{ "uniprot_canonical_ac": "O75475-1", "uniprot_ac": "O75475", "uniprot_id": "PSIP1_HUMAN", "mass": { "chemical_mass": 60103.0, "monoisotopic_mass": 60103.0 }, "refseq": { "ac": "NP_001121689", "name": "PC4 and SFRS1-interacting protein isoform 2", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001121689" }, "gene_names": [ { "name": "PSIP1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O75475", "id": "O75475" }, { "name": "DFS70; LEDGF; p52; p75; PAIP; PSIP2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001121689", "id": "NP_001121689" }, { "name": "DFS70", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O75475", "id": "O75475" }, { "name": "LEDGF", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O75475", "id": "O75475" }, { "name": "PSIP1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001121689", "id": "NP_001121689" }, { "name": "PSIP2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O75475", "id": "O75475" } ], "protein_names": [ { "name": "PC4 and SFRS1-interacting protein", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O75475" }, { "name": "CLL-associated antigen KW-7", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O75475" }, { "name": "DFS 70", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O75475" }, { "name": "Dense fine speckles 70 kDa protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O75475" }, { "name": "Lens epithelium-derived growth factor", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O75475" }, { "name": "PC4 and SFRS1-interacting protein isoform 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001121689", "id": "NP_001121689" }, { "name": "Transcriptional coactivator p75/p52", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O75475" }, { "name": "transcriptional coactivator p52/p75; PC4 and SFRS1-interacting protein; PC4 and SFRS1 interacting protein 1; CLL-associated antigen KW-7; dense fine speckles 70 kDa protein; lens epithelium-derived growth factor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001121689", "id": "NP_001121689" } ], "function": [ { "annotation": "LEDGF/p75 Is Required for an Efficient DNA Damage Response. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001121689", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001121689" }, { "database": "PubMed", "id": "34070855", "url": "https://glygen.org/publication/PubMed/34070855" } ] }, { "annotation": "Modulation of the intrinsic chromatin binding property of HIV-1 integrase by LEDGF/p75.", "evidence": [ { "database": "RefSeq", "id": "NP_001121689", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001121689" }, { "database": "PubMed", "id": "34634812", "url": "https://glygen.org/publication/PubMed/34634812" } ] }, { "annotation": "PSIP1/p52 is expressed from the same gene as PSIP2/LEDGF/p75 due to alternative splicing of the pre-mRNA. It has transcription co-activator activity in vitro and can functionally interact with the ASF/SF2 splicing factor in vitro.", "evidence": [ { "database": "RefSeq", "id": "NP_001121689", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001121689" }, { "database": "PubMed", "id": "9885563", "url": "https://glygen.org/publication/PubMed/9885563" } ] }, { "annotation": "PSIP2/LEDGF/p75 co-purifies with transcription coactivator PC4 from HeLa cell extract. PSIP2 and PSIP1 interact with VP16 activation domain and several components of the general transcription machinery in vitro.", "evidence": [ { "database": "RefSeq", "id": "NP_001121689", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001121689" }, { "database": "PubMed", "id": "9822615", "url": "https://glygen.org/publication/PubMed/9822615" } ] }, { "annotation": "The LEDGF/p75 Integrase Binding Domain Interactome Contributes to the Survival, Clonogenicity, and Tumorsphere Formation of Docetaxel-Resistant Prostate Cancer Cells. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001121689", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001121689" }, { "database": "PubMed", "id": "34685704", "url": "https://glygen.org/publication/PubMed/34685704" } ] }, { "annotation": "The LncRNA MIR155HG is Upregulated by SP1 in Melanoma Cells and Drives Melanoma Progression via Modulating the MiR-485-3p/PSIP1 Axis.", "evidence": [ { "database": "RefSeq", "id": "NP_001121689", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001121689" }, { "database": "PubMed", "id": "34225636", "url": "https://glygen.org/publication/PubMed/34225636" } ] }, { "annotation": "Transcriptional coactivator involved in neuroepithelial stem cell differentiation and neurogenesis. Involved in particular in lens epithelial cell gene regulation and stress responses. May play an important role in lens epithelial to fiber cell terminal differentiation. May play a protective role during stress-induced apoptosis. Isoform 2 is a more general and stronger transcriptional coactivator. Isoform 2 may also act as an adapter to coordinate pre-mRNA splicing. Cellular cofactor for lentiviral integration.", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475#function" }, { "database": "PubMed", "id": "15642333", "url": "https://glygen.org/publication/PubMed/15642333" } ] }, { "annotation": "Unlike Its Paralog LEDGF/p75, HRP-2 Is Dispensable for MLL-R Leukemogenesis but Important for Leukemic Cell Survival. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001121689", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001121689" }, { "database": "PubMed", "id": "33477970", "url": "https://glygen.org/publication/PubMed/33477970" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs765296080", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765296080" }, { "id": "rs765296080", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765296080" }, { "id": "rs765296080", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs765296080" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 113, "end_pos": 113, "sequence_org": "K", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (KET->NET).", "chr_id": "9", "chr_pos": "15486881", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "K113", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1215427040", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1215427040" }, { "id": "rs1215427040", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1215427040" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 116, "end_pos": 116, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SVS->NVS).", "chr_id": "9", "chr_pos": "15486873", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S116", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1302608555", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1302608555" }, { "id": "rs1302608555", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1302608555" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 132, "end_pos": 132, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DVT->NVT).", "chr_id": "9", "chr_pos": "15486068", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D132", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs770210781", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770210781" }, { "id": "rs770210781", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770210781" }, { "id": "rs770210781", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs770210781" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 490, "end_pos": 490, "sequence_org": "P", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NQP->NQS).", "chr_id": "9", "chr_pos": "15466812", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P490", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs762256313", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762256313" }, { "id": "rs762256313", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762256313" }, { "id": "rs762256313", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs762256313#frequency_tab" }, { "id": "rs762256313", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs762256313" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 525, "end_pos": 525, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DST->NST).", "chr_id": "9", "chr_pos": "15465540", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D525", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O75475", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O75475" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 88, "end_pos": 88, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "P", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NNP->NNS).", "chr_id": "9", "chr_pos": "15490012", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "P88", "disease": [ { "disease_id": "DOID:4362", "recommended_name": { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "cervical cancer", "description": "A female reproductive organ cancer that is located_in the cervix." }, "synonyms": [ { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "cervical neoplasm", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "cervix cancer", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "cervix uteri cancer", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "neoplasm of uterine cervix", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "tumor of the Cervix Uteri", "description": "" }, { "id": "DOID:4362", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4362", "name": "uterine cervical neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervical cancer", "description": "A primary or metastatic malignant neoplasm involving the cervix." }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervical neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "tumor of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "tumour of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "uterine cervical neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cancer of uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervical cancer, somatic", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervix cancer", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "cervix uteri cancer", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervical neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervical tumor", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervical tumour", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix tumor", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix tumour", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix uteri neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix uteri tumor", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant cervix uteri tumour", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of the cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of the uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant neoplasm of uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of the cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of the uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumor of uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of the cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of the cervix uteri", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of the uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant tumour of uterine cervix", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant uterine cervix neoplasm", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant uterine cervix tumor", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "malignant uterine cervix tumour", "description": "" }, { "id": "MONDO:0002974", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0002974", "name": "uterine cervix cancer", "description": "" }, { "id": "MIM:603956", "resource": "MIM", "url": "https://www.omim.org/entry/603956", "name": "Cervical cancer", "description": "Cervical cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] } ], "mutagenesis": [ { "start_pos": 360, "end_pos": 360, "sequence_org": "K", "sequence_mut": "A", "comment": "Reduced interaction with POGZ, CDCA7L and human HIV-1 integrase.", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" }, { "database": "PubMed", "id": "19244240", "url": "https://glygen.org/publication/PubMed/19244240" } ] }, { "start_pos": 365, "end_pos": 365, "sequence_org": "I", "sequence_mut": "A", "comment": "Loss of interaction with human HIV-1 integrase; reduced interaction with POGZ and CDCA7L.", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" }, { "database": "PubMed", "id": "15895093", "url": "https://glygen.org/publication/PubMed/15895093" }, { "database": "PubMed", "id": "19244240", "url": "https://glygen.org/publication/PubMed/19244240" } ] }, { "start_pos": 366, "end_pos": 366, "sequence_org": "D", "sequence_mut": "A", "comment": "Loss of interaction with human HIV-1 integrase; no effect on interaction with CDCA7L and POGZ.", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" }, { "database": "PubMed", "id": "19244240", "url": "https://glygen.org/publication/PubMed/19244240" } ] }, { "start_pos": 366, "end_pos": 366, "sequence_org": "D", "sequence_mut": "N", "comment": "Loss of interaction with human HIV-1 integrase; no effect on interaction with KMT2A.", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" }, { "database": "PubMed", "id": "15895093", "url": "https://glygen.org/publication/PubMed/15895093" }, { "database": "PubMed", "id": "25082813", "url": "https://glygen.org/publication/PubMed/25082813" } ] }, { "start_pos": 368, "end_pos": 368, "sequence_org": "L", "sequence_mut": "A", "comment": "Reduced interaction with KMT2A. Significant loss of interaction with KMT2A; when associated with D-407.", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" }, { "database": "PubMed", "id": "25082813", "url": "https://glygen.org/publication/PubMed/25082813" } ] }, { "start_pos": 370, "end_pos": 370, "sequence_org": "V", "sequence_mut": "A", "comment": "Reduced interaction with POGZ, CDCA7L and human HIV-1 integrase.", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" }, { "database": "PubMed", "id": "19244240", "url": "https://glygen.org/publication/PubMed/19244240" } ] }, { "start_pos": 404, "end_pos": 404, "sequence_org": "R", "sequence_mut": "D", "comment": "Significant loss of interaction with KMT2A; when associated with D-405.", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" }, { "database": "PubMed", "id": "25082813", "url": "https://glygen.org/publication/PubMed/25082813" } ] }, { "start_pos": 405, "end_pos": 405, "sequence_org": "R", "sequence_mut": "D", "comment": "Significant loss of interaction with KMT2A; when associated with D-404.", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" }, { "database": "PubMed", "id": "25082813", "url": "https://glygen.org/publication/PubMed/25082813" } ] }, { "start_pos": 406, "end_pos": 406, "sequence_org": "F", "sequence_mut": "A", "comment": "Loss of interaction with human HIV-1 integrase and POGZ; reduced interaction with CDCA7L.", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" }, { "database": "PubMed", "id": "15895093", "url": "https://glygen.org/publication/PubMed/15895093" }, { "database": "PubMed", "id": "19244240", "url": "https://glygen.org/publication/PubMed/19244240" } ] }, { "start_pos": 407, "end_pos": 407, "sequence_org": "K", "sequence_mut": "D", "comment": "Reduced interaction with KMT2A. Significant loss of interaction with KMT2A; when associated with A-368.", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" }, { "database": "PubMed", "id": "25082813", "url": "https://glygen.org/publication/PubMed/25082813" } ] }, { "start_pos": 408, "end_pos": 408, "sequence_org": "V", "sequence_mut": "A", "comment": "Reduced interaction with human HIV-1 integrase; no effect on interaction with POGZ and CDCA7L.", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" }, { "database": "PubMed", "id": "15895093", "url": "https://glygen.org/publication/PubMed/15895093" }, { "database": "PubMed", "id": "19244240", "url": "https://glygen.org/publication/PubMed/19244240" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "87.26", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000164985", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164985" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "91.27", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000164985", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164985" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "88.62", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000164985", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164985" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "88.82", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000164985", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164985" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "96.28", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000164985", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164985" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "95.19", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000164985", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164985" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "78.64", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000164985", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164985" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "95.54", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000164985", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164985" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "93.73", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000164985", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164985" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "87.4", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000164985", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164985" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "87.53", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000164985", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164985" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "91.82", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000164985", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164985" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "91.93", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000164985", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164985" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O75475", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75475" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O75475", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75475" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O75475", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75475" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O75475", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75475" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O75475", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75475" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O75475", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75475" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O75475", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75475" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O75475", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75475" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O75475", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75475" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O75475", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75475" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O75475", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75475" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O75475", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75475" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" } ], "common_name": "Human" } ], "gene": [ { "name": "PSIP1", "url": "https://www.uniprot.org/uniprot/O75475", "locus": { "chromosome": "9", "start_pos": 15464066, "end_pos": 15510995, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000164985", "url": "https://www.ensembl.org/id/ENSG00000164985" } ] } } ], "crossref": [ { "id": "ENSG00000164985", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164985", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "O75475", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O75475", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd20151", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd20151", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL3988590", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL3988590", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "PSIP1", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=PSIP1", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "11168", "url": "https://www.ncbi.nlm.nih.gov/gene/11168", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "9527", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=9527", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O75475", "url": "https://www.ebi.ac.uk/intact/interactors/id:O75475*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000313", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000313", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR021567", "url": "https://www.ebi.ac.uk/interpro/entry/IPR021567", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR035441", "url": "https://www.ebi.ac.uk/interpro/entry/IPR035441", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036218", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036218", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:11168", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:11168", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "603620", "url": "http://www.omim.org/entry/603620", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O75475", "url": "https://www.nextprot.org/entry/NX_O75475", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "O75475", "url": "https://oglcnac.org/atlas/detail/O75475", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "O75475", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75475", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "YTKNMNE", "url": "https://omabrowser.org/oma/group/YTKNMNE/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4271850at2759", "url": "http://www.orthodb.org/?query=4271850at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR12550", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12550", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12550:SF42", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12550:SF42", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1Z9E", "url": "https://www.rcsb.org/structure/1Z9E", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2B4J", "url": "https://www.rcsb.org/structure/2B4J", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2M16", "url": "https://www.rcsb.org/structure/2M16", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2MSR", "url": "https://www.rcsb.org/structure/2MSR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2MTN", "url": "https://www.rcsb.org/structure/2MTN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2N3A", "url": "https://www.rcsb.org/structure/2N3A", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3F9K", "url": "https://www.rcsb.org/structure/3F9K", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3HPG", "url": "https://www.rcsb.org/structure/3HPG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3HPH", "url": "https://www.rcsb.org/structure/3HPH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3U88", "url": "https://www.rcsb.org/structure/3U88", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3ZEH", "url": "https://www.rcsb.org/structure/3ZEH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4FU6", "url": "https://www.rcsb.org/structure/4FU6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5N88", "url": "https://www.rcsb.org/structure/5N88", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5OYM", "url": "https://www.rcsb.org/structure/5OYM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5YI9", "url": "https://www.rcsb.org/structure/5YI9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6EMO", "url": "https://www.rcsb.org/structure/6EMO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6EMP", "url": "https://www.rcsb.org/structure/6EMP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6EMQ", "url": "https://www.rcsb.org/structure/6EMQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6EMR", "url": "https://www.rcsb.org/structure/6EMR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6S01", "url": "https://www.rcsb.org/structure/6S01", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6TRJ", "url": "https://www.rcsb.org/structure/6TRJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6TVM", "url": "https://www.rcsb.org/structure/6TVM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6ZV0", "url": "https://www.rcsb.org/structure/6ZV0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7OUF", "url": "https://www.rcsb.org/structure/7OUF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7OUG", "url": "https://www.rcsb.org/structure/7OUG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7OUH", "url": "https://www.rcsb.org/structure/7OUH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7PEL", "url": "https://www.rcsb.org/structure/7PEL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7Z1Z", "url": "https://www.rcsb.org/structure/7Z1Z", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8CBQ", "url": "https://www.rcsb.org/structure/8CBQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8PC5", "url": "https://www.rcsb.org/structure/8PC5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8PC6", "url": "https://www.rcsb.org/structure/8PC6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8PEO", "url": "https://www.rcsb.org/structure/8PEO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8PEP", "url": "https://www.rcsb.org/structure/8PEP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00855", "url": "http://pfam.xfam.org/family/PF00855", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF11467", "url": "http://pfam.xfam.org/family/PF11467", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O75475", "url": "https://pharos.nih.gov/targets/O75475", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O75475", "url": "http://purl.obolibrary.org/obo/PR_O75475", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-162592", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-162592", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-164843", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-164843", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-175567", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-175567", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-177539", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-177539", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-180689", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180689", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-180910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180910", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001121689", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001121689", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O75475-1", "url": "https://www.uniprot.org/uniprot/O75475-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O75475-2", "url": "https://www.uniprot.org/uniprot/O75475-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O75475-3", "url": "https://www.uniprot.org/uniprot/O75475-3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "V9GYT7", "url": "https://www.uniprot.org/uniprot/V9GYT7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "V9GYT7-1", "url": "https://www.uniprot.org/uniprot/V9GYT7-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MTRDFKPGDLIFAKMKGYPHWPARVDEVPDGAVKPPTNKLPIFFFGTHETAFLGPKDIFPYSENKEKYGKPNKRKGFNEGLWEIDNNPKVKFSSQQAATKQSNASSDVEVEEKETSVSKEDTDHEEKASNEDVTKAVDITTPKAARRGRKRKAEKQVETEEAGVVTTATASVNLKVSPKRGRPAATEVKIPKPRGRPKMVKQPCPSESDIITEEDKSKKKGQEEKQPKKQPKKDEEGQKEEDKPRKEPDKKEGKKEVESKRKNLAKTGVTSTSDSEEEGDDQEGEKKRKGGRNFQTAHRRNMLKGQHEKEAADRKRKQEEQMETEQQNKDEGKKPEVKKVEKKRETSMDSRLQRIHAEIKNSLKIDNLDVNRCIEALDELASLQVTMQQAQKHTEMITTLKKIRRFKVSQVIMEKSTMLYNKFKNMFLVGEGDSVITQVLNKSLAEQRQHEEANKTKDQGKKGPNKKLEKEQTGSKTLNGGSDAQDGNQPQHNGESNEDSKDNHEASTKKKPSSEERETEISLKDSTLDN", "length": 530, "header": "sp|O75475-1|PSIP1_HUMAN Isoform 1 of PC4 and SFRS1-interacting protein OS=Homo sapiens OX=9606 GN=PSIP1 PE=1 SV=1 CANONICAL=O75475-1" }, "isoforms": [ { "isoform_ac": "O75475-1", "url": "", "sequence": { "sequence": "MTRDFKPGDLIFAKMKGYPHWPARVDEVPDGAVKPPTNKLPIFFFGTHETAFLGPKDIFPYSENKEKYGKPNKRKGFNEGLWEIDNNPKVKFSSQQAATKQSNASSDVEVEEKETSVSKEDTDHEEKASNEDVTKAVDITTPKAARRGRKRKAEKQVETEEAGVVTTATASVNLKVSPKRGRPAATEVKIPKPRGRPKMVKQPCPSESDIITEEDKSKKKGQEEKQPKKQPKKDEEGQKEEDKPRKEPDKKEGKKEVESKRKNLAKTGVTSTSDSEEEGDDQEGEKKRKGGRNFQTAHRRNMLKGQHEKEAADRKRKQEEQMETEQQNKDEGKKPEVKKVEKKRETSMDSRLQRIHAEIKNSLKIDNLDVNRCIEALDELASLQVTMQQAQKHTEMITTLKKIRRFKVSQVIMEKSTMLYNKFKNMFLVGEGDSVITQVLNKSLAEQRQHEEANKTKDQGKKGPNKKLEKEQTGSKTLNGGSDAQDGNQPQHNGESNEDSKDNHEASTKKKPSSEERETEISLKDSTLDN", "length": 530, "header": "sp|O75475-1|PSIP1_HUMAN Isoform 1 of PC4 and SFRS1-interacting protein OS=Homo sapiens OX=9606 GN=PSIP1 PE=1 SV=1 CANONICAL=O75475-1" }, "locus": { "chromosome": "9", "start_pos": 15510188, "end_pos": 15465523, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000380738.8", "url": "https://www.ensembl.org/id/ENST00000380738.8" }, { "database": "Ensembl Peptide", "id": "ENSP00000370114.4", "url": "https://www.ensembl.org/id/ENSP00000370114.4" } ] } }, { "isoform_ac": "O75475-2", "url": "", "sequence": { "sequence": "MTRDFKPGDLIFAKMKGYPHWPARVDEVPDGAVKPPTNKLPIFFFGTHETAFLGPKDIFPYSENKEKYGKPNKRKGFNEGLWEIDNNPKVKFSSQQAATKQSNASSDVEVEEKETSVSKEDTDHEEKASNEDVTKAVDITTPKAARRGRKRKAEKQVETEEAGVVTTATASVNLKVSPKRGRPAATEVKIPKPRGRPKMVKQPCPSESDIITEEDKSKKKGQEEKQPKKQPKKDEEGQKEEDKPRKEPDKKEGKKEVESKRKNLAKTGVTSTSDSEEEGDDQEGEKKRKGGRNFQTAHRRNMLKGQHEKEAADRKRKQEEQMETEHQTTCNLQ", "length": 333, "header": "sp|O75475-2|PSIP1_HUMAN Isoform 2 of PC4 and SFRS1-interacting protein OS=Homo sapiens OX=9606 GN=PSIP1 PE=1 SV=1 CANONICAL=O75475-1" }, "locus": { "chromosome": "9", "start_pos": 15510188, "end_pos": 15471210, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000380716.8", "url": "https://www.ensembl.org/id/ENST00000380716.8" }, { "database": "Ensembl Peptide", "id": "ENSP00000370092.4", "url": "https://www.ensembl.org/id/ENSP00000370092.4" } ] } }, { "isoform_ac": "O75475-3", "url": "", "sequence": { "sequence": "MTRDFKPGDLIFAKMKGYPHWPARVDEVPDGAVKPPTNKLPIFFFGTHETAFLGPKDIFPYSENKEKYGKPNKRKGFNEGLWEIDNNPKVKFSSQQAATKQSNASSDVEVEEKETSVSKEDTDHEEKASNEDVTKAVDITTPKAARRGRKRKAEKQVETEEAGVVTTATASVNLKVSPKRGRPAATEVKIPKPRGRPKMVKQPCPSESDIITEEDKSKKKGQEEKQPKKQPKKDEEGQKEEDKPRKEPDKKEGKKEVESKRKNLAKTGVTSTSDSEEEGDDQEGEKKRKGGRNFQTAHRRNMLKGQHEKEAADRKRKQEEQMETEHFAL", "length": 329, "header": "sp|O75475-3|PSIP1_HUMAN Isoform 3 of PC4 and SFRS1-interacting protein OS=Homo sapiens OX=9606 GN=PSIP1 PE=1 SV=1 CANONICAL=O75475-1" }, "locus": { "chromosome": "9", "start_pos": 15510188, "end_pos": 15471302, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000380715.5", "url": "https://www.ensembl.org/id/ENST00000380715.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000370091.1", "url": "https://www.ensembl.org/id/ENSP00000370091.1" } ] } }, { "isoform_ac": "V9GYT7-1", "url": "", "sequence": { "sequence": "KRKGGRNFQTAHRRNMLKGQHEKEAADRKRKQEEQMETEHINPVTEKRIQVEQTRDEDLDTDSLD", "length": 65, "header": "tr|V9GYT7-1|PSIP1_HUMAN Computationally mapped isoform of PC4 and SFRS1-interacting protein OS=Homo sapiens OX=9606 GN=PSIP1 PE=1 SV=1 CANONICAL=O75475-1" }, "locus": { "chromosome": "9", "start_pos": 15472750, "end_pos": 15471101, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000481862.1", "url": "https://www.ensembl.org/id/ENST00000481862.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000477077.1", "url": "https://www.ensembl.org/id/ENSP00000477077.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 206, "start_aa": "Ser", "end_pos": 206, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser206", "evidence": [ { "id": "O75475", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75475" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "O75475", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75475" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 37, "start_aa": "Thr", "end_pos": 37, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr37", "evidence": [ { "id": "O75475", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75475" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" }, { "id": "O75475", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O75475" } ] }, { "glytoucan_ac": "G70994MS", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 37, "start_aa": "Thr", "end_pos": 37, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr37", "evidence": [ { "id": "GLY_000142", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000142" }, { "id": "29351928", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29351928" } ] } ], "phosphorylation": [ { "start_pos": 102, "end_pos": 102, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" }, { "database": "iPTMnet", "id": "O75475", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75475" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser102" }, { "start_pos": 105, "end_pos": 105, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" }, { "database": "iPTMnet", "id": "O75475", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75475" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "phospho.ELM", "id": "O75475", "url": "http://phospho.elm.eu.org/byAccession/O75475.html" } ], "site_lbl": "Ser105" }, { "start_pos": 106, "end_pos": 106, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O75475", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75475" }, { "database": "PubMed", "id": "15302935", "url": "https://glygen.org/publication/PubMed/15302935" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "phospho.ELM", "id": "O75475", "url": "http://phospho.elm.eu.org/byAccession/O75475.html" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ], "site_lbl": "Ser106" }, { "start_pos": 115, "end_pos": 115, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" }, { "database": "iPTMnet", "id": "O75475", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75475" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Thr115" }, { "start_pos": 116, "end_pos": 116, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75475", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75475" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "phospho.ELM", "id": "O75475", "url": "http://phospho.elm.eu.org/byAccession/O75475.html" } ], "site_lbl": "Ser116" }, { "start_pos": 118, "end_pos": 118, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75475", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75475" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser118" }, { "start_pos": 122, "end_pos": 122, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O75475", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75475" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "phospho.ELM", "id": "O75475", "url": "http://phospho.elm.eu.org/byAccession/O75475.html" } ], "site_lbl": "Thr122" }, { "start_pos": 129, "end_pos": 129, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "iPTMnet", "id": "O75475", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75475" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "O75475", "url": "http://phospho.elm.eu.org/byAccession/O75475.html" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ], "site_lbl": "Ser129" }, { "start_pos": 140, "end_pos": 140, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75475", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75475" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Thr140" }, { "start_pos": 141, "end_pos": 141, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "iPTMnet", "id": "O75475", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75475" }, { "database": "PubMed", "id": "16964243", "url": "https://glygen.org/publication/PubMed/16964243" }, { "database": "PubMed", "id": "18212344", "url": "https://glygen.org/publication/PubMed/18212344" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" }, { "database": "PubMed", "id": "20068230", "url": "https://glygen.org/publication/PubMed/20068230" }, { "database": "phospho.ELM", "id": "O75475", "url": "http://phospho.elm.eu.org/byAccession/O75475.html" } ], "site_lbl": "Thr141" }, { "start_pos": 159, "end_pos": 159, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75475", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75475" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" } ], "site_lbl": "Thr159" }, { "start_pos": 167, "end_pos": 167, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "iPTMnet", "id": "O75475", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75475" } ], "site_lbl": "Thr167" }, { "start_pos": 169, "end_pos": 169, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75475", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75475" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" } ], "site_lbl": "Thr169" }, { "start_pos": 171, "end_pos": 171, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75475", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75475" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" } ], "site_lbl": "Ser171" }, { "start_pos": 177, "end_pos": 177, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "iPTMnet", "id": "O75475", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75475" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser177" }, { "start_pos": 206, "end_pos": 206, "kinase_uniprot_canonical_ac": "O00311-1", "kinase_gene_name": "CDC7", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75475", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75475" }, { "database": "PubMed", "id": "7231784", "url": "https://glygen.org/publication/PubMed/7231784" } ], "site_lbl": "Ser206" }, { "start_pos": 206, "end_pos": 206, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "iPTMnet", "id": "O75475", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75475" }, { "database": "PubMed", "id": "19864417", "url": "https://glygen.org/publication/PubMed/19864417" } ], "site_lbl": "Ser206" }, { "start_pos": 267, "end_pos": 267, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75475", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75475" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "phospho.ELM", "id": "O75475", "url": "http://phospho.elm.eu.org/byAccession/O75475.html" } ], "site_lbl": "Thr267" }, { "start_pos": 270, "end_pos": 270, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75475", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75475" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "phospho.ELM", "id": "O75475", "url": "http://phospho.elm.eu.org/byAccession/O75475.html" } ], "site_lbl": "Thr270" }, { "start_pos": 271, "end_pos": 271, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "iPTMnet", "id": "O75475", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75475" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19415658", "url": "https://glygen.org/publication/PubMed/19415658" }, { "database": "phospho.ELM", "id": "O75475", "url": "http://phospho.elm.eu.org/byAccession/O75475.html" }, { "database": "PubMed", "id": "16083285", "url": "https://glygen.org/publication/PubMed/16083285" } ], "site_lbl": "Ser271" }, { "start_pos": 272, "end_pos": 272, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "iPTMnet", "id": "O75475", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75475" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "PubMed", "id": "19415658", "url": "https://glygen.org/publication/PubMed/19415658" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "O75475", "url": "http://phospho.elm.eu.org/byAccession/O75475.html" } ], "site_lbl": "Thr272" }, { "start_pos": 273, "end_pos": 273, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "iPTMnet", "id": "O75475", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75475" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "PubMed", "id": "19415658", "url": "https://glygen.org/publication/PubMed/19415658" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "20166139", "url": "https://glygen.org/publication/PubMed/20166139" }, { "database": "phospho.ELM", "id": "O75475", "url": "http://phospho.elm.eu.org/byAccession/O75475.html" } ], "site_lbl": "Ser273" }, { "start_pos": 275, "end_pos": 275, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "iPTMnet", "id": "O75475", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75475" }, { "database": "PubMed", "id": "16083285", "url": "https://glygen.org/publication/PubMed/16083285" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "PubMed", "id": "19415658", "url": "https://glygen.org/publication/PubMed/19415658" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "20166139", "url": "https://glygen.org/publication/PubMed/20166139" }, { "database": "phospho.ELM", "id": "O75475", "url": "http://phospho.elm.eu.org/byAccession/O75475.html" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ], "site_lbl": "Ser275" }, { "start_pos": 398, "end_pos": 398, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75475", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75475" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Thr398" }, { "start_pos": 434, "end_pos": 434, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O75475", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75475" }, { "database": "phospho.ELM", "id": "O75475", "url": "http://phospho.elm.eu.org/byAccession/O75475.html" } ], "site_lbl": "Ser434" }, { "start_pos": 437, "end_pos": 437, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" }, { "database": "PubMed", "id": "17525332", "url": "https://glygen.org/publication/PubMed/17525332" }, { "database": "iPTMnet", "id": "O75475", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75475" }, { "database": "phospho.ELM", "id": "O75475", "url": "http://phospho.elm.eu.org/byAccession/O75475.html" } ], "site_lbl": "Thr437" }, { "start_pos": 443, "end_pos": 443, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "iPTMnet", "id": "O75475", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75475" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "O75475", "url": "http://phospho.elm.eu.org/byAccession/O75475.html" } ], "site_lbl": "Ser443" }, { "start_pos": 508, "end_pos": 508, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75475", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75475" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Thr508" }, { "start_pos": 514, "end_pos": 514, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O75475", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75475" } ], "site_lbl": "Ser514" }, { "start_pos": 519, "end_pos": 519, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75475", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75475" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" } ], "site_lbl": "Thr519" }, { "start_pos": 522, "end_pos": 522, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "iPTMnet", "id": "O75475", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75475" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "O75475", "url": "http://phospho.elm.eu.org/byAccession/O75475.html" } ], "site_lbl": "Ser522" }, { "start_pos": 526, "end_pos": 526, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75475", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75475" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "phospho.ELM", "id": "O75475", "url": "http://phospho.elm.eu.org/byAccession/O75475.html" } ], "site_lbl": "Ser526" }, { "start_pos": 527, "end_pos": 527, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "iPTMnet", "id": "O75475", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75475" }, { "database": "phospho.ELM", "id": "O75475", "url": "http://phospho.elm.eu.org/byAccession/O75475.html" } ], "site_lbl": "Thr527" }, { "start_pos": 62, "end_pos": 62, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75475", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75475" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser62" }, { "start_pos": 93, "end_pos": 93, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75475", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75475" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" } ], "site_lbl": "Ser93" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Lens epithelium-derived growth factor: effects on growth and survival of lens epithelial cells, keratinocytes, and fibroblasts.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2000", "authors": "Singh DP, Ohguro N, Kikuchi T, Sueno T, Reddy VN, Yuge K, Chylack LT Jr, Shinohara T", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" } ], "reference": [ { "type": "PubMed", "id": "10623627", "url": "https://glygen.org/publication/PubMed/10623627" } ] }, { "title": "Lens epithelium-derived growth factor (LEDGF/p75) and p52 are derived from a single gene by alternative splicing.", "journal": "Gene", "date": "2000", "authors": "Singh DP, Kimura A, Chylack LT Jr, Shinohara T", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" } ], "reference": [ { "type": "PubMed", "id": "10721720", "url": "https://glygen.org/publication/PubMed/10721720" } ] }, { "title": "Autoantibodies to DFS 70 kd/transcription coactivator p75 in atopic dermatitis and other conditions.", "journal": "J. Allergy Clin. Immunol.", "date": "2000", "authors": "Ochs R L, Muro Y, Si Y, Ge H, Chan E K, Tan E M", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" } ], "reference": [ { "type": "PubMed", "id": "10856157", "url": "https://glygen.org/publication/PubMed/10856157" } ] }, { "title": "Identification of tumor-associated antigens in chronic lymphocytic leukemia by SEREX.", "journal": "Blood", "date": "2002", "authors": "Krackhardt Angela M, Witzens Mathias, Harig Sabine, Hodi F Stephen, Zauls A Jason, Chessia Morgan, Barrett Patrick, Gribben John G", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" } ], "reference": [ { "type": "PubMed", "id": "12200376", "url": "https://glygen.org/publication/PubMed/12200376" } ] }, { "title": "Docking of HIV-1 Vpr to the nuclear envelope is mediated by the interaction with the nucleoporin hCG1.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Le Rouzic E, Mousnier A, Rustum C, Stutz F, Hallberg E, Dargemont C, Benichou S", "evidence": [ { "database": "Reactome", "id": "R-HSA-180910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180910" } ], "reference": [ { "type": "PubMed", "id": "12228227", "url": "https://glygen.org/publication/PubMed/12228227" } ] }, { "title": "Leukemia proto-oncoprotein MLL is proteolytically processed into 2 fragments with opposite transcriptional properties.", "journal": "Blood", "date": "2002-11-15", "authors": "Yokoyama Akihiko, Kitabayashi Issay, Ayton Paul M, Cleary Michael L, Ohki Misao", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "12393701", "url": "https://glygen.org/publication/PubMed/12393701" } ] }, { "title": "Proteolytic cleavage of MLL generates a complex of N- and C-terminal fragments that confers protein stability and subnuclear localization.", "journal": "Molecular and cellular biology", "date": "2003", "authors": "Hsieh JJ, Ernst P, Erdjument-Bromage H, Tempst P, Korsmeyer SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "12482972", "url": "https://glygen.org/publication/PubMed/12482972" } ] }, { "title": "Human Sin3 deacetylase and trithorax-related Set1/Ash2 histone H3-K4 methyltransferase are tethered together selectively by the cell-proliferation factor HCF-1.", "journal": "Genes & development", "date": "2003", "authors": "Wysocka J, Myers MP, Laherty CD, Eisenman RN, Herr W", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "12670868", "url": "https://glygen.org/publication/PubMed/12670868" } ] }, { "title": "The cytidine deaminase CEM15 induces hypermutation in newly synthesized HIV-1 DNA.", "journal": "Nature", "date": "2003", "authors": "Zhang H, Yang B, Pomerantz RJ, Zhang C, Arunachalam SC, Gao L", "evidence": [ { "database": "Reactome", "id": "R-HSA-180689", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180689" } ], "reference": [ { "type": "PubMed", "id": "12808465", "url": "https://glygen.org/publication/PubMed/12808465" } ] }, { "title": "Taspase1: a threonine aspartase required for cleavage of MLL and proper HOX gene expression.", "journal": "Cell", "date": "2003", "authors": "Hsieh JJ, Cheng EH, Korsmeyer SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "14636557", "url": "https://glygen.org/publication/PubMed/14636557" } ] }, { "title": "Menin associates with a trithorax family histone methyltransferase complex and with the hoxc8 locus.", "journal": "Molecular cell", "date": "2004", "authors": "Hughes CM, Rozenblatt-Rosen O, Milne TA, Copeland TD, Levine SS, Lee JC, Hayes DN, Shanmugam KS, Bhattacharjee A, Biondi CA, Kay GF, Hayward NK, Hess JL, Meyerson M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "14992727", "url": "https://glygen.org/publication/PubMed/14992727" } ] }, { "title": "Single-strand specificity of APOBEC3G accounts for minus-strand deamination of the HIV genome.", "journal": "Nature structural & molecular biology", "date": "2004", "authors": "Yu Q, Konig R, Pillai S, Chiles K, Kearney M, Palmer S, Richman D, Coffin JM, Landau NR", "evidence": [ { "database": "Reactome", "id": "R-HSA-180689", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180689" } ], "reference": [ { "type": "PubMed", "id": "15098018", "url": "https://glygen.org/publication/PubMed/15098018" } ] }, { "title": "Leukemia proto-oncoprotein MLL forms a SET1-like histone methyltransferase complex with menin to regulate Hox gene expression.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Yokoyama A, Wang Z, Wysocka J, Sanyal M, Aufiero DJ, Kitabayashi I, Herr W, Cleary ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "15199122", "url": "https://glygen.org/publication/PubMed/15199122" } ] }, { "title": "Large-scale characterization of HeLa cell nuclear phosphoproteins.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP", "evidence": [ { "database": "iPTMnet", "id": "O75475-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75475-1" } ], "reference": [ { "type": "PubMed", "id": "15302935", "url": "https://glygen.org/publication/PubMed/15302935" } ] }, { "title": "Lens epithelium-derived growth factor/p75 prevents proteasomal degradation of HIV-1 integrase.", "journal": "J. Biol. Chem.", "date": "2004", "authors": "Llano Manuel, Delgado Sharon, Vanegas Maria, Poeschla Eric M", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" } ], "reference": [ { "type": "PubMed", "id": "15475359", "url": "https://glygen.org/publication/PubMed/15475359" } ] }, { "title": "APOBEC3G incorporation into human immunodeficiency virus type 1 particles.", "journal": "Journal of virology", "date": "2004", "authors": "Zennou V, Perez-Caballero D, Gottlinger H, Bieniasz PD", "evidence": [ { "database": "Reactome", "id": "R-HSA-180689", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180689" } ], "reference": [ { "type": "PubMed", "id": "15479846", "url": "https://glygen.org/publication/PubMed/15479846" } ] }, { "title": "Lens epithelium-derived growth factor (LEDGF/p75) expression in fetal and adult human brain.", "journal": "Experimental eye research", "date": "2004-12", "authors": "Chylack Leo T, Fu Ling, Mancini Ronald, Martin-Rehrmann Matthew D, Saunders Aleister J, Konopka Genevieve, Tian Di, Hedley-Whyte E Tessa, Folkerth Rebecca D, Goldstein Lee E", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" } ], "reference": [ { "type": "PubMed", "id": "15642333", "url": "https://glygen.org/publication/PubMed/15642333" } ] }, { "title": "t(9;11)(p22;p15) with NUP98-LEDGF fusion gene in pediatric acute myeloid leukemia.", "journal": "Leuk. Res.", "date": "2005", "authors": "Morerio Cristina, Acquila Maura, Rosanda Cristina, Rapella Annamaria, Tassano Elisa, Micalizzi Concetta, Panarello Claudio", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" } ], "reference": [ { "type": "PubMed", "id": "15725483", "url": "https://glygen.org/publication/PubMed/15725483" } ] }, { "title": "Importin-alpha promotes passage through the nuclear pore complex of human immunodeficiency virus type 1 Vpr.", "journal": "Journal of virology", "date": "2005", "authors": "Kamata M, Nitahara-Kasahara Y, Miyamoto Y, Yoneda Y, Aida Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-180910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180910" } ], "reference": [ { "type": "PubMed", "id": "15731250", "url": "https://glygen.org/publication/PubMed/15731250" } ] }, { "title": "The interaction of LEDGF/p75 with integrase is lentiviral-specific and promotes DNA binding.", "journal": "J. Biol. Chem.", "date": "2005", "authors": "Busschots Katrien, Vercammen Jo, Emiliani St\u00e9phane, Benarous Richard, Engelborghs Yves, Christ Frauke, Debyser Zeger", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" } ], "reference": [ { "type": "PubMed", "id": "15749713", "url": "https://glygen.org/publication/PubMed/15749713" } ] }, { "title": "Identification of the LEDGF/p75 HIV-1 integrase-interaction domain and NLS reveals NLS-independent chromatin tethering.", "journal": "J. Cell Sci.", "date": "2005", "authors": "Vanegas Maria, Llano Manuel, Delgado Sharon, Thompson Daniah, Peretz Mary, Poeschla Eric", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" } ], "reference": [ { "type": "PubMed", "id": "15797927", "url": "https://glygen.org/publication/PubMed/15797927" } ] }, { "title": "Solution structure of the HIV-1 integrase-binding domain in LEDGF/p75.", "journal": "Nature structural & molecular biology", "date": "2005", "authors": "Cherepanov P, Sun ZY, Rahman S, Maertens G, Wagner G, Engelman A", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" } ], "reference": [ { "type": "PubMed", "id": "15895093", "url": "https://glygen.org/publication/PubMed/15895093" } ] }, { "title": "Global phosphoproteome of HT-29 human colon adenocarcinoma cells.", "journal": "Journal of proteome research", "date": "2005", "authors": "Kim JE, Tannenbaum SR, White FM", "evidence": [ { "database": "iPTMnet", "id": "O75475-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75475-1" } ], "reference": [ { "type": "PubMed", "id": "16083285", "url": "https://glygen.org/publication/PubMed/16083285" } ] }, { "title": "Genome-wide analysis of retroviral DNA integration.", "journal": "Nature reviews. Microbiology", "date": "2005", "authors": "Bushman F, Lewinski M, Ciuffi A, Barr S, Leipzig J, Hannenhalli S, Hoffmann C", "evidence": [ { "database": "Reactome", "id": "R-HSA-162592", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-162592" } ], "reference": [ { "type": "PubMed", "id": "16175173", "url": "https://glygen.org/publication/PubMed/16175173" } ] }, { "title": "A human protein complex homologous to the Drosophila MSL complex is responsible for the majority of histone H4 acetylation at lysine 16.", "journal": "Molecular and cellular biology", "date": "2005", "authors": "Smith ER, Cayrou C, Huang R, Lane WS, Cote J, Lucchesi JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "16227571", "url": "https://glygen.org/publication/PubMed/16227571" } ] }, { "title": "The menin tumor suppressor protein is an essential oncogenic cofactor for MLL-associated leukemogenesis.", "journal": "Cell", "date": "2005-10-21", "authors": "Yokoyama Akihiko, Somervaille Tim C P, Smith Kevin S, Rozenblatt-Rosen Orit, Meyerson Matthew, Cleary Michael L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "16239140", "url": "https://glygen.org/publication/PubMed/16239140" } ] }, { "title": "Structural basis for the recognition between HIV-1 integrase and transcriptional coactivator p75.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2005", "authors": "Cherepanov Peter, Ambrosio Andre L B, Rahman Shaila, Ellenberger Tom, Engelman Alan", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" } ], "reference": [ { "type": "PubMed", "id": "16260736", "url": "https://glygen.org/publication/PubMed/16260736" } ] }, { "title": "Retroviral DNA integration--mechanism and consequences.", "journal": "Advances in genetics", "date": "2005", "authors": "Lewinski MK, Bushman FD", "evidence": [ { "database": "Reactome", "id": "R-HSA-162592", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-162592" } ], "reference": [ { "type": "PubMed", "id": "16291214", "url": "https://glygen.org/publication/PubMed/16291214" } ] }, { "title": "Histone H3 recognition and presentation by the WDR5 module of the MLL1 complex.", "journal": "Nature structural & molecular biology", "date": "2006-08", "authors": "Ruthenburg Alexander J, Wang Wooikoon, Graybosch Daina M, Li Haitao, Allis C David, Patel Dinshaw J, Verdine Gregory L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "16829959", "url": "https://glygen.org/publication/PubMed/16829959" } ] }, { "title": "Regulation of MLL1 H3K4 methyltransferase activity by its core components.", "journal": "Nature structural & molecular biology", "date": "2006-08", "authors": "Dou Yali, Milne Thomas A, Ruthenburg Alexander J, Lee Seunghee, Lee Jae Woon, Verdine Gregory L, Allis C David, Roeder Robert G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "16878130", "url": "https://glygen.org/publication/PubMed/16878130" } ] }, { "title": "Molecular regulation of H3K4 trimethylation by ASH2L, a shared subunit of MLL complexes.", "journal": "Nature structural & molecular biology", "date": "2006-09", "authors": "Steward Melissa M, Lee Jung-Shin, O'Donovan Aisling, Wyatt Matt, Bernstein Bradley E, Shilatifard Ali", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "16892064", "url": "https://glygen.org/publication/PubMed/16892064" } ] }, { "title": "A probability-based approach for high-throughput protein phosphorylation analysis and site localization.", "journal": "Nature biotechnology", "date": "2006", "authors": "Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP", "evidence": [ { "database": "iPTMnet", "id": "O75475-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75475-1" } ], "reference": [ { "type": "PubMed", "id": "16964243", "url": "https://glygen.org/publication/PubMed/16964243" } ] }, { "title": "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.", "journal": "Cell", "date": "2006", "authors": "Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" }, { "database": "iPTMnet", "id": "O75475-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75475-1" } ], "reference": [ { "type": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ] }, { "title": "Global proteomic profiling of phosphopeptides using electron transfer dissociation tandem mass spectrometry.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Molina H, Horn DM, Tang N, Mathivanan S, Pandey A", "evidence": [ { "database": "iPTMnet", "id": "O75475-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75475-1" } ], "reference": [ { "type": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" } ] }, { "title": "Identification and characterization of the human Set1B histone H3-Lys4 methyltransferase complex.", "journal": "The Journal of biological chemistry", "date": "2007-05-04", "authors": "Lee Jeong-Heon, Tate Courtney M, You Jin-Sam, Skalnik David G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "17355966", "url": "https://glygen.org/publication/PubMed/17355966" } ] }, { "title": "PTIP associates with MLL3- and MLL4-containing histone H3 lysine 4 methyltransferase complex.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Cho YW, Hong T, Hong S, Guo H, Yu H, Kim D, Guszczynski T, Dressler GR, Copeland TD, Kalkum M, Ge K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "17500065", "url": "https://glygen.org/publication/PubMed/17500065" } ] }, { "title": "ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.", "journal": "Science (New York, N.Y.)", "date": "2007", "authors": "Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" }, { "database": "iPTMnet", "id": "O75475-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75475-1" } ], "reference": [ { "type": "PubMed", "id": "17525332", "url": "https://glygen.org/publication/PubMed/17525332" } ] }, { "title": "E2F activation of S phase promoters via association with HCF-1 and the MLL family of histone H3K4 methyltransferases.", "journal": "Molecular cell", "date": "2007-07-06", "authors": "Tyagi Shweta, Chabes Anna Lena, Wysocka Joanna, Herr Winship", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "17612494", "url": "https://glygen.org/publication/PubMed/17612494" } ] }, { "title": "Interaction of MLL amino terminal sequences with menin is required for transformation.", "journal": "Cancer research", "date": "2007-08-01", "authors": "Caslini Corrado, Yang Zhaohai, El-Osta Mohamad, Milne Thomas A, Slany Robert K, Hess Jay L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "17671196", "url": "https://glygen.org/publication/PubMed/17671196" } ] }, { "title": "The BRCT-domain containing protein PTIP links PAX2 to a histone H3, lysine 4 methyltransferase complex.", "journal": "Developmental cell", "date": "2007-10", "authors": "Patel Sanjeevkumar R, Kim Doyeob, Levitan Inna, Dressler Gregory R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "17925232", "url": "https://glygen.org/publication/PubMed/17925232" } ] }, { "title": "Wdr82 is a C-terminal domain-binding protein that recruits the Setd1A Histone H3-Lys4 methyltransferase complex to transcription start sites of transcribed human genes.", "journal": "Molecular and cellular biology", "date": "2008", "authors": "Lee JH, Skalnik DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "17998332", "url": "https://glygen.org/publication/PubMed/17998332" } ] }, { "title": "Hydrophilic interaction chromatography reduces the complexity of the phosphoproteome and improves global phosphopeptide isolation and detection.", "journal": "Molecular & cellular proteomics : MCP", "date": "2008", "authors": "McNulty DE, Annan RS", "evidence": [ { "database": "iPTMnet", "id": "O75475-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75475-1" } ], "reference": [ { "type": "PubMed", "id": "18212344", "url": "https://glygen.org/publication/PubMed/18212344" } ] }, { "title": "Large-scale phosphoproteome analysis of human liver tissue by enrichment and fractionation of phosphopeptides with strong anion exchange chromatography.", "journal": "Proteomics", "date": "2008", "authors": "Han G, Ye M, Zhou H, Jiang X, Feng S, Jiang X, Tian R, Wan D, Zou H, Gu J", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" } ], "reference": [ { "type": "PubMed", "id": "18318008", "url": "https://glygen.org/publication/PubMed/18318008" } ] }, { "title": "Motif-specific sampling of phosphoproteomes.", "journal": "Journal of proteome research", "date": "2008", "authors": "Ruse CI, McClatchy DB, Lu B, Cociorva D, Motoyama A, Park SK, Yates JR 3rd", "evidence": [ { "database": "iPTMnet", "id": "O75475-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75475-1" } ], "reference": [ { "type": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" } ] }, { "title": "Menin critically links MLL proteins with LEDGF on cancer-associated target genes.", "journal": "Cancer cell", "date": "2008-07-08", "authors": "Yokoyama Akihiko, Cleary Michael L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "18598942", "url": "https://glygen.org/publication/PubMed/18598942" } ] }, { "title": "A quantitative atlas of mitotic phosphorylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" }, { "database": "iPTMnet", "id": "O75475-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75475-1" } ], "reference": [ { "type": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ] }, { "title": "A conserved arginine-containing motif crucial for the assembly and enzymatic activity of the mixed lineage leukemia protein-1 core complex.", "journal": "The Journal of biological chemistry", "date": "2008-11-21", "authors": "Patel Anamika, Vought Valarie E, Dharmarajan Venkatasubramanian, Cosgrove Michael S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "18829457", "url": "https://glygen.org/publication/PubMed/18829457" } ] }, { "title": "Structure of WDR5 bound to mixed lineage leukemia protein-1 peptide.", "journal": "The Journal of biological chemistry", "date": "2008-11-21", "authors": "Patel Anamika, Dharmarajan Venkatasubramanian, Cosgrove Michael S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "18829459", "url": "https://glygen.org/publication/PubMed/18829459" } ] }, { "title": "Human ATAC Is a GCN5/PCAF-containing acetylase complex with a novel NC2-like histone fold module that interacts with the TATA-binding protein.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Wang YL, Faiola F, Xu M, Pan S, Martinez E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "18838386", "url": "https://glygen.org/publication/PubMed/18838386" } ] }, { "title": "Molecular regulation of H3K4 trimethylation by Wdr82, a component of human Set1/COMPASS.", "journal": "Molecular and cellular biology", "date": "2008-12", "authors": "Wu Min, Wang Peng Fei, Lee Jung Shin, Martin-Brown Skylar, Florens Laurence, Washburn Michael, Shilatifard Ali", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "18838538", "url": "https://glygen.org/publication/PubMed/18838538" } ] }, { "title": "The double-histone-acetyltransferase complex ATAC is essential for mammalian development.", "journal": "Molecular and cellular biology", "date": "2009", "authors": "Guelman S, Kozuka K, Mao Y, Pham V, Solloway MJ, Wang J, Wu J, Lill JR, Zha J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "19103755", "url": "https://glygen.org/publication/PubMed/19103755" } ] }, { "title": "Accumulation of Pax2 transactivation domain interaction protein (PTIP) at sites of DNA breaks via RNF8-dependent pathway is required for cell survival after DNA damage.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Gong Z, Cho YW, Kim JE, Ge K, Chen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "19124460", "url": "https://glygen.org/publication/PubMed/19124460" } ] }, { "title": "Structural basis for the requirement of additional factors for MLL1 SET domain activity and recognition of epigenetic marks.", "journal": "Molecular cell", "date": "2009", "authors": "Southall SM, Wong PS, Odho Z, Roe SM, Wilson JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "19187761", "url": "https://glygen.org/publication/PubMed/19187761" } ] }, { "title": "Lens epithelium-derived growth factor/p75 interacts with the transposase-derived DDE domain of PogZ.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Bartholomeeusen K, Christ F, Hendrix J, Rain JC, Emiliani S, Benarous R, Debyser Z, Gijsbers R, De Rijck J", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" } ], "reference": [ { "type": "PubMed", "id": "19244240", "url": "https://glygen.org/publication/PubMed/19244240" } ] }, { "title": "Phosphorylation analysis of primary human T lymphocytes using sequential IMAC and titanium oxide enrichment.", "journal": "J. Proteome Res.", "date": "2008", "authors": "Carrascal M, Ovelleiro D, Casas V, Gay M, Abian J", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" } ], "reference": [ { "type": "PubMed", "id": "19367720", "url": "https://glygen.org/publication/PubMed/19367720" } ] }, { "title": "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.", "journal": "Analytical chemistry", "date": "2009", "authors": "Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S", "evidence": [ { "database": "iPTMnet", "id": "O75475-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75475-1" } ], "reference": [ { "type": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" } ] }, { "title": "Phosphoproteomic analysis of distinct tumor cell lines in response to nocodazole treatment.", "journal": "Proteomics", "date": "2009", "authors": "Nagano K, Shinkawa T, Mutoh H, Kondoh O, Morimoto S, Inomata N, Ashihara M, Ishii N, Aoki Y, Haramura M", "evidence": [ { "database": "iPTMnet", "id": "O75475-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75475-1" } ], "reference": [ { "type": "PubMed", "id": "19415658", "url": "https://glygen.org/publication/PubMed/19415658" } ] }, { "title": "On the mechanism of multiple lysine methylation by the human mixed lineage leukemia protein-1 (MLL1) core complex.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Patel A, Dharmarajan V, Vought VE, Cosgrove MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "19556245", "url": "https://glygen.org/publication/PubMed/19556245" } ] }, { "title": "Global effects of kinase inhibitors on signaling networks revealed by quantitative phosphoproteomics.", "journal": "Molecular & cellular proteomics : MCP", "date": "2009", "authors": "Pan C, Olsen JV, Daub H, Mann M", "evidence": [ { "database": "iPTMnet", "id": "O75475-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75475-1" } ], "reference": [ { "type": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" } ] }, { "title": "Phosphorylation dynamics during early differentiation of human embryonic stem cells.", "journal": "Cell stem cell", "date": "2009", "authors": "Van Hoof D, Munoz J, Braam SR, Pinkse MW, Linding R, Heck AJ, Mummery CL, Krijgsveld J", "evidence": [ { "database": "iPTMnet", "id": "O75475-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75475-1" } ], "reference": [ { "type": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" } ] }, { "title": "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.", "journal": "Science signaling", "date": "2009", "authors": "Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" }, { "database": "iPTMnet", "id": "O75475", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75475" } ], "reference": [ { "type": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" } ] }, { "title": "Transcriptional co-activator LEDGF interacts with Cdc7-activator of S-phase kinase (ASK) and stimulates its enzymatic activity.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Hughes S, Jenkins V, Dar MJ, Engelman A, Cherepanov P", "evidence": [ { "database": "iPTMnet", "id": "O75475", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75475" } ], "reference": [ { "type": "PubMed", "id": "19864417", "url": "https://glygen.org/publication/PubMed/19864417" } ] }, { "title": "Subunit composition and substrate specificity of a MOF-containing histone acetyltransferase distinct from the male-specific lethal (MSL) complex.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Cai Y, Jin J, Swanson SK, Cole MD, Choi SH, Florens L, Washburn MP, Conaway JW, Conaway RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "20018852", "url": "https://glygen.org/publication/PubMed/20018852" } ] }, { "title": "Extensive crosstalk between O-GlcNAcylation and phosphorylation regulates cytokinesis.", "journal": "Science signaling", "date": "2010", "authors": "Wang Z, Udeshi ND, Slawson C, Compton PD, Sakabe K, Cheung WD, Shabanowitz J, Hunt DF, Hart GW", "evidence": [ { "database": "iPTMnet", "id": "O75475-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75475-1" } ], "reference": [ { "type": "PubMed", "id": "20068230", "url": "https://glygen.org/publication/PubMed/20068230" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" }, { "database": "iPTMnet", "id": "O75475-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75475-1" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "Phosphoproteome analysis of human liver tissue by long-gradient nanoflow LC coupled with multiple stage MS analysis.", "journal": "Electrophoresis", "date": "2010", "authors": "Han G, Ye M, Liu H, Song C, Sun D, Wu Y, Jiang X, Chen R, Wang C, Wang L, Zou H", "evidence": [ { "database": "iPTMnet", "id": "O75475-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75475-1" } ], "reference": [ { "type": "PubMed", "id": "20166139", "url": "https://glygen.org/publication/PubMed/20166139" } ] }, { "title": "Analysis of the binding of mixed lineage leukemia 1 (MLL1) and histone 3 peptides to WD repeat domain 5 (WDR5) for the design of inhibitors of the MLL1-WDR5 interaction.", "journal": "Journal of medicinal chemistry", "date": "2010-07-22", "authors": "Karatas Hacer, Townsend Elizabeth C, Bernard Denzil, Dou Yali, Wang Shaomeng", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "20575550", "url": "https://glygen.org/publication/PubMed/20575550" } ] }, { "title": "Characterization of a novel WDR5-binding site that recruits RbBP5 through a conserved motif to enhance methylation of histone H3 lysine 4 by mixed lineage leukemia protein-1.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Odho Z, Southall SM, Wilson JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "20716525", "url": "https://glygen.org/publication/PubMed/20716525" } ] }, { "title": "Molecular basis of the mixed lineage leukemia-menin interaction: implications for targeting mixed lineage leukemias.", "journal": "The Journal of biological chemistry", "date": "2010-12-24", "authors": "Grembecka Jolanta, Belcher Amalia M, Hartley Thomas, Cierpicki Tomasz", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "20961854", "url": "https://glygen.org/publication/PubMed/20961854" } ] }, { "title": "A novel non-SET domain multi-subunit methyltransferase required for sequential nucleosomal histone H3 methylation by the mixed lineage leukemia protein-1 (MLL1) core complex.", "journal": "The Journal of biological chemistry", "date": "2011-02-04", "authors": "Patel Anamika, Vought Valarie E, Dharmarajan Venkatasubramanian, Cosgrove Michael S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "21106533", "url": "https://glygen.org/publication/PubMed/21106533" } ] }, { "title": "An Ash2L/RbBP5 heterodimer stimulates the MLL1 methyltransferase activity through coordinated substrate interactions with the MLL1 SET domain.", "journal": "PloS one", "date": "2010-11-23", "authors": "Cao Fang, Chen Yong, Cierpicki Tomasz, Liu Yifan, Basrur Venkatesha, Lei Ming, Dou Yali", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "21124902", "url": "https://glygen.org/publication/PubMed/21124902" } ] }, { "title": "Distinct roles of GCN5/PCAF-mediated H3K9ac and CBP/p300-mediated H3K18/27ac in nuclear receptor transactivation.", "journal": "The EMBO journal", "date": "2011-01-19", "authors": "Jin Qihuang, Yu Li-Rong, Wang Lifeng, Zhang Zhijing, Kasper Lawryn H, Lee Ji-Eun, Wang Chaochen, Brindle Paul K, Dent Sharon Y R, Ge Kai", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "21131905", "url": "https://glygen.org/publication/PubMed/21131905" } ] }, { "title": "Fine-tuning the stimulation of MLL1 methyltransferase activity by a histone H3-based peptide mimetic.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2011-03", "authors": "Avdic Vanja, Zhang Pamela, Lanouette Sylvain, Voronova Anastassia, Skerjanc Ilona, Couture Jean-Francois", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "21135039", "url": "https://glygen.org/publication/PubMed/21135039" } ] }, { "title": "Structural and biochemical insights into MLL1 core complex assembly.", "journal": "Structure (London, England : 1993)", "date": "2011", "authors": "Avdic V, Zhang P, Lanouette S, Groulx A, Tremblay V, Brunzelle J, Couture JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "21220120", "url": "https://glygen.org/publication/PubMed/21220120" } ] }, { "title": "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.", "journal": "Science signaling", "date": "2011", "authors": "Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" }, { "database": "iPTMnet", "id": "O75475", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75475" } ], "reference": [ { "type": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" } ] }, { "title": "Retroviral DNA integration directed by HIV integration protein in vitro.", "journal": "Science (New York, N.Y.)", "date": "1990", "authors": "Bushman FD, Fujiwara T, Craigie R", "evidence": [ { "database": "Reactome", "id": "R-HSA-162592", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-162592" } ], "reference": [ { "type": "PubMed", "id": "2171144", "url": "https://glygen.org/publication/PubMed/2171144" } ] }, { "title": "The plasticity of WDR5 peptide-binding cleft enables the binding of the SET1 family of histone methyltransferases.", "journal": "Nucleic acids research", "date": "2012-05", "authors": "Zhang Pamela, Lee Hwabin, Brunzelle Joseph S, Couture Jean-Francois", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "22266653", "url": "https://glygen.org/publication/PubMed/22266653" } ] }, { "title": "The same pocket in menin binds both MLL and JUND but has opposite effects on transcription.", "journal": "Nature", "date": "2012", "authors": "Huang J, Gurung B, Wan B, Matkar S, Veniaminova NA, Wan K, Merchant JL, Hua X, Lei M", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" }, { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "22327296", "url": "https://glygen.org/publication/PubMed/22327296" } ] }, { "title": "WRAD: enabler of the SET1-family of H3K4 methyltransferases.", "journal": "Briefings in functional genomics", "date": "2012-05", "authors": "Ernst Patricia, Vakoc Christopher R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "22652693", "url": "https://glygen.org/publication/PubMed/22652693" } ] }, { "title": "Structural basis for WDR5 interaction (Win) motif recognition in human SET1 family histone methyltransferases.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Dharmarajan V, Lee JH, Patel A, Skalnik DG, Cosgrove MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "22665483", "url": "https://glygen.org/publication/PubMed/22665483" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" }, { "database": "iPTMnet", "id": "O75475", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75475" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "Proteome wide purification and identification of O-GlcNAc-modified proteins using click chemistry and mass spectrometry.", "journal": "Journal of proteome research", "date": "2013", "authors": "Hahne H, Sobotzki N, Nyberg T, Helm D, Borodkin VS, van Aalten DM, Agnew B, Kuster B", "evidence": [ { "database": "O-GlcNAc Database", "id": "O75475", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75475" } ], "reference": [ { "type": "PubMed", "id": "23301498", "url": "https://glygen.org/publication/PubMed/23301498" } ] }, { "title": "Quantitative dissection and stoichiometry determination of the human SET1/MLL histone methyltransferase complexes.", "journal": "Molecular and cellular biology", "date": "2013-05", "authors": "van Nuland Rick, Smits Arne H, Pallaki Paschalina, Jansen Pascal W T C, Vermeulen Michiel, Timmers H T Marc", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "23508102", "url": "https://glygen.org/publication/PubMed/23508102" } ] }, { "title": "Regulation of transcription by the MLL2 complex and MLL complex-associated AKAP95.", "journal": "Nature structural & molecular biology", "date": "2013", "authors": "Jiang H, Lu X, Shimada M, Dou Y, Tang Z, Roeder RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "23995757", "url": "https://glygen.org/publication/PubMed/23995757" } ] }, { "title": "Crosstalk between NSL histone acetyltransferase and MLL/SET complexes: NSL complex functions in promoting histone H3K4 di-methylation activity by MLL/SET complexes.", "journal": "PLoS genetics", "date": "2013-11", "authors": "Zhao Xiaoming, Su Jiaming, Wang Fei, Liu Da, Ding Jian, Yang Yang, Conaway Joan W, Conaway Ronald C, Cao Lingling, Wu Donglu, Wu Min, Cai Yong, Jin Jingji", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "24244196", "url": "https://glygen.org/publication/PubMed/24244196" } ] }, { "title": "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.", "journal": "Journal of proteomics", "date": "2014", "authors": "Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" }, { "database": "iPTMnet", "id": "O75475", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75475" } ], "reference": [ { "type": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" } ] }, { "title": "H3K4 mono- and di-methyltransferase MLL4 is required for enhancer activation during cell differentiation.", "journal": "eLife", "date": "2013", "authors": "Lee JE, Wang C, Xu S, Cho YW, Wang L, Feng X, Baldridge A, Sartorelli V, Zhuang L, Peng W, Ge K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "24368734", "url": "https://glygen.org/publication/PubMed/24368734" } ] }, { "title": "A non-active-site SET domain surface crucial for the interaction of MLL1 and the RbBP5/Ash2L heterodimer within MLL family core complexes.", "journal": "Journal of molecular biology", "date": "2014-06-12", "authors": "Shinsky Stephen A, Hu Michael, Vought Valarie E, Ng Sarah B, Bamshad Michael J, Shendure Jay, Cosgrove Michael S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "24680668", "url": "https://glygen.org/publication/PubMed/24680668" } ] }, { "title": "Validation and structural characterization of the LEDGF/p75-MLL interface as a new target for the treatment of MLL-dependent leukemia.", "journal": "Cancer research", "date": "2014", "authors": "Cermakova K, Tesina P, Demeulemeester J, El Ashkar S, Mereau H, Schwaller J, Rezacova P, Veverka V, De Rijck J", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" } ], "reference": [ { "type": "PubMed", "id": "25082813", "url": "https://glygen.org/publication/PubMed/25082813" } ] }, { "title": "The same site on the integrase-binding domain of lens epithelium-derived growth factor is a therapeutic target for MLL leukemia and HIV.", "journal": "Blood", "date": "2014", "authors": "Murai MJ, Pollock J, He S, Miao H, Purohit T, Yokom A, Hess JL, Muntean AG, Grembecka J, Cierpicki T", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" } ], "reference": [ { "type": "PubMed", "id": "25305204", "url": "https://glygen.org/publication/PubMed/25305204" } ] }, { "title": "Retroviral integration: structure of the initial covalent product and its precursor, and a role for the viral IN protein.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1989", "authors": "Brown PO, Bowerman B, Varmus HE, Bishop JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-162592", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-162592" } ], "reference": [ { "type": "PubMed", "id": "2539592", "url": "https://glygen.org/publication/PubMed/2539592" } ] }, { "title": "Biochemical reconstitution and phylogenetic comparison of human SET1 family core complexes involved in histone methylation.", "journal": "The Journal of biological chemistry", "date": "2015", "authors": "Shinsky SA, Monteith KE, Viggiano S, Cosgrove MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "25561738", "url": "https://glygen.org/publication/PubMed/25561738" } ] }, { "title": "A phosphorylation switch on RbBP5 regulates histone H3 Lys4 methylation.", "journal": "Genes & development", "date": "2015", "authors": "Zhang P, Chaturvedi CP, Tremblay V, Cramet M, Brunzelle JS, Skiniotis G, Brand M, Shilatifard A, Couture JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "25593305", "url": "https://glygen.org/publication/PubMed/25593305" } ] }, { "title": "Unique Role of the WD-40 Repeat Protein 5 (WDR5) Subunit within the Mixed Lineage Leukemia 3 (MLL3) Histone Methyltransferase Complex.", "journal": "The Journal of biological chemistry", "date": "2015", "authors": "Shinsky SA, Cosgrove MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "26324722", "url": "https://glygen.org/publication/PubMed/26324722" } ] }, { "title": "Structural basis for activity regulation of MLL family methyltransferases.", "journal": "Nature", "date": "2016", "authors": "Li Y, Han J, Zhang Y, Cao F, Liu Z, Li S, Wu J, Hu C, Wang Y, Shuai J, Chen J, Cao L, Li D, Shi P, Tian C, Zhang J, Dou Y, Li G, Chen Y, Lei M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "26886794", "url": "https://glygen.org/publication/PubMed/26886794" } ] }, { "title": "Targeted Disruption of the Interaction between WD-40 Repeat Protein 5 (WDR5) and Mixed Lineage Leukemia (MLL)/SET1 Family Proteins Specifically Inhibits MLL1 and SETd1A Methyltransferase Complexes.", "journal": "The Journal of biological chemistry", "date": "2016-10-21", "authors": "Alicea-Vel\u00e1zquez Nilda L, Shinsky Stephen A, Loh Daniel M, Lee Jeong-Heon, Skalnik David G, Cosgrove Michael S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "27563068", "url": "https://glygen.org/publication/PubMed/27563068" } ] }, { "title": "Enhancer priming by H3K4 methyltransferase MLL4 controls cell fate transition.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2016-10-18", "authors": "Wang Chaochen, Lee Ji-Eun, Lai Binbin, Macfarlan Todd S, Xu Shiliyang, Zhuang Lenan, Liu Chengyu, Peng Weiqun, Ge Kai", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "27698142", "url": "https://glygen.org/publication/PubMed/27698142" } ] }, { "title": "PHF20 Readers Link Methylation of Histone H3K4 and p53 with H4K16 Acetylation.", "journal": "Cell reports", "date": "2016", "authors": "Klein BJ, Wang X, Cui G, Yuan C, Botuyan MV, Lin K, Lu Y, Wang X, Zhao Y, Bruns CJ, Mer G, Shi X, Kutateladze TG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "27760318", "url": "https://glygen.org/publication/PubMed/27760318" } ] }, { "title": "Somatic cancer mutations in the MLL1 histone methyltransferase modulate its enzymatic activity and dependence on the WDR5/RBBP5/ASH2L complex.", "journal": "Molecular oncology", "date": "2017", "authors": "Weirich S, Kudithipudi S, Jeltsch A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "28182322", "url": "https://glygen.org/publication/PubMed/28182322" } ] }, { "title": "MLL3/MLL4 are required for CBP/p300 binding on enhancers and super-enhancer formation in brown adipogenesis.", "journal": "Nucleic acids research", "date": "2017-06-20", "authors": "Lai Binbin, Lee Ji-Eun, Jang Younghoon, Wang Lifeng, Peng Weiqun, Ge Kai", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "28398509", "url": "https://glygen.org/publication/PubMed/28398509" } ] }, { "title": "Synthesis of a Highly Azide-Reactive and Thermosensitive Biofunctional Reagent for Efficient Enrichment and Large-Scale Identification of O-GlcNAc Proteins by Mass Spectrometry.", "journal": "Analytical chemistry", "date": "2017", "authors": "Zhang W, Liu T, Dong H, Bai H, Tian F, Shi Z, Chen M, Wang J, Qin W, Qian X", "evidence": [ { "database": "O-GlcNAc Database", "id": "O75475", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75475" } ], "reference": [ { "type": "PubMed", "id": "28510447", "url": "https://glygen.org/publication/PubMed/28510447" } ] }, { "title": "A cytoplasmic COMPASS is necessary for cell survival and triple-negative breast cancer pathogenesis by regulating metabolism.", "journal": "Genes & development", "date": "2017-10-15", "authors": "Wang Lu, Collings Clayton K, Zhao Zibo, Cozzolino Kira Alia, Ma Quanhong, Liang Kaiwei, Marshall Stacy A, Sze Christie C, Hashizume Rintaro, Savas Jeffrey Nicholas, Shilatifard Ali", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "29138278", "url": "https://glygen.org/publication/PubMed/29138278" } ] }, { "title": "Mapping and Quantification of Over 2000 O-linked Glycopeptides in Activated Human T Cells with Isotope-Targeted Glycoproteomics (Isotag).", "journal": "Molecular & cellular proteomics : MCP", "date": "2018", "authors": "Woo CM, Lund PJ, Huang AC, Davis MM, Bertozzi CR, Pitteri SJ", "evidence": [ { "database": "O-GlcNAc Database", "id": "O75475", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75475" }, { "database": "O-GlcNAc Atlas", "id": "O75475", "url": "https://oglcnac.org/atlas/detail/O75475" }, { "database": "GlyGen", "id": "GLY_000142", "url": "https://data.glygen.org/GLY_000142" } ], "reference": [ { "type": "PubMed", "id": "29351928", "url": "https://glygen.org/publication/PubMed/29351928" } ] }, { "title": "The structure of the RbBP5 beta-propeller domain reveals a surface with potential nucleic acid binding sites.", "journal": "Nucleic acids research", "date": "2018", "authors": "Mittal A, Hobor F, Zhang Y, Martin SR, Gamblin SJ, Ramos A, Wilson JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "29897600", "url": "https://glygen.org/publication/PubMed/29897600" } ] }, { "title": "Histone Methylation by SETD1A Protects Nascent DNA through the Nucleosome Chaperone Activity of FANCD2.", "journal": "Molecular cell", "date": "2018", "authors": "Higgs MR, Sato K, Reynolds JJ, Begum S, Bayley R, Goula A, Vernet A, Paquin KL, Skalnik DG, Kobayashi W, Takata M, Howlett NG, Kurumizaka H, Kimura H, Stewart GS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "29937342", "url": "https://glygen.org/publication/PubMed/29937342" } ] }, { "title": "Affinity switching of the LEDGF/p75 IBD interactome is governed by kinase-dependent phosphorylation.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2018", "authors": "Sharma S, Cermakova K, De Rijck J, Demeulemeester J, Fabry M, El Ashkar S, Van Belle S, Lepsik M, Tesina P, Duchoslav V, Novak P, Hubalek M, Srb P, Christ F, Rezacova P, Hodges HC, Debyser Z, Veverka V", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" } ], "reference": [ { "type": "PubMed", "id": "29997176", "url": "https://glygen.org/publication/PubMed/29997176" } ] }, { "title": "Correct integration of retroviral DNA in vitro.", "journal": "Cell", "date": "1987", "authors": "Brown PO, Bowerman B, Varmus HE, Bishop JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-162592", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-162592" } ], "reference": [ { "type": "PubMed", "id": "3032450", "url": "https://glygen.org/publication/PubMed/3032450" } ] }, { "title": "The MLL1 trimeric catalytic complex is a dynamic conformational ensemble stabilized by multiple weak interactions.", "journal": "Nucleic acids research", "date": "2019", "authors": "Kaustov L, Lemak A, Wu H, Faini M, Fan L, Fang X, Zeng H, Duan S, Allali-Hassani A, Li F, Wei Y, Vedadi M, Aebersold R, Wang Y, Houliston S, Arrowsmith CH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "31400120", "url": "https://glygen.org/publication/PubMed/31400120" } ] }, { "title": "Structural basis of nucleosome recognition and modification by MLL methyltransferases.", "journal": "Nature", "date": "2019-09", "authors": "Xue Han, Yao Tonghui, Cao Mi, Zhu Guanjun, Li Yan, Yuan Guiyong, Chen Yong, Lei Ming, Huang Jing", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "31485071", "url": "https://glygen.org/publication/PubMed/31485071" } ] }, { "title": "The internal interaction in RBBP5 regulates assembly and activity of MLL1 methyltransferase complex.", "journal": "Nucleic acids research", "date": "2019", "authors": "Han J, Li T, Li Y, Li M, Wang X, Peng C, Su C, Li N, Li Y, Xu Y, Chen Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "31544921", "url": "https://glygen.org/publication/PubMed/31544921" } ] }, { "title": "Proteomic profiling and genome-wide mapping of O-GlcNAc chromatin-associated proteins reveal an O-GlcNAc-regulated genotoxic stress response.", "journal": "Nature communications", "date": "2020", "authors": "Liu Y, Chen Q, Zhang N, Zhang K, Dou T, Cao Y, Liu Y, Li K, Hao X, Xie X, Li W, Ren Y, Zhang J", "evidence": [ { "database": "O-GlcNAc Database", "id": "O75475", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75475" } ], "reference": [ { "type": "PubMed", "id": "33214551", "url": "https://glygen.org/publication/PubMed/33214551" } ] }, { "title": "Unlike Its Paralog LEDGF/p75, HRP-2 Is Dispensable for MLL-R Leukemogenesis but Important for Leukemic Cell Survival.", "journal": "Cells", "date": "2021", "authors": "Van Belle S, El Ashkar S, Cermakova K, Matthijssens F, Goossens S, Canella A, Hodges CH, Christ F, De Rijck J, Van Vlierberghe P, Veverka V, Debyser Z", "evidence": [ { "database": "RefSeq", "id": "NP_001121689", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001121689" } ], "reference": [ { "type": "PubMed", "id": "33477970", "url": "https://glygen.org/publication/PubMed/33477970" } ] }, { "title": "Complex-dependent histone acetyltransferase activity of KAT8 determines its role in transcription and cellular homeostasis.", "journal": "Molecular cell", "date": "2021", "authors": "Radzisheuskaya A, Shliaha PV, Grinev VV, Shlyueva D, Damhofer H, Koche R, Gorshkov V, Kovalchuk S, Zhan Y, Rodriguez KL, Johnstone AL, Keogh MC, Hendrickson RC, Jensen ON, Helin K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "33657400", "url": "https://glygen.org/publication/PubMed/33657400" } ] }, { "title": "Mechanism for DPY30 and ASH2L intrinsically disordered regions to modulate the MLL/SET1 activity on chromatin.", "journal": "Nature communications", "date": "2021", "authors": "Lee YT, Ayoub A, Park SH, Sha L, Xu J, Mao F, Zheng W, Zhang Y, Cho US, Dou Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "34012049", "url": "https://glygen.org/publication/PubMed/34012049" } ] }, { "title": "O-GlcNAc modification regulates MTA1 transcriptional activity during breast cancer cell genotoxic adaptation.", "journal": "Biochimica et biophysica acta. General subjects", "date": "2021", "authors": "Xie X, Wu Q, Zhang K, Liu Y, Zhang N, Chen Q, Wang L, Li W, Zhang J, Liu Y", "evidence": [ { "database": "O-GlcNAc Database", "id": "O75475", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75475" } ], "reference": [ { "type": "PubMed", "id": "34019948", "url": "https://glygen.org/publication/PubMed/34019948" } ] }, { "title": "LEDGF/p75 Is Required for an Efficient DNA Damage Response.", "journal": "International journal of molecular sciences", "date": "2021", "authors": "Liedtke V, Schroder C, Roggenbuck D, Weiss R, Stohwasser R, Schierack P, Rodiger S, Schenk L", "evidence": [ { "database": "RefSeq", "id": "NP_001121689", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001121689" } ], "reference": [ { "type": "PubMed", "id": "34070855", "url": "https://glygen.org/publication/PubMed/34070855" } ] }, { "title": "The LncRNA MIR155HG is Upregulated by SP1 in Melanoma Cells and Drives Melanoma Progression via Modulating the MiR-485-3p/PSIP1 Axis.", "journal": "Anti-cancer agents in medicinal chemistry", "date": "2022", "authors": "Huo J, Wang Y, Zhang Y, Wang W, Yang P, Zhao W, Zhang M, Cui L, Zhang D", "evidence": [ { "database": "RefSeq", "id": "NP_001121689", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001121689" } ], "reference": [ { "type": "PubMed", "id": "34225636", "url": "https://glygen.org/publication/PubMed/34225636" } ] }, { "title": "Modulation of the intrinsic chromatin binding property of HIV-1 integrase by LEDGF/p75.", "journal": "Nucleic acids research", "date": "2021", "authors": "Lapaillerie D, Lelandais B, Mauro E, Lagadec F, Tumiotto C, Miskey C, Ferran G, Kuschner N, Calmels C, Metifiot M, Rooryck C, Ivics Z, Ruff M, Zimmer C, Lesbats P, Toutain J, Parissi V", "evidence": [ { "database": "RefSeq", "id": "NP_001121689", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001121689" } ], "reference": [ { "type": "PubMed", "id": "34634812", "url": "https://glygen.org/publication/PubMed/34634812" } ] }, { "title": "The LEDGF/p75 Integrase Binding Domain Interactome Contributes to the Survival, Clonogenicity, and Tumorsphere Formation of Docetaxel-Resistant Prostate Cancer Cells.", "journal": "Cells", "date": "2021", "authors": "Ortiz-Hernandez GL, Sanchez-Hernandez ES, Ochoa PT, Elix CC, Alkashgari HR, McMullen JRW, Soto U, Martinez SR, Diaz Osterman CJ, Mahler M, Roy S, Casiano CA", "evidence": [ { "database": "RefSeq", "id": "NP_001121689", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001121689" } ], "reference": [ { "type": "PubMed", "id": "34685704", "url": "https://glygen.org/publication/PubMed/34685704" } ] }, { "title": "GRWD1-WDR5-MLL2 Epigenetic Complex Mediates H3K4me3 Mark and Is Essential for Kaposi's Sarcoma-Associated Herpesvirus-Induced Cellular Transformation.", "journal": "mBio", "date": "2021", "authors": "Wei S, Lu S, Liang L, Wang X, Li W, Li T, Chen L, Ju E, Zhang X, Lai Z, Huang Y, Lu X, Gao SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "34933446", "url": "https://glygen.org/publication/PubMed/34933446" } ] }, { "title": "Methyl-lysine readers PHF20 and PHF20L1 define two distinct\u00a0gene expression-regulating NSL complexes.", "journal": "The Journal of biological chemistry", "date": "2022-03", "authors": "Van Hieu T, Harkins Peter R, Patel Avni, Jain Abhinav K, Lu Yue, Bedford Mark T, Santos Margarida A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "35033534", "url": "https://glygen.org/publication/PubMed/35033534" } ] }, { "title": "Disentangling the recognition complexity of a protein hub using a nanopore.", "journal": "Nature communications", "date": "2022-02-21", "authors": "Mayse Lauren Ashley, Imran Ali, Larimi Motahareh Ghahari, Cosgrove Michael S, Wolfe Aaron James, Movileanu Liviu", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "35190547", "url": "https://glygen.org/publication/PubMed/35190547" } ] }, { "title": "H3K4 methylation by SETD1A/BOD1L facilitates RIF1-dependent NHEJ.", "journal": "Molecular cell", "date": "2022-05-19", "authors": "Bayley Rachel, Borel Valerie, Moss Rhiannon J, Sweatman Ellie, Ruis Philip, Ormrod Alice, Goula Amalia, Mottram Rachel M A, Stanage Tyler, Hewitt Graeme, Saponaro Marco, Stewart Grant S, Boulton Simon J, Higgs Martin R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9772755", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755" } ], "reference": [ { "type": "PubMed", "id": "35439434", "url": "https://glygen.org/publication/PubMed/35439434" } ] }, { "title": "Extracellular arginine availability modulates eIF2\u03b1 O-GlcNAcylation and heme oxygenase 1 translation for cellular homeostasis.", "journal": "Journal of biomedical science", "date": "2023-05-22", "authors": "Hung Yu-Wen, Ouyang Ching, Ping Xiaoli, Qi Yue, Wang Yi-Chang, Kung Hsing-Jien, Ann David K", "evidence": [ { "database": "O-GlcNAc Database", "id": "O75475", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75475" } ], "reference": [ { "type": "PubMed", "id": "37217939", "url": "https://glygen.org/publication/PubMed/37217939" } ] }, { "title": "[Diagnostic value of copper and magnesium in hemolymphopathies and solid tumors].", "journal": "Minerva medica", "date": "1981", "authors": "Russo N, Cipolletta L, Diadema MR, Parente A, Lonardo L", "evidence": [ { "database": "iPTMnet", "id": "O75475", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75475" } ], "reference": [ { "type": "PubMed", "id": "7231784", "url": "https://glygen.org/publication/PubMed/7231784" } ] }, { "title": "HIV cDNA integration: molecular biology and inhibitor development.", "journal": "AIDS (London, England)", "date": "1996", "authors": "Farnet CM, Bushman FD", "evidence": [ { "database": "Reactome", "id": "R-HSA-162592", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-162592" } ], "reference": [ { "type": "PubMed", "id": "8883604", "url": "https://glygen.org/publication/PubMed/8883604" } ] }, { "title": "HIV-1 cDNA integration: requirement of HMG I(Y) protein for function of preintegration complexes in vitro.", "journal": "Cell", "date": "1997", "authors": "Farnet CM, Bushman FD", "evidence": [ { "database": "Reactome", "id": "R-HSA-162592", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-162592" } ], "reference": [ { "type": "PubMed", "id": "9038339", "url": "https://glygen.org/publication/PubMed/9038339" } ] }, { "title": "Human immunodeficiency virus type 1 preintegration complexes: studies of organization and composition.", "journal": "Journal of virology", "date": "1997", "authors": "Miller MD, Farnet CM, Bushman FD", "evidence": [ { "database": "Reactome", "id": "R-HSA-162592", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-162592" } ], "reference": [ { "type": "PubMed", "id": "9188609", "url": "https://glygen.org/publication/PubMed/9188609" } ] }, { "title": "HIV-1 Vpr interacts with the nuclear transport pathway to promote macrophage infection.", "journal": "Genes & development", "date": "1998", "authors": "Vodicka MA, Koepp DM, Silver PA, Emerman M", "evidence": [ { "database": "Reactome", "id": "R-HSA-180910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180910" } ], "reference": [ { "type": "PubMed", "id": "9436978", "url": "https://glygen.org/publication/PubMed/9436978" } ] }, { "title": "Viral protein R regulates docking of the HIV-1 preintegration complex to the nuclear pore complex.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Popov S, Rexach M, Ratner L, Blobel G, Bukrinsky M", "evidence": [ { "database": "Reactome", "id": "R-HSA-180910", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180910" } ], "reference": [ { "type": "PubMed", "id": "9582382", "url": "https://glygen.org/publication/PubMed/9582382" } ] }, { "title": "Isolation of cDNAs encoding novel transcription coactivators p52 and p75 reveals an alternate regulatory mechanism of transcriptional activation.", "journal": "EMBO J.", "date": "1998", "authors": "Ge H, Si Y, Roeder RG", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" }, { "database": "RefSeq", "id": "NP_001121689", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001121689" } ], "reference": [ { "type": "PubMed", "id": "9822615", "url": "https://glygen.org/publication/PubMed/9822615" } ] }, { "title": "The barrier-to-autointegration protein is a host factor for HIV type 1 integration.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Chen H, Engelman A", "evidence": [ { "database": "Reactome", "id": "R-HSA-162592", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-162592" } ], "reference": [ { "type": "PubMed", "id": "9860958", "url": "https://glygen.org/publication/PubMed/9860958" } ] }, { "title": "A novel transcriptional coactivator, p52, functionally interacts with the essential splicing factor ASF/SF2.", "journal": "Mol. Cell", "date": "1998", "authors": "Ge H, Si Y, Wolffe AP", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" }, { "database": "RefSeq", "id": "NP_001121689", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001121689" } ], "reference": [ { "type": "PubMed", "id": "9885563", "url": "https://glygen.org/publication/PubMed/9885563" } ] } ], "pathway": [ { "id": "hsa:11168", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:11168", "resource": "KEGG Pathway" }, { "id": "R-HSA-162592", "name": "Integration of provirus", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-162592", "resource": "Reactome", "description": "Integration of provirus" }, { "id": "R-HSA-164843", "name": "2-LTR circle formation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-164843", "resource": "Reactome", "description": "2-LTR circle formation" }, { "id": "R-HSA-175567", "name": "Integration of viral DNA into host genomic DNA", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-175567", "resource": "Reactome", "description": "Integration of viral DNA into host genomic DNA" }, { "id": "R-HSA-177539", "name": "Autointegration results in viral DNA circles", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-177539", "resource": "Reactome", "description": "Autointegration results in viral DNA circles" }, { "id": "R-HSA-180689", "name": "APOBEC3G mediated resistance to HIV-1 infection", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180689", "resource": "Reactome", "description": "APOBEC3G mediated resistance to HIV-1 infection" }, { "id": "R-HSA-180910", "name": "Vpr-mediated nuclear import of PICs", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-180910", "resource": "Reactome", "description": "Vpr-mediated nuclear import of PICs" }, { "id": "R-HSA-9772755", "name": "Formation of WDR5-containing histone-modifying complexes", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755", "resource": "Reactome", "description": "Formation of WDR5-containing histone-modifying complexes" } ], "orthologs": [ { "uniprot_canonical_ac": "Q812D1-1", "protein_name": "PC4 and SFRS1-interacting protein", "gene_name": "Psip1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MTRDFKPGDLIFAKMKGYPHWPARVDEVPDGAVKPPTNKLPIFFFGTHETAFLGPKDIFPYSENKEKYGKPNKRKGFNEGLWEIDNNPKVKFSSQQVSTKQSNASSDVEAEEKETSVSKEDTDQEEKASNEDVTKAADITTPKAARRGRKRKAEKQVDTEEAGVVTAATASNVKASPKRGRPAATEVKIPKPRGRPKVVKQPCPSESDMVIDEDKSKKKGPEEKPPKKQLKKEEEGQKEEEKPRKEPDKKEGKKEVESKRKNLAKPGVTSTSDSEEDDDQEGEKKRKGGRHFQAAHRRNMLKGQHEKEAADRKRKQEEQMETEQQTKDEGKKPEVKKVEKKRETSMDSRLQRIHAEIKNSLKIDNLDVNRCIEALDELASLQVTMQQAQKHTEMITTLKKIRRFKVSQVIMEKSTMLYNKFKNMFLVGEGDSVITQVLNKSLAEQRQHEEANKTKDQGKKGPNKKLEKEQTGTKSLNGGSDAQESNHPQHNGDSAEESKDSREAGSKTKTPGEEREAEVSLKESTLDN", "length": 528 }, "evidence": [ { "id": "45929335", "url": "http://www.informatics.jax.org/homology/45929335", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q99JF8-1", "protein_name": "PC4 and SFRS1-interacting protein", "gene_name": "Psip1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MTRDFKPGDLIFAKMKGYPHWPARVDEVPDGAVKPPTNKLPIFFFGTHETAFLGPKDIFPYSENKEKYGKPNKRKGFNEGLWEIDNNPKVKFSSQQASTKQSNASSDVEVEEKETNVSKEDTDQEEKASNEDVTKAVDITTPKAARRGRKRKAEKQVDTEEAGMVTAATASNVKASPKRGRPAATEVKIPKPRGRPKVVKQPCPSDGDMVIDEDKSKKKGPEEKQPKKQLKKEEEGQKEEEKPRKEPDKKEGKKEVESKRKNLAKPGVTSTSDSEDEDDQEGEKKRKGGRNFQAAHRRNMLKGQHEKEAGDRKRKQEEQMETEQQNKDEGKKPEVKKVEKKRETSMDSRLQRIHAEIKNSLKIDNLDVNRCIEALDELASLQVTMQQAQKHTEMITTLKKIRRFKVSQVIMEKSTMLYNKFKNMFLVGEGDSVITQVLNKSLAEQRQHEEANKTKDQGKKGPNKKLEKEPTGTKSLNGGSDAQESNHPQHNGDSNEDGKDSREASSKTKPPGEEREAEISLKESTLDN", "length": 528 }, "evidence": [ { "id": "45929335", "url": "http://www.informatics.jax.org/homology/45929335", "database": "MGI" }, { "id": "O75475", "url": "https://omabrowser.org/oma/group/O75475/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9VAA9-1", "protein_name": "JIL-1 anchoring and stabilizing protein, isoform A", "gene_name": "Jasper", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MGKEKAAASYSIGDLVFAKVKGYPPWPAKITKSNNNKKYNVYFYGTGETANIKLEDLFPYASNKERFATEKIMKRAKFIEAIDQIESALRGEDSAPIDLLDGAEPVAPPTTGDGVKTEEPKPEPGPEPATAAPVAAAAEKPKKSGTRKTKAPPRHVDGDSEAGAELAPPPAKRRVPTEGLATAAAIPAAPAAATPTSSKKSVKKSKPTAAVTPIQKRSRPVNNIRNEMLMVYMPTAKCLGIVINYKKPESFESAAAEEAWMENARKEALELKLKLESGQINPESMPDRIVVEPTRSEIPKQEALRFIEELIEHEDALFMERDFIQLSQQLRECLGLRRANVGKCLEILEQFKEVEFTKLMLLRNPECVDIMRRLRRYVGNLELWKMDLSDEVEFKERAQTIRKVSSGIYDGFKSLFNPEPESEDNFWIDFCEKVKIYKTYTKNINENLRVGMNERGYNSLVLAKEAAASAGSAPQ", "length": 475 }, "evidence": [ { "id": "O75475", "url": "https://omabrowser.org/oma/group/O75475/", "database": "OMA" } ], "common_name": "Fruit fly" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 5, "go_terms": [ { "name": "chromatin binding", "id": "GO:0003682", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003682", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" } ], "pmid": "" }, { "name": "transcription coactivator activity", "id": "GO:0003713", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003713", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" } ], "pmid": "" }, { "name": "RNA binding", "id": "GO:0003723", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003723", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" } ], "pmid": "" }, { "name": "supercoiled DNA binding", "id": "GO:0097100", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097100", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" } ], "pmid": "" }, { "name": "DNA-binding transcription factor binding", "id": "GO:0140297", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140297", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 6, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" } ], "pmid": "" }, { "name": "euchromatin", "id": "GO:0000791", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000791", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" } ], "pmid": "" }, { "name": "nuclear periphery", "id": "GO:0034399", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034399", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" } ], "pmid": "" }, { "name": "heterochromatin", "id": "GO:0000792", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000792", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "chromatin remodeling", "id": "GO:0006338", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006338", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" } ], "pmid": "" }, { "name": "response to oxidative stress", "id": "GO:0006979", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006979", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" } ], "pmid": "" }, { "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" } ], "pmid": "" }, { "name": "response to heat", "id": "GO:0009408", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009408", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" } ], "pmid": "" }, { "name": "mRNA 5'-splice site recognition", "id": "GO:0000395", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000395", "evidence": [ { "database": "UniProtKB", "id": "O75475", "url": "https://www.uniprot.org/uniprot/O75475" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 103, "end_pos": 105, "annotation": "n_glycosylation_sequon" }, { "start_pos": 441, "end_pos": 443, "annotation": "n_glycosylation_sequon" }, { "start_pos": 454, "end_pos": 456, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 37, 206 ], "snv_sites": [ 88, 113, 116, 132, 490, 525 ], "glycation_sites": [], "phosphorylation_sites": [ 62, 93, 102, 105, 106, 115, 116, 118, 122, 129, 140, 141, 159, 167, 169, 171, 177, 206, 267, 270, 271, 272, 273, 275, 398, 434, 437, 443, 508, 514, 519, 522, 526, 527 ], "sequon_annotation_sites": [ { "start_pos": 103, "end_pos": 105 }, { "start_pos": 441, "end_pos": 443 }, { "start_pos": 454, "end_pos": 456 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 2 }, { "field": "o_linked_glycan_sites", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 2 }, { "field": "o_linked_glycan_sites", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 35 }, { "field": "total_sites", "count": 34 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 6 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 133 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }