFYNFEYWFLPMKFPFIKITYEEIPLPIRNKTLSGL", "length": 358, "header": "sp|O75503-1|CLN5_HUMAN Isoform 1 of Ceroid-lipofuscinosis neuronal protein 5 OS=Homo sapiens OX=9606 GN=CLN5 PE=1 SV=2 CANONICAL=O75503-1" }, "locus": { "chromosome": "13", "start_pos": 77000966, "end_pos": 76992099, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000377453.9", "url": "https://www.ensembl.org/id/ENST00000377453.9" }, { "database": "Ensembl Peptide", "id": "ENSP00000366673.5", "url": "https://www.ensembl.org/id/ENSP00000366673.5" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 130, "start_aa": "Asn", "end_pos": 130, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn130", "evidence": [ { "id": "O75503", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75503#ptm_processing" }, { "id": "24058541", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24058541" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 143, "start_aa": "Asn", "end_pos": 143, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn143", "evidence": [ { "id": "O75503", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75503#ptm_processing" }, { "id": "24058541", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24058541" } ] }, { "glytoucan_ac": "G05724UK", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 178, "start_aa": "Asn", "end_pos": 178, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn178", "evidence": [ { "id": "1108", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1108" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 178, "start_aa": "Asn", "end_pos": 178, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn178", "evidence": [ { "id": "O75503", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75503#ptm_processing" }, { "id": "24058541", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24058541" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "G20210JR", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 203, "start_aa": "Asn", "end_pos": 203, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn203", "evidence": [ { "id": "1108", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1108" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G50372IH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 203, "start_aa": "Asn", "end_pos": 203, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn203", "evidence": [ { "id": "O75503", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G64527OM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 203, "start_aa": "Asn", "end_pos": 203, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn203", "evidence": [ { "id": "1108", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1108" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G70101JE", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 203, "start_aa": "Asn", "end_pos": 203, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn203", "evidence": [ { "id": "1108", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1108" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 203, "start_aa": "Asn", "end_pos": 203, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn203", "evidence": [ { "id": "O75503", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "O75503", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75503#ptm_processing" }, { "id": "24058541", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24058541" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 255, "start_aa": "Asn", "end_pos": 255, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn255", "evidence": [ { "id": "1108", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1108" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G14669DU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 255, "start_aa": "Asn", "end_pos": 255, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn255", "evidence": [ { "id": "1108", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1108" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G23294PN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 255, "start_aa": "Asn", "end_pos": 255, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn255", "evidence": [ { "id": "1108", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1108" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 255, "start_aa": "Asn", "end_pos": 255, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn255", "evidence": [ { "id": "1108", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1108" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 255, "start_aa": "Asn", "end_pos": 255, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn255", "evidence": [ { "id": "1108", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1108" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G72291OX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 255, "start_aa": "Asn", "end_pos": 255, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn255", "evidence": [ { "id": "1108", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1108" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G75983OB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 255, "start_aa": "Asn", "end_pos": 255, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn255", "evidence": [ { "id": "1108", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1108" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G82463GQ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 255, "start_aa": "Asn", "end_pos": 255, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn255", "evidence": [ { "id": "1108", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1108" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 255, "start_aa": "Asn", "end_pos": 255, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn255", "evidence": [ { "id": "O75503", "database": "UniCarbKB", "url": "" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "O75503", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75503#ptm_processing" }, { "id": "24058541", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24058541" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "G46687AB", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "1108", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1108" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G66621EA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "1108", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1108" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G96577RX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "1108", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1108" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 271, "start_aa": "Asn", "end_pos": 271, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn271", "evidence": [ { "id": "O75503", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75503#ptm_processing" }, { "id": "24058541", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24058541" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 281, "start_aa": "Asn", "end_pos": 281, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn281", "evidence": [ { "id": "O75503", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75503#ptm_processing" }, { "id": "24058541", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24058541" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 352, "start_aa": "Asn", "end_pos": 352, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn352", "evidence": [ { "id": "O75503", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75503#ptm_processing" }, { "id": "24058541", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24058541" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "O75503", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75503" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan", "glycoprotein_reported" ], "publication": [ { "title": "Lysosomal localization of the neuronal ceroid lipofuscinosis CLN5 protein.", "journal": "Human molecular genetics", "date": "2002", "authors": "Isosomppi J, Vesa J, Jalanko A, Peltonen L", "evidence": [ { "database": "UniProtKB", "id": "O75503", "url": "https://www.uniprot.org/uniprot/O75503" } ], "reference": [ { "type": "PubMed", "id": "11971870", "url": "https://glygen.org/publication/PubMed/11971870" } ] }, { "title": "A CLN5 mutation causing an atypical neuronal ceroid lipofuscinosis of juvenile onset.", "journal": "Neurology", "date": "2005", "authors": "Pineda-Trujillo N, Cornejo W, Carrizosa J, Wheeler RB, Munera S, Valencia A, Agudelo-Arango J, Cogollo A, Anderson G, Bedoya G, Mole SE, Ruiz-Linares A", "evidence": [ { "database": "UniProtKB", "id": "O75503", "url": "https://www.uniprot.org/uniprot/O75503" } ], "reference": [ { "type": "PubMed", "id": "15728307", "url": "https://glygen.org/publication/PubMed/15728307" } ] }, { "title": "Two novel CLN5 mutations in a Portuguese patient with vLINCL: insights into molecular mechanisms of CLN5 deficiency.", "journal": "Molecular genetics and metabolism", "date": "2006", "authors": "Bessa C, Teixeira CA, Mangas M, Dias A, Sa Miranda MC, Guimaraes A, Ferreira JC, Canas N, Cabral P, Ribeiro MG", "evidence": [ { "database": "UniProtKB", "id": "O75503", "url": "https://www.uniprot.org/uniprot/O75503" } ], "reference": [ { "type": "PubMed", "id": "16814585", "url": "https://glygen.org/publication/PubMed/16814585" } ] }, { "title": "Revelation of a novel CLN5 mutation in early juvenile neuronal ceroid lipofuscinosis.", "journal": "Neuropediatrics", "date": "2007", "authors": "Cannelli N, Nardocci N, Cassandrini D, Morbin M, Aiello C, Bugiani M, Criscuolo L, Zara F, Striano P, Granata T, Bertini E, Simonati A, Santorelli FM", "evidence": [ { "database": "UniProtKB", "id": "O75503", "url": "https://www.uniprot.org/uniprot/O75503" } ], "reference": [ { "type": "PubMed", "id": "17607606", "url": "https://glygen.org/publication/PubMed/17607606" } ] }, { "title": "Retention of lysosomal protein CLN5 in the endoplasmic reticulum causes neuronal ceroid lipofuscinosis in Asian sibship.", "journal": "Human mutation", "date": "2009", "authors": "Lebrun AH, Storch S, Ruschendorf F, Schmiedt ML, Kyttala A, Mole SE, Kitzmuller C, Saar K, Mewasingh LD, Boda V, Kohlschutter A, Ullrich K, Braulke T, Schulz A", "evidence": [ { "database": "UniProtKB", "id": "O75503", "url": "https://www.uniprot.org/uniprot/O75503" } ], "reference": [ { "type": "PubMed", "id": "19309691", "url": "https://glygen.org/publication/PubMed/19309691" } ] }, { "title": "The neuronal ceroid lipofuscinosis protein CLN5: new insights into cellular maturation, transport, and consequences of mutations.", "journal": "Human mutation", "date": "2010", "authors": "Schmiedt ML, Bessa C, Heine C, Ribeiro MG, Jalanko A, Kyttala A", "evidence": [ { "database": "UniProtKB", "id": "O75503", "url": "https://www.uniprot.org/uniprot/O75503" } ], "reference": [ { "type": "PubMed", "id": "20052765", "url": "https://glygen.org/publication/PubMed/20052765" } ] }, { "title": "Update of the mutation spectrum and clinical correlations of over 360 mutations in eight genes that underlie the neuronal ceroid lipofuscinoses.", "journal": "Human mutation", "date": "2012", "authors": "Kousi M, Lehesjoki AE, Mole SE", "evidence": [ { "database": "UniProtKB", "id": "O75503", "url": "https://www.uniprot.org/uniprot/O75503" } ], "reference": [ { "type": "PubMed", "id": "21990111", "url": "https://glygen.org/publication/PubMed/21990111" } ] }, { "title": "The role of ceroid lipofuscinosis neuronal protein 5 (CLN5) in endosomal sorting.", "journal": "Molecular and cellular biology", "date": "2012", "authors": "Mamo A, Jules F, Dumaresq-Doiron K, Costantino S, Lefrancois S", "evidence": [ { "database": "UniProtKB", "id": "O75503", "url": "https://www.uniprot.org/uniprot/O75503" } ], "reference": [ { "type": "PubMed", "id": "22431521", "url": "https://glygen.org/publication/PubMed/22431521" } ] }, { "title": "Topology and membrane anchoring of the lysosomal storage disease-related protein CLN5.", "journal": "Human mutation", "date": "2013", "authors": "Larkin H, Ribeiro MG, Lavoie C", "evidence": [ { "database": "UniProtKB", "id": "O75503", "url": "https://www.uniprot.org/uniprot/O75503" } ], "reference": [ { "type": "PubMed", "id": "24038957", "url": "https://glygen.org/publication/PubMed/24038957" } ] }, { "title": "The role of N-glycosylation in folding, trafficking, and functionality of lysosomal protein CLN5.", "journal": "PloS one", "date": "2013", "authors": "Moharir A, Peck SH, Budden T, Lee SY", "evidence": [ { "database": "UniProtKB", "id": "O75503", "url": "https://www.uniprot.org/uniprot/O75503#ptm_processing" }, { "database": "UniProtKB", "id": "O75503", "url": "https://www.uniprot.org/uniprot/O75503" } ], "reference": [ { "type": "PubMed", "id": "24058541", "url": "https://glygen.org/publication/PubMed/24058541" } ] }, { "title": "N-linked glycosylation enrichment for in-depth cell surface proteomics of diffuse large B-cell lymphoma subtypes.", "journal": "Molecular & cellular proteomics : MCP", "date": "2014", "authors": "Deeb SJ, Cox J, Schmidt-Supprian M, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "24190977", "url": "https://glygen.org/publication/PubMed/24190977" } ] }, { "title": "Proteolytic processing of the neuronal ceroid lipofuscinosis related lysosomal protein CLN5.", "journal": "Experimental cell research", "date": "2015", "authors": "De Silva B, Adams J, Lee SY", "evidence": [ { "database": "UniProtKB", "id": "O75503", "url": "https://www.uniprot.org/uniprot/O75503" } ], "reference": [ { "type": "PubMed", "id": "26342652", "url": "https://glygen.org/publication/PubMed/26342652" } ] }, { "title": "Reanalysis of Global Proteomic and Phosphoproteomic Data Identified a Large Number of Glycopeptides.", "journal": "Analytical chemistry", "date": "2018", "authors": "Hu Y, Shah P, Clark DJ, Ao M, Zhang H", "evidence": [ { "database": "UniCarbKB", "id": "O75503", "url": "" }, { "database": "GlyConnect", "id": "1108", "url": "https://glyconnect.expasy.org/browser/proteins/1108" } ], "reference": [ { "type": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "title": "Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes.", "journal": "Journal of proteome research", "date": "2020", "authors": "Zhu J, Lin YH, Dingess KA, Mank M, Stahl B, Heck AJR", "evidence": [ { "database": "GlyConnect", "id": "1108", "url": "https://glyconnect.expasy.org/browser/proteins/1108" } ], "reference": [ { "type": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "title": "Deficiency of the Lysosomal Protein CLN5 Alters Lysosomal Function and Movement.", "journal": "Biomolecules", "date": "2021", "authors": "Basak I, Hansen RA, Ward ME, Hughes SM", "evidence": [ { "database": "RefSeq", "id": "NP_006484", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006484" } ], "reference": [ { "type": "PubMed", "id": "34680045", "url": "https://glygen.org/publication/PubMed/34680045" } ] }, { "title": "Spatiotemporal Activation of Protein O-GlcNAcylation in Living Cells.", "journal": "Journal of the American Chemical Society", "date": "2022", "authors": "He J, Fan Z, Tian Y, Yang W, Zhou Y, Zhu Q, Zhang W, Qin W, Yi W", "evidence": [ { "database": "O-GlcNAc Database", "id": "O75503", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75503" } ], "reference": [ { "type": "PubMed", "id": "35138101", "url": "https://glygen.org/publication/PubMed/35138101" } ] }, { "title": "Cln5 represents a new type of cysteine-based S-depalmitoylase linked to neurodegeneration.", "journal": "Science advances", "date": "2022", "authors": "Luebben AV, Bender D, Becker S, Crowther LM, Erven I, Hofmann K, Soding J, Klemp H, Bellotti C, Stauble A, Qiu T, Kathayat RS, Dickinson BC, Gartner J, Sheldrick GM, Kratzner R, Steinfeld R", "evidence": [ { "database": "RefSeq", "id": "NP_006484", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006484" } ], "reference": [ { "type": "PubMed", "id": "35427157", "url": "https://glygen.org/publication/PubMed/35427157" } ] }, { "title": "Lysosomal dysfunction, autophagic defects, and CLN5 accumulation underlie the pathogenesis of KCTD7-mutated neuronal ceroid lipofuscinoses.", "journal": "Autophagy", "date": "2022-11-11", "authors": "Wang Yalan, Wang Hongyan, Wang Chenji", "evidence": [ { "database": "RefSeq", "id": "NP_006484", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006484" } ], "reference": [ { "type": "PubMed", "id": "36368077", "url": "https://glygen.org/publication/PubMed/36368077" } ] }, { "title": "The Batten disease gene product CLN5 is the lysosomal bis(monoacylglycero)phosphate synthase.", "journal": "Science (New York, N.Y.)", "date": "2023-09-15", "authors": "Medoh Uche N, Hims Andy, Chen Julie Y, Ghoochani Ali, Nyame Kwamina, Dong Wentao, Abu-Remaileh Monther", "evidence": [ { "database": "RefSeq", "id": "NP_006484", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006484" } ], "reference": [ { "type": "PubMed", "id": "37708259", "url": "https://glygen.org/publication/PubMed/37708259" } ] }, { "title": "CLN5, a novel gene encoding a putative transmembrane protein mutated in Finnish variant late infantile neuronal ceroid lipofuscinosis.", "journal": "Nature genetics", "date": "1998", "authors": "Savukoski M, Klockars T, Holmberg V, Santavuori P, Lander ES, Peltonen L", "evidence": [ { "database": "UniProtKB", "id": "O75503", "url": "https://www.uniprot.org/uniprot/O75503" }, { "database": "dbSNP", "id": "rs28940280", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs28940280" } ], "reference": [ { "type": "PubMed", "id": "9662406", "url": "https://glygen.org/publication/PubMed/9662406" } ] } ], "pathway": [ { "id": "hsa:1203", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:1203", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A1W2Q672-1", "protein_name": "CLN5, intracellular trafficking protein", "gene_name": "Cln5", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MPRVGPGGAHWRPALALALLGLAATLGASPTSGQRWPVPYKRFSFRPKTDPFCQAKYTFCPTGSPIPVMKDNDVIEVLRLQAPVWEFKYGDLLGHFVRMHLDLKIMHDAIGFRSTLTGKNYTVEWYELFQLGNCTFPHLRPEVNAPFWCNQGAACFFEGIYDKHWKENGTLSLVATVSGNTFNKVAEWVKQDNETGIYYETWTVRASPGKGAQTWFESYDCSNFVLRTYEKLAEFGTDFKKIETNYTKIFLYSGEPIYLGNETSIFGPKGNKTLALAIKKFYGPFKRYSSTKDFLLNFLKIFDTVIMHREFYLFYNFEYWFLPMKPPFVKITYEETPLPTQHTTFTDL", "length": 348 }, "evidence": [ { "id": "O75503", "url": "https://omabrowser.org/oma/group/O75503/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q3UMW8-1", "protein_name": "Ceroid-lipofuscinosis neuronal protein 5 homolog", "gene_name": "Cln5", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MLRGGPCGAHWRPALALALLGLATILGASPTSGQRWPVPYKRFSFRPKTDPYCQAKYTFCPTGSPIPVMKDNDVIEVLRLQAPIWEFKYGDLLGHFKLMHDAVGFRSTLTGKNYTIEWYELFQLGNCTFPHLRPDKSAPFWCNQGAACFFEGIDDKHWKENGTLSVVATISGNTFNKVAEWVKQDNETGIYYETWTVRAGPGQGAQTWFESYDCSNFVLRTYKKLAEFGTEFKKIETNYTKIFLYSGEPIYLGNETSIFGPKGNKTLALAIKKFYGPFRPYLSTKDFLMNFLKIFDTVIIHRQFYLFYNFEYWFLPMKPPFVKITYEETPLPTRHTTFTDL", "length": 341 }, "evidence": [ { "id": "45920736", "url": "http://www.informatics.jax.org/homology/45920736", "database": "MGI" }, { "id": "O75503", "url": "https://omabrowser.org/oma/group/O75503/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 9, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "O75503", "url": "https://www.uniprot.org/uniprot/O75503" } ], "pmid": "" }, { "name": "lysosome", "id": "GO:0005764", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005764", "evidence": [ { "database": "UniProtKB", "id": "O75503", "url": "https://www.uniprot.org/uniprot/O75503" } ], "pmid": "" }, { "name": "endoplasmic reticulum", "id": "GO:0005783", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "evidence": [ { "database": "UniProtKB", "id": "O75503", "url": "https://www.uniprot.org/uniprot/O75503" } ], "pmid": "" }, { "name": "Golgi apparatus", "id": "GO:0005794", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005794", "evidence": [ { "database": "UniProtKB", "id": "O75503", "url": "https://www.uniprot.org/uniprot/O75503" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "O75503", "url": "https://www.uniprot.org/uniprot/O75503" } ], "pmid": "" }, { "name": "perinuclear region of cytoplasm", "id": "GO:0048471", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048471", "evidence": [ { "database": "UniProtKB", "id": "O75503", "url": "https://www.uniprot.org/uniprot/O75503" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "O75503", "url": "https://www.uniprot.org/uniprot/O75503" } ], "pmid": "" }, { "name": "lysosomal membrane", "id": "GO:0005765", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005765", "evidence": [ { "database": "UniProtKB", "id": "O75503", "url": "https://www.uniprot.org/uniprot/O75503" } ], "pmid": "" }, { "name": "vacuolar lumen", "id": "GO:0005775", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005775", "evidence": [ { "database": "UniProtKB", "id": "O75503", "url": "https://www.uniprot.org/uniprot/O75503" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 11, "go_terms": [ { "name": "brain development", "id": "GO:0007420", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007420", "evidence": [ { "database": "UniProtKB", "id": "O75503", "url": "https://www.uniprot.org/uniprot/O75503" } ], "pmid": "" }, { "name": "visual perception", "id": "GO:0007601", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007601", "evidence": [ { "database": "UniProtKB", "id": "O75503", "url": "https://www.uniprot.org/uniprot/O75503" } ], "pmid": "" }, { "name": "lysosome organization", "id": "GO:0007040", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007040", "evidence": [ { "database": "UniProtKB", "id": "O75503", "url": "https://www.uniprot.org/uniprot/O75503" } ], "pmid": "" }, { "name": "retrograde transport, endosome to Golgi", "id": "GO:0042147", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042147", "evidence": [ { "database": "UniProtKB", "id": "O75503", "url": "https://www.uniprot.org/uniprot/O75503" } ], "pmid": "" }, { "name": "protein catabolic process", "id": "GO:0030163", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030163", "evidence": [ { "database": "UniProtKB", "id": "O75503", "url": "https://www.uniprot.org/uniprot/O75503" } ], "pmid": "" }, { "name": "neurogenesis", "id": "GO:0022008", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0022008", "evidence": [ { "database": "UniProtKB", "id": "O75503", "url": "https://www.uniprot.org/uniprot/O75503" } ], "pmid": "" }, { "name": "lysosomal lumen acidification", "id": "GO:0007042", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007042", "evidence": [ { "database": "UniProtKB", "id": "O75503", "url": "https://www.uniprot.org/uniprot/O75503" } ], "pmid": "" }, { "name": "neuron maturation", "id": "GO:0042551", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042551", "evidence": [ { "database": "UniProtKB", "id": "O75503", "url": "https://www.uniprot.org/uniprot/O75503" } ], "pmid": "" }, { "name": "signal peptide processing", "id": "GO:0006465", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006465", "evidence": [ { "database": "UniProtKB", "id": "O75503", "url": "https://www.uniprot.org/uniprot/O75503" } ], "pmid": "" }, { "name": "glycosylation", "id": "GO:0070085", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070085", "evidence": [ { "database": "UniProtKB", "id": "O75503", "url": "https://www.uniprot.org/uniprot/O75503" } ], "pmid": "" }, { "name": "positive regulation of GTP binding", "id": "GO:1904426", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904426", "evidence": [ { "database": "UniProtKB", "id": "O75503", "url": "https://www.uniprot.org/uniprot/O75503" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "mannose binding", "id": "GO:0005537", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005537", "evidence": [ { "database": "UniProtKB", "id": "O75503", "url": "https://www.uniprot.org/uniprot/O75503" } ], "pmid": "" }, { "name": "hydrolase activity, acting on glycosyl bonds", "id": "GO:0016798", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016798", "evidence": [ { "database": "UniProtKB", "id": "O75503", "url": "https://www.uniprot.org/uniprot/O75503" } ], "pmid": "" } ] } ] }, "pro_annotation": [ { "name": "ceroid-lipofuscinosis neuronal protein 5 N-glycosylated 1 (human)", "definition": "A ceroid-lipofuscinosis neuronal protein 5 (human) that has been N-glycosylated at the residue equivalent to Asn-203 of the amino acid sequence represented by UniProtKB:O75503-1, in which the glycan composition is represented by GlyTouCan:G50372IH. Example: UniProtKB:O75503-1, Asn-203, MOD:00160~GNO:G50372IH. [PRO:DNx, PMID:29741879]", "evidence": [ { "id": "PR:000050839", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000050839" } ] } ], "site_annotation": [ { "start_pos": 130, "end_pos": 132, "annotation": "n_glycosylation_sequon" }, { "start_pos": 143, "end_pos": 145, "annotation": "n_glycosylation_sequon" }, { "start_pos": 178, "end_pos": 180, "annotation": "n_glycosylation_sequon" }, { "start_pos": 203, "end_pos": 205, "annotation": "n_glycosylation_sequon" }, { "start_pos": 255, "end_pos": 257, "annotation": "n_glycosylation_sequon" }, { "start_pos": 271, "end_pos": 273, "annotation": "n_glycosylation_sequon" }, { "start_pos": 281, "end_pos": 283, "annotation": "n_glycosylation_sequon" }, { "start_pos": 352, "end_pos": 354, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Can undergo proteolytic cleavage at the C-terminus, probably by a cysteine protease and may involve the removal of approximately 10-15 residues from the C-terminal end (PubMed:26342652).", "evidence": [ { "database": "UniProtKB", "id": "O75503", "url": "https://www.uniprot.org/uniprot/O75503" }, { "database": "PubMed", "id": "26342652", "url": "https://glygen.org/publication/PubMed/26342652" } ] }, { "annotation": "N-glycosylated with both high mannose and complex type sugars. Glycosylation is important for proper folding and trafficking to the lysosomes.", "evidence": [ { "database": "UniProtKB", "id": "O75503", "url": "https://www.uniprot.org/uniprot/O75503" }, { "database": "PubMed", "id": "24058541", "url": "https://glygen.org/publication/PubMed/24058541" }, { "database": "PubMed", "id": "20052765", "url": "https://glygen.org/publication/PubMed/20052765" }, { "database": "PubMed", "id": "24038957", "url": "https://glygen.org/publication/PubMed/24038957" }, { "database": "PubMed", "id": "11971870", "url": "https://glygen.org/publication/PubMed/11971870" } ] }, { "annotation": "The type II membrane signal anchor is proteolytically cleaved to produce a mature form that is transported to the lysosomes (Ceroid-lipofuscinosis neuronal protein 5, secreted form) (PubMed:24038957, PubMed:20052765).", "evidence": [ { "database": "UniProtKB", "id": "O75503", "url": "https://www.uniprot.org/uniprot/O75503" }, { "database": "PubMed", "id": "20052765", "url": "https://glygen.org/publication/PubMed/20052765" }, { "database": "PubMed", "id": "24038957", "url": "https://glygen.org/publication/PubMed/24038957" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [ 130, 143, 178, 203, 255, 271, 281, 352 ], "o_linked_sites": [], "snv_sites": [ 132, 143, 145, 178, 230, 255, 271, 283 ], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 130, "end_pos": 132 }, { "start_pos": 143, "end_pos": 145 }, { "start_pos": 178, "end_pos": 180 }, { "start_pos": 203, "end_pos": 205 }, { "start_pos": 255, "end_pos": 257 }, { "start_pos": 271, "end_pos": 273 }, { "start_pos": 281, "end_pos": 283 }, { "start_pos": 352, "end_pos": 354 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 25 }, { "field": "total_sites", "count": 9 }, { "field": "n_linked_glycans", "count": 16 }, { "field": "n_linked_glycan_sites", "count": 12 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 8 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 8 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 17 }, { "field": "total_sites", "count": 5 }, { "field": "n_linked_glycans", "count": 16 }, { "field": "n_linked_glycan_sites", "count": 4 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 12 }, { "field": "total_sites", "count": 8 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 5 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 20 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }