{
"uniprot_canonical_ac": "O75452-1",
"uniprot_ac": "O75452",
"uniprot_id": "RDH16_HUMAN",
"mass": {
"chemical_mass": 35673.0,
"monoisotopic_mass": 35673.0
},
"refseq": {
"ac": "NP_003699",
"name": "retinol dehydrogenase 16 isoform 1",
"summary": "",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_003699"
},
"gene_names": [
{
"name": "RDH16",
"resource": "UniProtKB",
"type": "recommended",
"url": "https://www.uniprot.org/uniprot/O75452",
"id": "O75452"
},
{
"name": "RDH16",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_003699",
"id": "NP_003699"
},
{
"name": "RODH4",
"resource": "UniProtKB",
"type": "synonym",
"url": "https://www.uniprot.org/uniprot/O75452",
"id": "O75452"
},
{
"name": "SDR9C8",
"resource": "UniProtKB",
"type": "synonym",
"url": "https://www.uniprot.org/uniprot/O75452",
"id": "O75452"
},
{
"name": "hRDH-E; RODH-4; RODH4; SDR9C8",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_003699",
"id": "NP_003699"
}
],
"protein_names": [
{
"name": "Retinol dehydrogenase 16",
"resource": "UniProtKB",
"type": "recommended",
"url": "",
"id": "O75452"
},
{
"name": "1.1.1.105",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "O75452"
},
{
"name": "1.1.1.209",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "O75452"
},
{
"name": "1.1.1.315",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "O75452"
},
{
"name": "1.1.1.53",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "O75452"
},
{
"name": "Human epidermal retinol dehydrogenase",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "O75452"
},
{
"name": "Microsomal NAD(+)-dependent retinol dehydrogenase 4",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "O75452"
},
{
"name": "RoDH-4",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "O75452"
},
{
"name": "Short chain dehydrogenase/reductase family 9C member 8",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "O75452"
},
{
"name": "Sterol/retinol dehydrogenase",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "O75452"
},
{
"name": "hRDH-E",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "O75452"
},
{
"name": "microsomal NAD+-dependent retinol dehydrogenase 4; retinol dehydrogenase 16 (all-trans and 13-cis); short chain dehydrogenase/reductase family 9C, member 8; sterol/retinol dehydrogenase; retinol dehydrogenase 16 (all-trans); human epidermal retinol dehydrogenase",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_003699",
"id": "NP_003699"
},
{
"name": "retinol dehydrogenase 16 isoform 1",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_003699",
"id": "NP_003699"
}
],
"function": [
{
"annotation": "Characterization of the retinol dehydrogenase activity of RoDH-4 identifies it as the enzyme capable of accessing the bound form of retinol for retinoic acid production.",
"evidence": [
{
"database": "RefSeq",
"id": "NP_003699",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_003699"
},
{
"database": "PubMed",
"id": "12534290",
"url": "https://glygen.org/publication/PubMed/12534290"
}
]
},
{
"annotation": "In endometrial cancers, hRoDH-4 immunoreactivity was markedly reduced.",
"evidence": [
{
"database": "RefSeq",
"id": "NP_003699",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_003699"
},
{
"database": "PubMed",
"id": "11967490",
"url": "https://glygen.org/publication/PubMed/11967490"
}
]
},
{
"annotation": "Oxidoreductase with a preference for NAD. Oxidizes all-trans-retinol, 9-cis-retinol, 11-cis-retinol and 13-cis-retinol to the corresponding aldehydes (PubMed:10329026, PubMed:12534290, PubMed:9677409). Has higher activity towards CRBP-bound retinol than with free retinol (PubMed:12534290). Oxidizes also 3-alpha-hydroxysteroids. Oxidizes androstanediol and androsterone to dihydrotestosterone and androstanedione. Can also catalyze the reverse reaction (PubMed:10329026, PubMed:9677409, PubMed:29541409).",
"evidence": [
{
"database": "UniProtKB",
"id": "O75452",
"url": "https://www.uniprot.org/uniprot/O75452#function"
},
{
"database": "PubMed",
"id": "9677409",
"url": "https://glygen.org/publication/PubMed/9677409"
},
{
"database": "PubMed",
"id": "10329026",
"url": "https://glygen.org/publication/PubMed/10329026"
},
{
"database": "PubMed",
"id": "12534290",
"url": "https://glygen.org/publication/PubMed/12534290"
},
{
"database": "PubMed",
"id": "29541409",
"url": "https://glygen.org/publication/PubMed/29541409"
}
]
},
{
"annotation": "RDH16 is a stemness suppressor that partially rescues stem cell-like glioma cells from the NSPc1-induced increase in neurosphere formation.",
"evidence": [
{
"database": "RefSeq",
"id": "NP_003699",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_003699"
},
{
"database": "PubMed",
"id": "28394339",
"url": "https://glygen.org/publication/PubMed/28394339"
}
]
}
],
"disease": [],
"snv": [],
"mutagenesis": [
{
"start_pos": 176,
"end_pos": 176,
"sequence_org": "Y",
"sequence_mut": "F",
"comment": "Decreases androsterone dehydrogenase activity; when associated with R-180.",
"evidence": [
{
"database": "UniProtKB",
"id": "O75452",
"url": "https://www.uniprot.org/uniprot/O75452"
},
{
"database": "PubMed",
"id": "29541409",
"url": "https://glygen.org/publication/PubMed/29541409"
}
]
},
{
"start_pos": 180,
"end_pos": 180,
"sequence_org": "K",
"sequence_mut": "R",
"comment": "Decreases androsterone dehydrogenase activity; when associated with F-176.",
"evidence": [
{
"database": "UniProtKB",
"id": "O75452",
"url": "https://www.uniprot.org/uniprot/O75452"
},
{
"database": "PubMed",
"id": "29541409",
"url": "https://glygen.org/publication/PubMed/29541409"
}
]
}
],
"expression_tissue": [
{
"tissue": {
"name": "Adult mammalian kidney",
"namespace": "UBERON",
"id": "0000082",
"url": "http://purl.obolibrary.org/obo/UBERON_0000082"
},
"score": "62.32",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000139547",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000139547"
}
]
},
{
"tissue": {
"name": "Oral cavity",
"namespace": "UBERON",
"id": "0000167",
"url": "http://purl.obolibrary.org/obo/UBERON_0000167"
},
"score": "62.84",
"present": "ABSENT",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000139547",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000139547"
}
]
},
{
"tissue": {
"name": "Stomach",
"namespace": "UBERON",
"id": "0000945",
"url": "http://purl.obolibrary.org/obo/UBERON_0000945"
},
"score": "49.72",
"present": "LOW",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000139547",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000139547"
}
]
},
{
"tissue": {
"name": "Uterus",
"namespace": "UBERON",
"id": "0000995",
"url": "http://purl.obolibrary.org/obo/UBERON_0000995"
},
"score": "65.66",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000139547",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000139547"
}
]
},
{
"tissue": {
"name": "Esophagus",
"namespace": "UBERON",
"id": "0001043",
"url": "http://purl.obolibrary.org/obo/UBERON_0001043"
},
"score": "61.78",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000139547",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000139547"
}
]
},
{
"tissue": {
"name": "Rectum",
"namespace": "UBERON",
"id": "0001052",
"url": "http://purl.obolibrary.org/obo/UBERON_0001052"
},
"score": "49.79",
"present": "ABSENT",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000139547",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000139547"
}
]
},
{
"tissue": {
"name": "Colon",
"namespace": "UBERON",
"id": "0001155",
"url": "http://purl.obolibrary.org/obo/UBERON_0001155"
},
"score": "57.49",
"present": "LOW",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000139547",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000139547"
}
]
},
{
"tissue": {
"name": "Urinary bladder",
"namespace": "UBERON",
"id": "0001255",
"url": "http://purl.obolibrary.org/obo/UBERON_0001255"
},
"score": "57.85",
"present": "LOW",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000139547",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000139547"
}
]
},
{
"tissue": {
"name": "Thyroid gland",
"namespace": "UBERON",
"id": "0002046",
"url": "http://purl.obolibrary.org/obo/UBERON_0002046"
},
"score": "56.61",
"present": "LOW",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000139547",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000139547"
}
]
},
{
"tissue": {
"name": "Lung",
"namespace": "UBERON",
"id": "0002048",
"url": "http://purl.obolibrary.org/obo/UBERON_0002048"
},
"score": "57.67",
"present": "LOW",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000139547",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000139547"
}
]
},
{
"tissue": {
"name": "Liver",
"namespace": "UBERON",
"id": "0002107",
"url": "http://purl.obolibrary.org/obo/UBERON_0002107"
},
"score": "97.47",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000139547",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000139547"
}
]
},
{
"tissue": {
"name": "Prostate gland",
"namespace": "UBERON",
"id": "0002367",
"url": "http://purl.obolibrary.org/obo/UBERON_0002367"
},
"score": "77.89",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000139547",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000139547"
}
]
},
{
"tissue": {
"name": "Thoracic mammary gland",
"namespace": "UBERON",
"id": "0005200",
"url": "http://purl.obolibrary.org/obo/UBERON_0005200"
},
"score": "59.36",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000139547",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000139547"
}
]
}
],
"expression_disease": [
{
"significant": "Yes",
"trend": "down",
"name": "Prostate cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:10283",
"evidence": [
{
"database": "BioXpress",
"id": "O75452",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75452"
}
],
"disease": [
{
"disease_id": "DOID:10283",
"recommended_name": {
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate cancer",
"description": "A male reproductive organ cancer that is located_in the prostate."
},
"synonyms": [
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "NGP - new growth of prostate",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "hereditary prostate cancer",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "malignant tumor of the prostate",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate cancer, familial",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate neoplasm",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostatic cancer",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostatic neoplasm",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "tumor of the prostate",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, type 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "HPC9",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, 12",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene."
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "EHBP1 familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "familial prostate cancer caused by mutation in EHBP1",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, 12",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, type 12",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "HPC12",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, type 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "HPC5",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, type 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, susceptibility to, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "HPC3",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, type 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, susceptibility to, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "HPC4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, on chromosome 7",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, 13",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene."
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "MSMB familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "familial prostate cancer caused by mutation in MSMB",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, 13",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, type 13",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "HPC13",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, type 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "HPC8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "predisposing for prostate cancer",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, type 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "HPC6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "prostate cancer, hereditary, 10",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "HPC10",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "prostate cancer, hereditary, 10",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "familial prostate carcinoma",
"description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma."
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "hereditary prostate cancer",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "hereditary prostate carcinoma",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, somatic",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, familial",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, hereditary",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer, hereditary, 7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "HPC7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer, hereditary, 7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer aggressiveness",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, 1",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene."
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "RNASEL familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "familial prostate cancer caused by mutation in RNASEL",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, type 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "HPC1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "Prca1",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "prostate cancer, hereditary, 11",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "HPC11",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "prostate cancer, hereditary, 11",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "prostate cancer, hereditary, 14",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "HPC14",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "prostate cancer, hereditary, 14",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "prostate cancer, hereditary, 15",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "HPC15",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "prostate cancer, hereditary, 15",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer, hereditary, X-linked 1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "HPCX1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer, hereditary, X-linked 1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer susceptibility, X-linked",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "prostate cancer, hereditary, X-linked 2",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "HPCX2",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "prostate cancer, hereditary, X-linked 2",
"description": ""
},
{
"id": "MIM:611868",
"resource": "MIM",
"url": "https://www.omim.org/entry/611868",
"name": "Prostate cancer, hereditary, 12",
"description": "Prostate cancer, hereditary, 12"
},
{
"id": "MIM:611928",
"resource": "MIM",
"url": "https://www.omim.org/entry/611928",
"name": "Prostate cancer, hereditary, 13",
"description": "Prostate cancer, hereditary, 13"
},
{
"id": "MIM:176807",
"resource": "MIM",
"url": "https://www.omim.org/entry/176807",
"name": "Prostate cancer",
"description": "Prostate cancer"
},
{
"id": "MIM:601518",
"resource": "MIM",
"url": "https://www.omim.org/entry/601518",
"name": "Prostate cancer, hereditary, 1",
"description": "Prostate cancer, hereditary, 1"
},
{
"id": "MIM:611955",
"resource": "MIM",
"url": "https://www.omim.org/entry/611955",
"name": "Prostate cancer, hereditary, 11",
"description": "Prostate cancer, hereditary, 11"
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Stomach cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:10534",
"evidence": [
{
"database": "BioXpress",
"id": "O75452",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75452"
}
],
"disease": [
{
"disease_id": "DOID:10534",
"recommended_name": {
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "stomach cancer",
"description": "A gastrointestinal system cancer that is located_in the stomach."
},
"synonyms": [
{
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "gastric cancer",
"description": ""
},
{
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer",
"description": "A primary or metastatic malignant neoplasm involving the stomach."
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "Ca lesser curvature - stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "cancer of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer risk after h. pylori infection",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer, somatic",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric tumor",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric tumour",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant stomach neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of greater curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of greater curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "stomach cancer",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "Ca body - stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "ca greater curvature of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer, intestinal",
"description": ""
},
{
"id": "MIM:613659",
"resource": "MIM",
"url": "https://www.omim.org/entry/613659",
"name": "Gastric cancer",
"description": "Gastric cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Urinary bladder cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:11054",
"evidence": [
{
"database": "BioXpress",
"id": "O75452",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75452"
}
],
"disease": [
{
"disease_id": "DOID:11054",
"recommended_name": {
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "urinary bladder cancer",
"description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder."
},
"synonyms": [
{
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "bladder cancer",
"description": ""
},
{
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder cancer",
"description": "A primary or metastatic malignant neoplasm involving the bladder."
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "tumour of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "bladder cancer, somatic",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "cancer of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder tumour",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm, bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm, urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor, urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder tumour",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder cancer",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant tumour",
"description": ""
},
{
"id": "MIM:109800",
"resource": "MIM",
"url": "https://www.omim.org/entry/109800",
"name": "Bladder cancer",
"description": "Bladder cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Head and neck cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:11934",
"evidence": [
{
"database": "BioXpress",
"id": "O75452",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75452"
}
],
"disease": [
{
"disease_id": "DOID:11934",
"recommended_name": {
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck cancer",
"description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx."
},
"synonyms": [
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck neoplasm",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck tumours",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head/neck neoplasm",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "tumor of head and neck",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Lung cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1324",
"evidence": [
{
"database": "BioXpress",
"id": "O75452",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75452"
}
],
"disease": [
{
"disease_id": "DOID:1324",
"recommended_name": {
"id": "DOID:1324",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1324",
"name": "lung cancer",
"description": "A respiratory system cancer that is located_in the lung."
},
"synonyms": [
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility 1",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "LNCR1",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility 1",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "lung cancer susceptibility 3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "LNCR3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "lung cancer susceptibility 3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "adenocarcinoma of lung, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "lung cancer susceptibility 4",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "LNCR4",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "lung cancer susceptibility 4",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "lung cancer susceptibility 5",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "LNCR5",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "lung cancer susceptibility 5",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer",
"description": "A malignant neoplasm involving the lung."
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "adenocarcinoma of lung, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "cancer of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, protection against, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, resistance to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung neoplasm",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung tumor",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung tumour",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant neoplasm of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant neoplasm of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumor of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumor of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumour of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumour of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "Nonsmall cell lung cancer",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "alveolar cell carcinoma",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, protection against",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung neoplasm",
"description": ""
},
{
"id": "MIM:211980",
"resource": "MIM",
"url": "https://www.omim.org/entry/211980",
"name": "Lung cancer",
"description": "Lung cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Breast cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1612",
"evidence": [
{
"database": "BioXpress",
"id": "O75452",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75452"
}
],
"disease": [
{
"disease_id": "DOID:1612",
"recommended_name": {
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "breast cancer",
"description": "A thoracic cancer that originates in the mammary gland."
},
"synonyms": [
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "breast tumor",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "malignant neoplasm of breast",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "malignant tumor of the breast",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "mammary cancer",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "mammary tumor",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "primary breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast carcinoma",
"description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma."
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer susceptibility, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, lobular, somatic",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, protection against, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, somatic",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial breast carcinoma",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial cancer of breast",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial cancer of the breast",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast carcinoma",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, familial",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, familial Male",
"description": ""
},
{
"id": "MIM:114480",
"resource": "MIM",
"url": "https://www.omim.org/entry/114480",
"name": "Breast cancer",
"description": "Breast cancer"
}
]
}
]
},
{
"significant": "No",
"trend": "up",
"name": "Thyroid cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1781",
"evidence": [
{
"database": "BioXpress",
"id": "O75452",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75452"
}
],
"disease": [
{
"disease_id": "DOID:1781",
"recommended_name": {
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid cancer",
"description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage."
},
"synonyms": [
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid gland cancer",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "Thyroid gland neoplasm",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "malignant neoplasm of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "malignant tumour of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "neoplasm of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid neoplasm",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Kidney cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:263",
"evidence": [
{
"database": "BioXpress",
"id": "O75452",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75452"
}
],
"disease": [
{
"disease_id": "DOID:263",
"recommended_name": {
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "kidney cancer",
"description": "A urinary system cancer that is located_in the kidney."
},
"synonyms": [
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "malignant neoplasm of kidney except pelvis",
"description": ""
},
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "malignant tumour of kidney",
"description": ""
},
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "renal cancer",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Liver cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:3571",
"evidence": [
{
"database": "BioXpress",
"id": "O75452",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75452"
}
],
"disease": [
{
"disease_id": "DOID:3571",
"recommended_name": {
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "liver cancer",
"description": "A hepatobiliary system cancer that is located_in the liver."
},
"synonyms": [
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "Ca liver - primary",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "Resectable malignant neoplasm of Liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "hepatic cancer",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "hepatic neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant hepato-biliary neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver, primary",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant tumor of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "non-resectable primary hepatic malignant neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "primary liver cancer",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "primary malignant neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "resectable malignant neoplasm of the liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver, not specified as primary or secondary",
"description": ""
}
]
}
]
},
{
"significant": "No",
"trend": "down",
"name": "Uterine cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:363",
"evidence": [
{
"database": "BioXpress",
"id": "O75452",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75452"
}
],
"disease": [
{
"disease_id": "DOID:363",
"recommended_name": {
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine cancer",
"description": "A female reproductive organ cancer that is located_in the uterus."
},
"synonyms": [
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "CA - cancer of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "Tumour of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterus neoplasm",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Esophageal cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:5041",
"evidence": [
{
"database": "BioXpress",
"id": "O75452",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75452"
}
],
"disease": [
{
"disease_id": "DOID:5041",
"recommended_name": {
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "esophageal cancer",
"description": "A gastrointestinal system cancer that is located_in the esophagus."
},
"synonyms": [
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "Ca lower third oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "Ca middle third oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "esophagus cancer",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of distal third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of lower third of oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of middle third of oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of proximal third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of upper third esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of Distal Third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of Proximal Third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of abdominal esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of the middle Third of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer",
"description": "A primary or metastatic malignant neoplasm involving the esophagus."
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "cancer of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "cancer of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal carcinoma, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal squamous cell carcinoma, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophagus cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal tumor",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal tumour",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophagus neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophagus tumor",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant oesophagus neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant oesophagus tumour",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "oesophagus cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca lower third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca lower third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca middle third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca middle third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of distal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of distal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of lower third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of lower third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of middle third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of middle third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of proximal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of proximal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of upper third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of upper third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of abdominal esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of distal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of proximal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of the middle third of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of abdominal oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of distal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of proximal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of the middle third of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Aerodigestive tract cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Escc, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal squamous cell carcinoma, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "gastric cardia adenocarcinoma, susceptibility to",
"description": ""
},
{
"id": "MIM:133239",
"resource": "MIM",
"url": "https://www.omim.org/entry/133239",
"name": "Esophageal cancer",
"description": "Esophageal cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Colorectal cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:9256",
"evidence": [
{
"database": "BioXpress",
"id": "O75452",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75452"
}
],
"disease": [
{
"disease_id": "DOID:9256",
"recommended_name": {
"id": "DOID:9256",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:9256",
"name": "colorectal cancer",
"description": "A large intestine cancer that is located_in the colon and/or located_in the rectum."
},
"synonyms": [
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma."
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, advanced, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer with chromosomal instability, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectum cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectum neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "CRC",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "large intestine cancer",
"description": ""
},
{
"id": "MIM:114500",
"resource": "MIM",
"url": "https://www.omim.org/entry/114500",
"name": "Colorectal cancer",
"description": "Colorectal cancer"
}
]
}
]
}
],
"species": [
{
"name": "Homo sapiens",
"taxid": 9606,
"evidence": [
{
"database": "UniProtKB",
"id": "O75452",
"url": "https://www.uniprot.org/uniprot/O75452"
}
],
"common_name": "Human"
}
],
"gene": [
{
"name": "RDH16",
"url": "https://www.uniprot.org/uniprot/O75452",
"locus": {
"chromosome": "12",
"start_pos": 56951431,
"end_pos": 56959374,
"strand": "+",
"evidence": [
{
"database": "Ensembl Gene",
"id": "ENSG00000139547",
"url": "https://www.ensembl.org/id/ENSG00000139547"
}
]
}
}
],
"crossref": [
{
"id": "ENSG00000139547",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000139547",
"database": "Bgee",
"categories": [
"Gene Expression"
]
},
{
"id": "1.1.1.105",
"url": "https://www.brenda-enzymes.org/enzyme.php?ecno=1.1.1.105&UniProtAcc=O75452",
"database": "BRENDA",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "RDH16",
"url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=RDH16",
"database": "GeneCards",
"categories": [
"Gene Annotation",
"Organism-specific"
]
},
{
"id": "8608",
"url": "https://www.ncbi.nlm.nih.gov/gene/8608",
"database": "GeneID",
"categories": [
"Genome Annotation"
]
},
{
"id": "29674",
"url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=29674",
"database": "HGNC",
"categories": [
"Organism-specific"
]
},
{
"id": "IPR002347",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR002347",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR020904",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR020904",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR036291",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR036291",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "hsa:8608",
"url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:8608",
"database": "KEGG Pathway",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "620043",
"url": "http://www.omim.org/entry/620043",
"database": "MIM",
"categories": [
"Other"
]
},
{
"id": "NX_O75452",
"url": "https://www.nextprot.org/entry/NX_O75452",
"database": "neXtProt",
"categories": [
"Protein",
"Organism-specific"
]
},
{
"id": "HLRDKCV",
"url": "https://omabrowser.org/oma/group/HLRDKCV/",
"database": "OMA",
"categories": [
"Protein Classification"
]
},
{
"id": "5403248at2759",
"url": "http://www.orthodb.org/?query=5403248at2759",
"database": "OrthoDB",
"categories": [
"Protein Classification"
]
},
{
"id": "PTHR43313",
"url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR43313",
"database": "PANTHER",
"categories": [
"Protein Classification"
]
},
{
"id": "PTHR43313:SF11",
"url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR43313:SF11",
"database": "PANTHER",
"categories": [
"Protein Classification"
]
},
{
"id": "PF00106",
"url": "http://pfam.xfam.org/family/PF00106",
"database": "Pfam",
"categories": [
"Protein Classification"
]
},
{
"id": "O75452",
"url": "https://pharos.nih.gov/targets/O75452",
"database": "PHAROS",
"categories": [
"Organism-specific"
]
},
{
"id": "PR_O75452",
"url": "http://purl.obolibrary.org/obo/PR_O75452",
"database": "PRO",
"categories": [
"Protein"
]
},
{
"id": "R-HSA-2453902",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453902",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-5365859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5365859",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "NP_003699",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_003699",
"database": "RefSeq",
"categories": [
"Protein"
]
},
{
"id": "20381",
"url": "https://www.rhea-db.org/rhea/20381",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "21284",
"url": "https://www.rhea-db.org/rhea/21284",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "42004",
"url": "https://www.rhea-db.org/rhea/42004",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "42052",
"url": "https://www.rhea-db.org/rhea/42052",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "42056",
"url": "https://www.rhea-db.org/rhea/42056",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "42060",
"url": "https://www.rhea-db.org/rhea/42060",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "48488",
"url": "https://www.rhea-db.org/rhea/48488",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "O75452",
"url": "https://www.uniprot.org/uniprot/O75452",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "O75452-1",
"url": "https://www.uniprot.org/uniprot/O75452-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
}
],
"sequence": {
"sequence": "MWLYLAVFVGLYYLLHWYRERQVLSHLRDKYVFITGCDSGFGKLLARQLDARGLRVLAACLTEKGAEQLRGQTSDRLETVTLDVTKTESVAAAAQWVKECVRDKGLWGLVNNAGISLPTAPNELLTKQDFVTILDVNLLGVIDVTLSLLPLVRRARGRVVNVSSVMGRVSLFGGGYCISKYGVEAFSDSLRRELSYFGVKVAMIEPGYFKTAVTSKERFLKSFLEIWDRSSPEVKEAYGEKFVADYKKSAEQMEQKCTQDLSLVTNCMEHALIACHPRTRYSAGWDAKLLYLPMSYMPTFLVDAIMYWVSPSPAKAL",
"length": 317,
"header": "sp|O75452-1|RDH16_HUMAN Isoform 1 of Retinol dehydrogenase 16 OS=Homo sapiens OX=9606 GN=RDH16 PE=1 SV=2 CANONICAL=O75452-1"
},
"isoforms": [
{
"isoform_ac": "O75452-1",
"url": "",
"sequence": {
"sequence": "MWLYLAVFVGLYYLLHWYRERQVLSHLRDKYVFITGCDSGFGKLLARQLDARGLRVLAACLTEKGAEQLRGQTSDRLETVTLDVTKTESVAAAAQWVKECVRDKGLWGLVNNAGISLPTAPNELLTKQDFVTILDVNLLGVIDVTLSLLPLVRRARGRVVNVSSVMGRVSLFGGGYCISKYGVEAFSDSLRRELSYFGVKVAMIEPGYFKTAVTSKERFLKSFLEIWDRSSPEVKEAYGEKFVADYKKSAEQMEQKCTQDLSLVTNCMEHALIACHPRTRYSAGWDAKLLYLPMSYMPTFLVDAIMYWVSPSPAKAL",
"length": 317,
"header": "sp|O75452-1|RDH16_HUMAN Isoform 1 of Retinol dehydrogenase 16 OS=Homo sapiens OX=9606 GN=RDH16 PE=1 SV=2 CANONICAL=O75452-1"
},
"locus": {
"chromosome": "12",
"start_pos": 56957462,
"end_pos": 56952032,
"strand": "+",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000398138.5",
"url": "https://www.ensembl.org/id/ENST00000398138.5"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000381206.3",
"url": "https://www.ensembl.org/id/ENSP00000381206.3"
}
]
}
}
],
"glycosylation": [],
"phosphorylation": [],
"glycation": [],
"keywords": [
"enzyme"
],
"publication": [
{
"title": "Retinal stimulates ATP hydrolysis by purified and reconstituted ABCR, the photoreceptor-specific ATP-binding cassette transporter responsible for Stargardt disease.",
"journal": "The Journal of biological chemistry",
"date": "1999",
"authors": "Sun H, Molday RS, Nathans J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2453902",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453902"
}
],
"reference": [
{
"type": "PubMed",
"id": "10075733",
"url": "https://glygen.org/publication/PubMed/10075733"
}
]
},
{
"title": "Cloning and characterization of retinol dehydrogenase transcripts expressed in human epidermal keratinocytes.",
"journal": "Molecular genetics and metabolism",
"date": "1999",
"authors": "Jurukovski V, Markova NG, Karaman-Jurukovska N, Randolph RK, Su J, Napoli JL, Simon M",
"evidence": [
{
"database": "UniProtKB",
"id": "O75452",
"url": "https://www.uniprot.org/uniprot/O75452"
},
{
"database": "Reactome",
"id": "R-HSA-5365859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5365859"
}
],
"reference": [
{
"type": "PubMed",
"id": "10329026",
"url": "https://glygen.org/publication/PubMed/10329026"
}
]
},
{
"title": "Mutations in the gene encoding 11-cis retinol dehydrogenase cause delayed dark adaptation and fundus albipunctatus.",
"journal": "Nature genetics",
"date": "1999",
"authors": "Yamamoto H, Simon A, Eriksson U, Harris E, Berson EL, Dryja TP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5365859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5365859"
}
],
"reference": [
{
"type": "PubMed",
"id": "10369264",
"url": "https://glygen.org/publication/PubMed/10369264"
}
]
},
{
"title": "11-cis retinol dehydrogenase mutations as a major cause of the congenital night-blindness disorder known as fundus albipunctatus.",
"journal": "Molecular vision",
"date": "1999",
"authors": "Gonzalez-Fernandez F, Kurz D, Bao Y, Newman S, Conway BP, Young JE, Han DP, Khani SC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2453902",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453902"
}
],
"reference": [
{
"type": "PubMed",
"id": "10617778",
"url": "https://glygen.org/publication/PubMed/10617778"
}
]
},
{
"title": "Identification and characterization of all-trans-retinol dehydrogenase from photoreceptor outer segments, the visual cycle enzyme that reduces all-trans-retinal to all-trans-retinol.",
"journal": "The Journal of biological chemistry",
"date": "2000",
"authors": "Rattner A, Smallwood PM, Nathans J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2453902",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453902"
}
],
"reference": [
{
"type": "PubMed",
"id": "10753906",
"url": "https://glygen.org/publication/PubMed/10753906"
}
]
},
{
"title": "Retinoid-binding proteins: mediators of retinoid action.",
"journal": "The Biochemical journal",
"date": "2000",
"authors": "Noy N",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5365859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5365859"
}
],
"reference": [
{
"type": "PubMed",
"id": "10839978",
"url": "https://glygen.org/publication/PubMed/10839978"
}
]
},
{
"title": "cDNA cloning and expression of a human aldehyde dehydrogenase (ALDH) active with 9-cis-retinal and identification of a rat ortholog, ALDH12.",
"journal": "The Journal of biological chemistry",
"date": "2000",
"authors": "Lin M, Napoli JL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5365859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5365859"
}
],
"reference": [
{
"type": "PubMed",
"id": "11007799",
"url": "https://glygen.org/publication/PubMed/11007799"
}
]
},
{
"title": "The C-terminal nucleotide binding domain of the human retinal ABCR protein is an adenosine triphosphatase.",
"journal": "Biochemistry",
"date": "2000",
"authors": "Biswas EE, Biswas SB",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2453902",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453902"
}
],
"reference": [
{
"type": "PubMed",
"id": "11123914",
"url": "https://glygen.org/publication/PubMed/11123914"
}
]
},
{
"title": "Prostate short-chain dehydrogenase reductase 1 (PSDR1): a new member of the short-chain steroid dehydrogenase/reductase family highly expressed in normal and neoplastic prostate epithelium.",
"journal": "Cancer research",
"date": "2001",
"authors": "Lin B, White JT, Ferguson C, Wang S, Vessella R, Bumgarner R, True LD, Hood L, Nelson PS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5365859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5365859"
}
],
"reference": [
{
"type": "PubMed",
"id": "11245473",
"url": "https://glygen.org/publication/PubMed/11245473"
}
]
},
{
"title": "Identification, retinoid binding, and x-ray analysis of a human retinol-binding protein.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2001",
"authors": "Folli C, Calderone V, Ottonello S, Bolchi A, Zanotti G, Stoppini M, Berni R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2453902",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453902"
}
],
"reference": [
{
"type": "PubMed",
"id": "11274389",
"url": "https://glygen.org/publication/PubMed/11274389"
}
]
},
{
"title": "Expression of a retinol dehydrogenase (hRoDH-4), a member of the retinol/steroid dehydrogenase family implicated in retinoic acid biosynthesis, in normal and neoplastic endometria.",
"journal": "Am. J. Obstet. Gynecol.",
"date": "2002",
"authors": "Cain JM, Zaino R, Shearer D, Bennett RA, Olt G, Weisz J",
"evidence": [
{
"database": "UniProtKB",
"id": "O75452",
"url": "https://www.uniprot.org/uniprot/O75452"
},
{
"database": "RefSeq",
"id": "NP_003699",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_003699"
}
],
"reference": [
{
"type": "PubMed",
"id": "11967490",
"url": "https://glygen.org/publication/PubMed/11967490"
}
]
},
{
"title": "Evidence that the human gene for prostate short-chain dehydrogenase/reductase (PSDR1) encodes a novel retinal reductase (RalR1).",
"journal": "The Journal of biological chemistry",
"date": "2002",
"authors": "Kedishvili NY, Chumakova OV, Chetyrkin SV, Belyaeva OV, Lapshina EA, Lin DW, Matsumura M, Nelson PS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5365859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5365859"
}
],
"reference": [
{
"type": "PubMed",
"id": "12036956",
"url": "https://glygen.org/publication/PubMed/12036956"
}
]
},
{
"title": "Rhodopsin with 11-cis-locked chromophore is capable of forming an active state photoproduct.",
"journal": "The Journal of biological chemistry",
"date": "2002",
"authors": "Fan G, Siebert F, Sheves M, Vogel R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2453902",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453902"
}
],
"reference": [
{
"type": "PubMed",
"id": "12177057",
"url": "https://glygen.org/publication/PubMed/12177057"
}
]
},
{
"title": "Dual-substrate specificity short chain retinol dehydrogenases from the vertebrate retina.",
"journal": "The Journal of biological chemistry",
"date": "2002",
"authors": "Haeseleer F, Jang GF, Imanishi Y, Driessen CAGG, Matsumura M, Nelson PS, Palczewski K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5365859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5365859"
}
],
"reference": [
{
"type": "PubMed",
"id": "12226107",
"url": "https://glygen.org/publication/PubMed/12226107"
}
]
},
{
"title": "Cloning and characterization of a novel all-trans retinol short-chain dehydrogenase/reductase from the RPE.",
"journal": "Investigative ophthalmology & visual science",
"date": "2002",
"authors": "Wu BX, Chen Y, Chen Y, Fan J, Rohrer B, Crouch RK, Ma JX",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2453902",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453902"
}
],
"reference": [
{
"type": "PubMed",
"id": "12407145",
"url": "https://glygen.org/publication/PubMed/12407145"
}
]
},
{
"title": "Differential recognition of the free versus bound retinol by human microsomal retinol/sterol dehydrogenases: characterization of the holo-CRBP dehydrogenase activity of RoDH-4.",
"journal": "Biochemistry",
"date": "2003",
"authors": "Lapshina EA, Belyaeva OV, Chumakova OV, Kedishvili NY",
"evidence": [
{
"database": "UniProtKB",
"id": "O75452",
"url": "https://www.uniprot.org/uniprot/O75452"
},
{
"database": "RefSeq",
"id": "NP_003699",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_003699"
}
],
"reference": [
{
"type": "PubMed",
"id": "12534290",
"url": "https://glygen.org/publication/PubMed/12534290"
}
]
},
{
"title": "Reduction of all-trans-retinal in the mouse liver peroxisome fraction by the short-chain dehydrogenase/reductase RRD: induction by the PPAR alpha ligand clofibrate.",
"journal": "Biochemistry",
"date": "2003",
"authors": "Lei Z, Chen W, Zhang M, Napoli JL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5365859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5365859"
}
],
"reference": [
{
"type": "PubMed",
"id": "12680773",
"url": "https://glygen.org/publication/PubMed/12680773"
}
]
},
{
"title": "A novel human cytochrome P450, CYP26C1, involved in metabolism of 9-cis and all-trans isomers of retinoic acid.",
"journal": "The Journal of biological chemistry",
"date": "2004",
"authors": "Taimi M, Helvig C, Wisniewski J, Ramshaw H, White J, Amad M, Korczak B, Petkovich M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5365859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5365859"
}
],
"reference": [
{
"type": "PubMed",
"id": "14532297",
"url": "https://glygen.org/publication/PubMed/14532297"
}
]
},
{
"title": "Genomic organization and transcription of the human retinol dehydrogenase 10 (RDH10) gene.",
"journal": "FEBS letters",
"date": "2003",
"authors": "Picozzi P, Marozzi A, Fornasari D, Benfante R, Barisani D, Meneveri R, Ginelli E",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5365859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5365859"
}
],
"reference": [
{
"type": "PubMed",
"id": "14596915",
"url": "https://glygen.org/publication/PubMed/14596915"
}
]
},
{
"title": "Retinosomes: new insights into intracellular managing of hydrophobic substances in lipid bodies.",
"journal": "The Journal of cell biology",
"date": "2004",
"authors": "Imanishi Y, Gerke V, Palczewski K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2453902",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453902"
}
],
"reference": [
{
"type": "PubMed",
"id": "15314061",
"url": "https://glygen.org/publication/PubMed/15314061"
}
]
},
{
"title": "N-retinylidene-phosphatidylethanolamine is the preferred retinoid substrate for the photoreceptor-specific ABC transporter ABCA4 (ABCR).",
"journal": "The Journal of biological chemistry",
"date": "2004",
"authors": "Beharry S, Zhong M, Molday RS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2453902",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453902"
}
],
"reference": [
{
"type": "PubMed",
"id": "15471866",
"url": "https://glygen.org/publication/PubMed/15471866"
}
]
},
{
"title": "Biochemical properties of purified human retinol dehydrogenase 12 (RDH12): catalytic efficiency toward retinoids and C9 aldehydes and effects of cellular retinol-binding protein type I (CRBPI) and cellular retinaldehyde-binding protein (CRALBP) on the oxidation and reduction of retinoids.",
"journal": "Biochemistry",
"date": "2005",
"authors": "Belyaeva OV, Korkina OV, Stetsenko AV, Kim T, Nelson PS, Kedishvili NY",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2453902",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453902"
}
],
"reference": [
{
"type": "PubMed",
"id": "15865448",
"url": "https://glygen.org/publication/PubMed/15865448"
}
]
},
{
"title": "A membrane receptor for retinol binding protein mediates cellular uptake of vitamin A.",
"journal": "Science (New York, N.Y.)",
"date": "2007",
"authors": "Kawaguchi R, Yu J, Honda J, Hu J, Whitelegge J, Ping P, Wiita P, Bok D, Sun H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2453902",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453902"
}
],
"reference": [
{
"type": "PubMed",
"id": "17255476",
"url": "https://glygen.org/publication/PubMed/17255476"
}
]
},
{
"title": "Human retinol dehydrogenase 13 (RDH13) is a mitochondrial short-chain dehydrogenase/reductase with a retinaldehyde reductase activity.",
"journal": "The FEBS journal",
"date": "2008",
"authors": "Belyaeva OV, Korkina OV, Stetsenko AV, Kedishvili NY",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5365859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5365859"
}
],
"reference": [
{
"type": "PubMed",
"id": "18039331",
"url": "https://glygen.org/publication/PubMed/18039331"
}
]
},
{
"title": "Retinoic acid synthesis and signaling during early organogenesis.",
"journal": "Cell",
"date": "2008",
"authors": "Duester G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5365859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5365859"
}
],
"reference": [
{
"type": "PubMed",
"id": "18805086",
"url": "https://glygen.org/publication/PubMed/18805086"
}
]
},
{
"title": "Cloning and characterization of the human ADH4 gene.",
"journal": "Gene",
"date": "1991",
"authors": "von Bahr-Lindstrom H, Jornvall H, Hoog JO",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5365859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5365859"
}
],
"reference": [
{
"type": "PubMed",
"id": "1889753",
"url": "https://glygen.org/publication/PubMed/1889753"
}
]
},
{
"title": "The SDR (short-chain dehydrogenase/reductase and related enzymes) nomenclature initiative.",
"journal": "Chem. Biol. Interact.",
"date": "2009",
"authors": "Persson B, Kallberg Y, Bray JE, Bruford E, Dellaporta SL, Favia AD, Duarte RG, Jornvall H, Kavanagh KL, Kedishvili N, Kisiela M, Maser E, Mindnich R, Orchard S, Penning TM, Thornton JM, Adamski J, Oppermann U",
"evidence": [
{
"database": "UniProtKB",
"id": "O75452",
"url": "https://www.uniprot.org/uniprot/O75452"
}
],
"reference": [
{
"type": "PubMed",
"id": "19027726",
"url": "https://glygen.org/publication/PubMed/19027726"
}
]
},
{
"title": "Identification of a novel palmitylation site essential for membrane association and isomerohydrolase activity of RPE65.",
"journal": "The Journal of biological chemistry",
"date": "2009",
"authors": "Takahashi Y, Moiseyev G, Ablonczy Z, Chen Y, Crouch RK, Ma JX",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2453902",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453902"
}
],
"reference": [
{
"type": "PubMed",
"id": "19049981",
"url": "https://glygen.org/publication/PubMed/19049981"
}
]
},
{
"title": "The first step in vision: femtosecond isomerization of rhodopsin.",
"journal": "Science (New York, N.Y.)",
"date": "1991",
"authors": "Schoenlein RW, Peteanu LA, Mathies RA, Shank CV",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2453902",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453902"
}
],
"reference": [
{
"type": "PubMed",
"id": "1925597",
"url": "https://glygen.org/publication/PubMed/1925597"
}
]
},
{
"title": "Phenotypic spectrum of STRA6 mutations: from Matthew-Wood syndrome to non-lethal anophthalmia.",
"journal": "Human mutation",
"date": "2009",
"authors": "Chassaing N, Golzio C, Odent S, Lequeux L, Vigouroux A, Martinovic-Bouriel J, Tiziano FD, Masini L, Piro F, Maragliano G, Delezoide AL, Attie-Bitach T, Manouvrier-Hanu S, Etchevers HC, Calvas P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2453902",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453902"
}
],
"reference": [
{
"type": "PubMed",
"id": "19309693",
"url": "https://glygen.org/publication/PubMed/19309693"
}
]
},
{
"title": "Structure and activation of the visual pigment rhodopsin.",
"journal": "Annual review of biophysics",
"date": "2010",
"authors": "Smith SO",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2453902",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453902"
}
],
"reference": [
{
"type": "PubMed",
"id": "20192770",
"url": "https://glygen.org/publication/PubMed/20192770"
}
]
},
{
"title": "Retinol dehydrogenases (RDHs) in the visual cycle.",
"journal": "Experimental eye research",
"date": "2010",
"authors": "Parker RO, Crouch RK",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5365859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5365859"
}
],
"reference": [
{
"type": "PubMed",
"id": "20801113",
"url": "https://glygen.org/publication/PubMed/20801113"
}
]
},
{
"title": "The Usher 1B protein, MYO7A, is required for normal localization and function of the visual retinoid cycle enzyme, RPE65.",
"journal": "Human molecular genetics",
"date": "2011",
"authors": "Lopes VS, Gibbs D, Libby RT, Aleman TS, Welch DL, Lillo C, Jacobson SG, Radu RA, Steel KP, Williams DS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2453902",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453902"
}
],
"reference": [
{
"type": "PubMed",
"id": "21493626",
"url": "https://glygen.org/publication/PubMed/21493626"
}
]
},
{
"title": "Cytochrome P450s in the regulation of cellular retinoic acid metabolism.",
"journal": "Annual review of nutrition",
"date": "2011",
"authors": "Ross AC, Zolfaghari R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5365859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5365859"
}
],
"reference": [
{
"type": "PubMed",
"id": "21529158",
"url": "https://glygen.org/publication/PubMed/21529158"
}
]
},
{
"title": "Physiological insights into all-trans-retinoic acid biosynthesis.",
"journal": "Biochimica et biophysica acta",
"date": "2012",
"authors": "Napoli JL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5365859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5365859"
}
],
"reference": [
{
"type": "PubMed",
"id": "21621639",
"url": "https://glygen.org/publication/PubMed/21621639"
}
]
},
{
"title": "Receptor-mediated cellular uptake mechanism that couples to intracellular storage.",
"journal": "ACS chemical biology",
"date": "2011",
"authors": "Kawaguchi R, Yu J, Ter-Stepanian M, Zhong M, Cheng G, Yuan Q, Jin M, Travis GH, Ong D, Sun H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2453902",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453902"
}
],
"reference": [
{
"type": "PubMed",
"id": "21774515",
"url": "https://glygen.org/publication/PubMed/21774515"
}
]
},
{
"title": "Retinaldehyde is a substrate for human aldo-keto reductases of the 1C subfamily.",
"journal": "The Biochemical journal",
"date": "2011",
"authors": "Ruiz FX, Porte S, Gallego O, Moro A, Ardevol A, Del Rio-Espinola A, Rovira C, Farres J, Pares X",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5365859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5365859"
}
],
"reference": [
{
"type": "PubMed",
"id": "21851338",
"url": "https://glygen.org/publication/PubMed/21851338"
}
]
},
{
"title": "Craniosynostosis and multiple skeletal anomalies in humans and zebrafish result from a defect in the localized degradation of retinoic acid.",
"journal": "American journal of human genetics",
"date": "2011",
"authors": "Laue K, Pogoda HM, Daniel PB, van Haeringen A, Alanay Y, von Ameln S, Rachwalski M, Morgan T, Gray MJ, Breuning MH, Sawyer GM, Sutherland-Smith AJ, Nikkels PG, Kubisch C, Bloch W, Wollnik B, Hammerschmidt M, Robertson SP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5365859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5365859"
}
],
"reference": [
{
"type": "PubMed",
"id": "22019272",
"url": "https://glygen.org/publication/PubMed/22019272"
}
]
},
{
"title": "Cross talk between signaling and vitamin A transport by the retinol-binding protein receptor STRA6.",
"journal": "Molecular and cellular biology",
"date": "2012",
"authors": "Berry DC, O'Byrne SM, Vreeland AC, Blaner WS, Noy N",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2453902",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453902"
}
],
"reference": [
{
"type": "PubMed",
"id": "22665496",
"url": "https://glygen.org/publication/PubMed/22665496"
}
]
},
{
"title": "Characterization and comparative structural features of the gene for human interstitial retinol-binding protein.",
"journal": "The Journal of biological chemistry",
"date": "1990",
"authors": "Fong SL, Fong WB, Morris TA, Kedzie KM, Bridges CD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2453902",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453902"
}
],
"reference": [
{
"type": "PubMed",
"id": "2303470",
"url": "https://glygen.org/publication/PubMed/2303470"
}
]
},
{
"title": "Retinoic acid biosynthesis catalyzed by retinal dehydrogenases relies on a rate-limiting conformational transition associated with substrate recognition.",
"journal": "Chemico-biological interactions",
"date": "2013",
"authors": "Bchini R, Vasiliou V, Branlant G, Talfournier F, Rahuel-Clermont S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5365859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5365859"
}
],
"reference": [
{
"type": "PubMed",
"id": "23220587",
"url": "https://glygen.org/publication/PubMed/23220587"
}
]
},
{
"title": "Human interstitial retinoid-binding protein. Gene structure and primary structure.",
"journal": "The Journal of biological chemistry",
"date": "1989",
"authors": "Liou GI, Ma DP, Yang YW, Geng L, Zhu C, Baehr W",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2453902",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453902"
}
],
"reference": [
{
"type": "PubMed",
"id": "2542268",
"url": "https://glygen.org/publication/PubMed/2542268"
}
]
},
{
"title": "NSPc1 promotes cancer stem cell self-renewal by repressing the synthesis of all-trans retinoic acid via targeting RDH16 in malignant glioma.",
"journal": "Oncogene",
"date": "2017",
"authors": "Hu PS, Xia QS, Wu F, Li DK, Qi YJ, Hu Y, Wei ZZ, Li SS, Tian NY, Wei QF, Shen LJ, Yin B, Jiang T, Yuan JG, Qiang BQ, Han W, Peng XZ",
"evidence": [
{
"database": "RefSeq",
"id": "NP_003699",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_003699"
}
],
"reference": [
{
"type": "PubMed",
"id": "28394339",
"url": "https://glygen.org/publication/PubMed/28394339"
}
]
},
{
"title": "Three human alcohol dehydrogenase subunits: cDNA structure and molecular and evolutionary divergence.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1986",
"authors": "Ikuta T, Szeto S, Yoshida A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5365859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5365859"
}
],
"reference": [
{
"type": "PubMed",
"id": "2935875",
"url": "https://glygen.org/publication/PubMed/2935875"
}
]
},
{
"title": "Inhibition of dihydrotestosterone synthesis in prostate cancer by combined frontdoor and backdoor pathway blockade.",
"journal": "Oncotarget",
"date": "2018",
"authors": "Fiandalo MV, Stocking JJ, Pop EA, Wilton JH, Mantione KM, Li Y, Attwood KM, Azabdaftari G, Wu Y, Watt DS, Wilson EM, Mohler JL",
"evidence": [
{
"database": "UniProtKB",
"id": "O75452",
"url": "https://www.uniprot.org/uniprot/O75452"
}
],
"reference": [
{
"type": "PubMed",
"id": "29541409",
"url": "https://glygen.org/publication/PubMed/29541409"
}
]
},
{
"title": "cDNA and protein structure for the alpha subunit of human liver alcohol dehydrogenase.",
"journal": "Biochemistry",
"date": "1986",
"authors": "von Bahr-Lindstrom H, Hoog JO, Heden LO, Kaiser R, Fleetwood L, Larsson K, Lake M, Holmquist B, Holmgren A, Hempel J, et al.",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5365859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5365859"
}
],
"reference": [
{
"type": "PubMed",
"id": "3013304",
"url": "https://glygen.org/publication/PubMed/3013304"
}
]
},
{
"title": "Internal quadruplication in the structure of human interstitial retinol-binding protein deduced from its cloned cDNA.",
"journal": "The Journal of biological chemistry",
"date": "1988",
"authors": "Fong SL, Bridges CD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2453902",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453902"
}
],
"reference": [
{
"type": "PubMed",
"id": "3170584",
"url": "https://glygen.org/publication/PubMed/3170584"
}
]
},
{
"title": "The photosensitivities of visual pigments in the presence of hydroxylamine.",
"journal": "Vision research",
"date": "1968",
"authors": "Dartnall HJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2453902",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453902"
}
],
"reference": [
{
"type": "PubMed",
"id": "5315589",
"url": "https://glygen.org/publication/PubMed/5315589"
}
]
},
{
"title": "Complex formation between metarhodopsin II and GTP-binding protein in bovine photoreceptor membranes leads to a shift of the photoproduct equilibrium.",
"journal": "FEBS letters",
"date": "1982",
"authors": "Emeis D, Kuhn H, Reichert J, Hofmann KP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2453902",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453902"
}
],
"reference": [
{
"type": "PubMed",
"id": "6288450",
"url": "https://glygen.org/publication/PubMed/6288450"
}
]
},
{
"title": "The structure of bovine rhodopsin.",
"journal": "Biophysics of structure and mechanism",
"date": "1983",
"authors": "Hargrave PA, McDowell JH, Curtis DR, Wang JK, Juszczak E, Fong SL, Rao JK, Argos P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2453902",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453902"
}
],
"reference": [
{
"type": "PubMed",
"id": "6342691",
"url": "https://glygen.org/publication/PubMed/6342691"
}
]
},
{
"title": "The photocurrent, noise and spectral sensitivity of rods of the monkey Macaca fascicularis.",
"journal": "The Journal of physiology",
"date": "1984",
"authors": "Baylor DA, Nunn BJ, Schnapf JL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2453902",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453902"
}
],
"reference": [
{
"type": "PubMed",
"id": "6512705",
"url": "https://glygen.org/publication/PubMed/6512705"
}
]
},
{
"title": "Isolation and nucleotide sequence of the gene encoding human rhodopsin.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1984",
"authors": "Nathans J, Hogness DS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2453902",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453902"
}
],
"reference": [
{
"type": "PubMed",
"id": "6589631",
"url": "https://glygen.org/publication/PubMed/6589631"
}
]
},
{
"title": "[Visual rhodopsin. III. Complete amino acid sequence and topography in a membrane].",
"journal": "Bioorganicheskaia khimiia",
"date": "1983",
"authors": "Ovchinnikov IuA, Abdulaev NG, Feigina MIu, Artamonov ID, Bogachuk AS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2453902",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453902"
}
],
"reference": [
{
"type": "PubMed",
"id": "6679757",
"url": "https://glygen.org/publication/PubMed/6679757"
}
]
},
{
"title": "Molecular cloning and structural analysis of the human gene encoding cellular retinaldehyde-binding protein.",
"journal": "The Journal of biological chemistry",
"date": "1994",
"authors": "Intres R, Goldflam S, Cook JR, Crabb JW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2453902",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453902"
}
],
"reference": [
{
"type": "PubMed",
"id": "7929238",
"url": "https://glygen.org/publication/PubMed/7929238"
}
]
},
{
"title": "Localization of the retinal protonated Schiff base counterion in rhodopsin.",
"journal": "Biophysical journal",
"date": "1993",
"authors": "Han M, DeDecker BS, Smith SO",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2453902",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453902"
}
],
"reference": [
{
"type": "PubMed",
"id": "8105993",
"url": "https://glygen.org/publication/PubMed/8105993"
}
]
},
{
"title": "Biological role of human cytosolic aldehyde dehydrogenase 1: hormonal response, retinal oxidation and implication in testicular feminization.",
"journal": "Advances in experimental medicine and biology",
"date": "1993",
"authors": "Yoshida A, Hsu LC, Yanagawa Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5365859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5365859"
}
],
"reference": [
{
"type": "PubMed",
"id": "8493914",
"url": "https://glygen.org/publication/PubMed/8493914"
}
]
},
{
"title": "Primary structure of human 11-cis retinol dehydrogenase and organization and chromosomal localization of the corresponding gene.",
"journal": "Genomics",
"date": "1996",
"authors": "Simon A, Lagercrantz J, Bajalica-Lagercrantz S, Eriksson U",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2453902",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453902"
}
],
"reference": [
{
"type": "PubMed",
"id": "8884265",
"url": "https://glygen.org/publication/PubMed/8884265"
}
]
},
{
"title": "X-ray structure of human class IV sigmasigma alcohol dehydrogenase. Structural basis for substrate specificity.",
"journal": "The Journal of biological chemistry",
"date": "1997",
"authors": "Xie P, Parsons SH, Speckhard DC, Bosron WF, Hurley TD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5365859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5365859"
}
],
"reference": [
{
"type": "PubMed",
"id": "9228021",
"url": "https://glygen.org/publication/PubMed/9228021"
}
]
},
{
"title": "Mapping of the rod photoreceptor ABC transporter (ABCR) to 1p21-p22.1 and identification of novel mutations in Stargardt's disease.",
"journal": "Human genetics",
"date": "1998",
"authors": "Nasonkin I, Illing M, Koehler MR, Schmid M, Molday RS, Weber BH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2453902",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453902"
}
],
"reference": [
{
"type": "PubMed",
"id": "9490294",
"url": "https://glygen.org/publication/PubMed/9490294"
}
]
},
{
"title": "Structural and functional characterization of recombinant human cellular retinaldehyde-binding protein.",
"journal": "Protein science : a publication of the Protein Society",
"date": "1998",
"authors": "Crabb JW, Carlson A, Chen Y, Goldflam S, Intres R, West KA, Hulmes JD, Kapron JT, Luck LA, Horwitz J, Bok D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2453902",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453902"
}
],
"reference": [
{
"type": "PubMed",
"id": "9541407",
"url": "https://glygen.org/publication/PubMed/9541407"
}
]
},
{
"title": "cDNA cloning and characterization of a new human microsomal NAD+-dependent dehydrogenase that oxidizes all-trans-retinol and 3alpha-hydroxysteroids.",
"journal": "The Journal of biological chemistry",
"date": "1998",
"authors": "Gough WH, VanOoteghem S, Sint T, Kedishvili NY",
"evidence": [
{
"database": "UniProtKB",
"id": "O75452",
"url": "https://www.uniprot.org/uniprot/O75452"
},
{
"database": "Reactome",
"id": "R-HSA-5365859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5365859"
}
],
"reference": [
{
"type": "PubMed",
"id": "9677409",
"url": "https://glygen.org/publication/PubMed/9677409"
}
]
},
{
"title": "The human photoreceptor rim protein gene (ABCR): genomic structure and primer set information for mutation analysis.",
"journal": "Human genetics",
"date": "1998",
"authors": "Azarian SM, Megarity CF, Weng J, Horvath DH, Travis GH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2453902",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453902"
}
],
"reference": [
{
"type": "PubMed",
"id": "9703434",
"url": "https://glygen.org/publication/PubMed/9703434"
}
]
},
{
"title": "Molecular characterization of a novel short-chain dehydrogenase/reductase that reduces all-trans-retinal.",
"journal": "The Journal of biological chemistry",
"date": "1998",
"authors": "Haeseleer F, Huang J, Lebioda L, Saari JC, Palczewski K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5365859",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5365859"
}
],
"reference": [
{
"type": "PubMed",
"id": "9705317",
"url": "https://glygen.org/publication/PubMed/9705317"
}
]
},
{
"title": "Molecular and biochemical characterization of lecithin retinol acyltransferase.",
"journal": "The Journal of biological chemistry",
"date": "1999",
"authors": "Ruiz A, Winston A, Lim YH, Gilbert BA, Rando RR, Bok D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2453902",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453902"
}
],
"reference": [
{
"type": "PubMed",
"id": "9920938",
"url": "https://glygen.org/publication/PubMed/9920938"
}
]
}
],
"pathway": [
{
"id": "hsa:8608",
"name": "",
"url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:8608",
"resource": "KEGG Pathway"
},
{
"id": "R-HSA-2453902",
"name": "The canonical retinoid cycle in rods (twilight vision)",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2453902",
"resource": "Reactome",
"description": "The canonical retinoid cycle in rods (twilight vision)"
},
{
"id": "R-HSA-5365859",
"name": "RA biosynthesis pathway",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5365859",
"resource": "Reactome",
"description": "RA biosynthesis pathway"
}
],
"orthologs": [
{
"uniprot_canonical_ac": "A0A287A319-1",
"protein_name": "Retinol dehydrogenase 16",
"gene_name": "RDH16",
"tax_id": 9823,
"organism": "Sus scrofa",
"sequence": {
"sequence": "MWVYLAVLVGLYYLLRWQRERQVVSHLRDKYVFITGCDSGFGNLLARQLDLRGLRVLAACLTEQGAQQLRKQTSDRLETVLLDVTKTESVAAAKEWVKERVGDRGLWGLVNNAGISVISAPNEWLTKQDFVKILDVNLLGMVDVTLQLLPLVRKTGRVVNVSSVMGRVSLFGGGYCLSKYGVEAFSDSLRRELSYFGVKVAMIEPGFFKTNVTKPEAISQGYKTAWNQASPEIKDLYGDTFLALCEKAVCSMETSCNQDLSLVTDCMEHALTSCHPRTRYSPGWDAKLFYLPMSYLPTFLVDLMIYYGAPRPAKAL",
"length": 316
},
"evidence": [
{
"id": "O75452",
"url": "https://omabrowser.org/oma/group/O75452/",
"database": "OMA"
}
],
"common_name": "Pig"
},
{
"uniprot_canonical_ac": "G5E8H9-1",
"protein_name": "Retinol dehydrogenase 19",
"gene_name": "Rdh19",
"tax_id": 10090,
"organism": "Mus musculus",
"sequence": {
"sequence": "MWLYLVSLVGLWTLLRFFRERQVVSHLQDKYVFITGCDSGFGNLLARQLDRRGMRVLAACLTEKGAEELRNKTSDRLETVILDVTKTESIVAATQWVKERVGNRGLWGLVNNAGISVPLGLSQWMNKQNFASVLDVNLLGMIEVTLTMLPLVRKARGRVVNVSSIMGRVSLHGNGGYCISKYGVEAFSDSLRRELSYFGVKVAIIEPGFFLTGMASSARLSSNTQMLWDQTSSEIREIYGEKYLAFYLKSLNELDKRCNKDLSLVTDCMEHALTACHPRTRYSAGWDAKLFFIPLSYLPTFLVDAVFYWTSMKPEKAL",
"length": 318
},
"evidence": [
{
"id": "45935979",
"url": "http://www.informatics.jax.org/homology/45935979",
"database": "MGI"
}
],
"common_name": "Mouse"
},
{
"uniprot_canonical_ac": "O54909-1",
"protein_name": "Retinol dehydrogenase 16",
"gene_name": "Rdh16",
"tax_id": 10090,
"organism": "Mus musculus",
"sequence": {
"sequence": "MWLYLVALVGLWTLLRFFRVRQVVSHLQDKYVFITGCDSGFGTLLARQLDRRGMRVLAACLTEKGAEELRNKTSDRLETVILDVTKTESIVTATQWVKEHVGNRGLWGLVNNAGISTPSGPNEWMKKQDFAHVLDVNLLGMIEVTLSMLPLVRKARGRVVNVSSVMGRVSLFGGGYCISKYGVEAFSDSLRRELSYFGVKVAIIEPGFFLTGVTSSARLCSNTQMLWDQTSSEIREIYGEKYLASYLKRLNKLDKRCNKDLSGVTDCMEHALTACHPRTRYSAGWDAKLFYLPLSYLPTFLVDALLYWTSLKPEKAL",
"length": 317
},
"evidence": [
{
"id": "45935981",
"url": "http://www.informatics.jax.org/homology/45935981",
"database": "MGI"
}
],
"common_name": "Mouse"
},
{
"uniprot_canonical_ac": "O88451-1",
"protein_name": "Retinol dehydrogenase 7",
"gene_name": "Rdh7",
"tax_id": 10090,
"organism": "Mus musculus",
"sequence": {
"sequence": "MWLYLVALVGLWTLLRFFRERQVVSHLQDKYVFITGCDSGFGNLLARQLDRRGMRVLAACLTEKGAEQLRNKTSDRLETVILDVTKTESIVAATQWVKERVGNRGLWGLVNNAGICVFAINEWLKKEDFANILDVNLLGMIEVTLSMLPLVRKARGRVVNISSSMGRVSLCGGGYCISKYGVEAFSDSLRREISYFGVKVAIIEPGGFRTNVSNYERLSHSIEKLWDQTSSEVKEVYDKNFLDSYIKAIQSLTDTCSDDLSVVTDCMEHALTACHPRTRYSAGWDAKLFYLPLSYMPTFLVDAMLYWSSVKPAQAL",
"length": 316
},
"evidence": [
{
"id": "45935980",
"url": "http://www.informatics.jax.org/homology/45935980",
"database": "MGI"
}
],
"common_name": "Mouse"
},
{
"uniprot_canonical_ac": "P50170-1",
"protein_name": "Retinol dehydrogenase 16",
"gene_name": "Rdh16",
"tax_id": 10116,
"organism": "Rattus norvegicus",
"sequence": {
"sequence": "MWLYLLALVGLWNLLRLFRERKVVSHLQDKYVFITGCDSGFGNLLARQLDRRGMRVLAACLTEKGAEQLRSKTSDRLETVILDVTKTESIVAATQWVKERVGNTGLWGLVNNAGISGHLGPNEWMNKQNIASVLDVNLLGMIEVTLSTVPLVRKARGRVVNVASIAGRLSFCGGGYCISKYGVEAFSDSLRRELSYFGVKVAIVEPGFFRTDVTNGVTLSSNFQMLWDQTSSEVREVYGENYLASYLKMLNGLDQRCNKDLSLVTDCMEHALTSCHPRTRYSAGWDAKFFYLPMSYLPTFLVDALFYWTSPKPEKAL",
"length": 317
},
"evidence": [
{
"id": "45935978",
"url": "http://www.informatics.jax.org/homology/45935978",
"database": "MGI"
},
{
"id": "45935983",
"url": "http://www.informatics.jax.org/homology/45935983",
"database": "MGI"
},
{
"id": "45935979",
"url": "http://www.informatics.jax.org/homology/45935979",
"database": "MGI"
},
{
"id": "45935982",
"url": "http://www.informatics.jax.org/homology/45935982",
"database": "MGI"
},
{
"id": "45935981",
"url": "http://www.informatics.jax.org/homology/45935981",
"database": "MGI"
}
],
"common_name": "Rat"
},
{
"uniprot_canonical_ac": "P55006-1",
"protein_name": "Retinol dehydrogenase 7",
"gene_name": "Rdh7",
"tax_id": 10116,
"organism": "Rattus norvegicus",
"sequence": {
"sequence": "MWLYLLALVGLWNLLRLFRERKVVSHLQDKYVFITGCDSGFGNLLARQLDRRGMRVLAACLTEKGAEQLRSKTSDRLETVILDVTKTESIVAATQWVKERVGNRGLWGLVNNAGISVPMGPNEWMRKKDFASVLDVNLLGVIEVTLNMLPLVRKARGRVVNIASTMGRMSLLGGGYCISKYGVEAFSDSLRRELTYFGVKVAIIEPGGFKTNVTNMERLSDNLKKLWDQATEEVKEIYGEKFRDSYMKAMESLVNMCSGDLSLVTDCMEHALTSCHPRTRYSAGWDAKFFYLPMSYLPTFLSDAVIYWGSVKPARAL",
"length": 317
},
"evidence": [
{
"id": "45935980",
"url": "http://www.informatics.jax.org/homology/45935980",
"database": "MGI"
}
],
"common_name": "Rat"
},
{
"uniprot_canonical_ac": "Q8CGV4-1",
"protein_name": "Retinol dehydrogenase 1 (All trans)",
"gene_name": "Rdh1",
"tax_id": 10090,
"organism": "Mus musculus",
"sequence": {
"sequence": "MWLYLVALVGLWTLLRFFRERQVVSHLQDKYVFITGCDSGFGNLLARQLDRRGMRVLAACLTEKGAEELRNKTSDRLETVILDVTKTESIVAATQWVKERVGNRGLWGLVNNAGISTPSGPNEWMKKQDFARVLDVNLLGMIEVTLSMLPLVRKARGRVVNVSSVMGRMSFFGGGYCISKYGVEAFSDSLRRELSYFGVKVAIIEPGGFKTCVTSSDRLSSNTKMIWDKASSEVKEIYGEKFLLFYLKNLNELDKRCNKDLSVVTDCMEHALTACHPRTRYSAGWDAKFLFLPLSYLPTFLVDALLYWTSMKPEKAL",
"length": 317
},
"evidence": [
{
"id": "45935978",
"url": "http://www.informatics.jax.org/homology/45935978",
"database": "MGI"
}
],
"common_name": "Mouse"
},
{
"uniprot_canonical_ac": "Q8K3M1-1",
"protein_name": "RDH16 family member 2",
"gene_name": "Rdh16f2",
"tax_id": 10090,
"organism": "Mus musculus",
"sequence": {
"sequence": "MWLYMVALLGLWMLLRFFRERQVVDHLQDKYVFITGCGSGFGNLLARQLDRRGMRVLAACRKEEGAEELRRKTSERLETVILDVTKTENIVAATQWVKERVGNRGLWGLVNNAGISVPSGPNEWMKKQDFASVLDVNLLGLIEVTLSMLPLVRKARGRVVNVSSILGRVSLGGSGGYCISKYGIEAFSDSLRRELRYFGVKVAIIEPGFFLTGMASSARLCSNIQMLWDQTSSEIREIYGEKYLASYLKNLNELDQRCNKDLSVVTDCMEHALTACHPRTRYSAGWDAKLFFTPLSYLPTFLVDALLYWTSPKPDKAL",
"length": 318
},
"evidence": [
{
"id": "45935983",
"url": "http://www.informatics.jax.org/homology/45935983",
"database": "MGI"
}
],
"common_name": "Mouse"
},
{
"uniprot_canonical_ac": "Q8K5C8-1",
"protein_name": "Cis-retinol/androgen dehydrogenase type 3",
"gene_name": "Rdh9",
"tax_id": 10090,
"organism": "Mus musculus",
"sequence": {
"sequence": "MWLFLVALVGLWTLLCFFRERQVVSYLQDKYVFITGCDSGFGNLLARQLDRRGMRVLAACLTEKGAEELRNKTSDRLETVILDVTKTESIVTATQWVKERVGNRGLWGLVNNAGISIPSGPNEWMKKQDFAHVLDVNLLGLIEVTLSMLPLVRKARGRVINVASVLGRVSLCGGAYCISKYGVEAFSDSLRRELSYFGVKVAIIEPGFFLTGVTSSARLCSNTQMLWDQTSSEIREIYGEKYLASYLKRLNELDKRCNKDLSLVTDCMEHALTACHPRTRYSAGWDAKLFYLPLSYLPTFLVDALLYWTSLKPEKAL",
"length": 317
},
"evidence": [
{
"id": "45935982",
"url": "http://www.informatics.jax.org/homology/45935982",
"database": "MGI"
}
],
"common_name": "Mouse"
}
],
"go_annotation": {
"categories": [
{
"name": "Biological Process",
"total": 3,
"go_terms": [
{
"name": "lipid metabolic process",
"id": "GO:0006629",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006629",
"evidence": [
{
"database": "UniProtKB",
"id": "O75452",
"url": "https://www.uniprot.org/uniprot/O75452"
}
],
"pmid": ""
},
{
"name": "retinol metabolic process",
"id": "GO:0042572",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042572",
"evidence": [
{
"database": "UniProtKB",
"id": "O75452",
"url": "https://www.uniprot.org/uniprot/O75452"
}
],
"pmid": ""
},
{
"name": "steroid metabolic process",
"id": "GO:0008202",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008202",
"evidence": [
{
"database": "UniProtKB",
"id": "O75452",
"url": "https://www.uniprot.org/uniprot/O75452"
}
],
"pmid": ""
}
]
},
{
"name": "Molecular Function",
"total": 6,
"go_terms": [
{
"name": "electron transfer activity",
"id": "GO:0009055",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009055",
"evidence": [
{
"database": "UniProtKB",
"id": "O75452",
"url": "https://www.uniprot.org/uniprot/O75452"
}
],
"pmid": ""
},
{
"name": "identical protein binding",
"id": "GO:0042802",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802",
"evidence": [
{
"database": "UniProtKB",
"id": "O75452",
"url": "https://www.uniprot.org/uniprot/O75452"
}
],
"pmid": ""
},
{
"name": "NAD-retinol dehydrogenase activity",
"id": "GO:0004745",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004745",
"evidence": [
{
"database": "UniProtKB",
"id": "O75452",
"url": "https://www.uniprot.org/uniprot/O75452"
}
],
"pmid": ""
},
{
"name": "androsterone dehydrogenase activity",
"id": "GO:0047023",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0047023",
"evidence": [
{
"database": "UniProtKB",
"id": "O75452",
"url": "https://www.uniprot.org/uniprot/O75452"
}
],
"pmid": ""
},
{
"name": "androstan-3-alpha,17-beta-diol dehydrogenase activity",
"id": "GO:0047044",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0047044",
"evidence": [
{
"database": "UniProtKB",
"id": "O75452",
"url": "https://www.uniprot.org/uniprot/O75452"
}
],
"pmid": ""
},
{
"name": "11-cis-retinol dehydrogenase",
"id": "GO:0106429",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0106429",
"evidence": [
{
"database": "UniProtKB",
"id": "O75452",
"url": "https://www.uniprot.org/uniprot/O75452"
}
],
"pmid": ""
}
]
},
{
"name": "Cellular Component",
"total": 2,
"go_terms": [
{
"name": "intracellular membrane-bounded organelle",
"id": "GO:0043231",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043231",
"evidence": [
{
"database": "UniProtKB",
"id": "O75452",
"url": "https://www.uniprot.org/uniprot/O75452"
}
],
"pmid": ""
},
{
"name": "endoplasmic reticulum membrane",
"id": "GO:0005789",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789",
"evidence": [
{
"database": "UniProtKB",
"id": "O75452",
"url": "https://www.uniprot.org/uniprot/O75452"
}
],
"pmid": ""
}
]
}
]
},
"pro_annotation": [],
"site_annotation": [
{
"start_pos": 161,
"end_pos": 163,
"annotation": "n_glycosylation_sequon"
}
],
"ptm_annotation": [
{
"annotation": "Not N-glycosylated.",
"evidence": [
{
"database": "UniProtKB",
"id": "O75452",
"url": "https://www.uniprot.org/uniprot/O75452"
},
{
"database": "PubMed",
"id": "12534290",
"url": "https://glygen.org/publication/PubMed/12534290"
}
]
}
],
"interactions": [],
"reactions": [
{
"id": "20381",
"name": "",
"equation": "androsterone + NAD(+) = 5alpha-androstan-3,17-dione + H(+) + NADH",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"Q8VD48-1",
"Q6AYQ2-1",
"P50170-1",
"O54753-1",
"Q9BPW9-1",
"Q92781-1",
"O75452-1",
"O14756-1",
"Q91WR5-1",
"Q58NB6-1",
"O55240-1",
"O54909-1",
"Q9R092-1"
],
"evidence": [
{
"id": "20381",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/20381"
}
]
},
{
"id": "21284",
"name": "",
"equation": "all-trans-retinol + NAD(+) = all-trans-retinal + H(+) + NADH",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"Q5M875-1",
"Q64563-1",
"Q8VD48-1",
"P41682-1",
"P50170-1",
"O54753-1",
"D3ZGP9-1",
"P08319-1",
"P40394-1",
"P00325-1",
"Q9BPW9-1",
"O75452-1",
"Q7Z5P4-1",
"O14756-1",
"A6NNS2-1",
"Q64437-1",
"Q9QYY9-1",
"Q58NB6-1",
"Q9R092-1",
"Q8VCR2-1",
"Q8CHS7-1"
],
"evidence": [
{
"id": "21284",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/21284"
}
]
},
{
"id": "42004",
"name": "",
"equation": "5alpha-androstane-3alpha,17beta-diol + NAD(+) = 17beta-hydroxy-5alpha-androstan-3-one + H(+) + NADH",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"Q8VD48-1",
"P50170-1",
"O54753-1",
"O70351-1",
"Q9BPW9-1",
"Q92781-1",
"O75452-1",
"P52895-1",
"P17516-1",
"Q04828-1",
"P42330-1",
"O14756-1",
"Q99714-1",
"Q58NB6-1",
"O55240-1",
"O54909-1",
"O08756-1",
"Q9R092-1",
"O18404-1"
],
"evidence": [
{
"id": "42004",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/42004"
}
]
},
{
"id": "42052",
"name": "",
"equation": "9-cis-retinol + NAD(+) = 9-cis-retinal + H(+) + NADH",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"Q64563-1",
"P41682-1",
"P50170-1",
"P08319-1",
"P40394-1",
"Q92781-1",
"O75452-1",
"Q64437-1",
"Q9QYY9-1",
"O55240-1",
"O54909-1"
],
"evidence": [
{
"id": "42052",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/42052"
}
]
},
{
"id": "42056",
"name": "",
"equation": "13-cis-retinol + NAD(+) = 13-cis-retinal + H(+) + NADH",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P50170-1",
"Q92781-1",
"O75452-1",
"O55240-1",
"O54909-1"
],
"evidence": [
{
"id": "42056",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/42056"
}
]
},
{
"id": "42060",
"name": "",
"equation": "11-cis-retinol + NAD(+) = 11-cis-retinal + H(+) + NADH",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P50170-1",
"Q92781-1",
"O75452-1",
"O55240-1",
"O54909-1"
],
"evidence": [
{
"id": "42060",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/42060"
}
]
},
{
"id": "48488",
"name": "",
"equation": "all-trans-retinol--[retinol-binding protein] + NAD(+) = all-trans-retinal--[retinol-binding protein] + H(+) + NADH",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P55006-1",
"P50170-1",
"O54753-1",
"O14756-1",
"Q8N3Y7-1",
"O75452-1",
"Q9R092-1",
"O88451-1",
"Q7TQA3-1",
"O54909-1"
],
"evidence": [
{
"id": "48488",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/48488"
}
]
},
{
"id": "R-HSA-2454081",
"name": "RDH5 oxidises 11cROL to 11cRAL",
"equation": "",
"summary": "Another member of the short-chain dehydrogenases/reductases (SDR) family, RDH5, can (reversibly) catalyse the oxidation of 11-cis-retinol (11cROL) to 11-cis-retinal (11cRAL) in retinal pigment epithelium (RPE) cells using NAD+ as cofactor (Simon et al. 1996, Gonzalez-Fernandez et al. 1999). Cellular retinaldehyde-binding protein (RLBP1), the protein bound to 11cRAL in RPE, is not present in photoreceptor cells.",
"cellular_location": "cytosol, endoplasmic reticulum membrane",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"Q9BPW9-1",
"O14756-1",
"O75452-1",
"Q92781-1",
"Q8NEX9-1"
],
"evidence": [
{
"id": "R-HSA-2454081",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2454081"
}
]
},
{
"id": "R-HSA-5362518",
"name": "RDH10,16,DHRS9,RDHE2 oxidise atROL to atRAL",
"equation": "",
"summary": "Multiple retinol dehydrogenases (RDH), members of the short-chain dehydrogenase/reductase (SDR) gene family, are candidates for catalysing conversion of retinol into retinal under physiological conditions (Napoli 2012). These include RDH16 (aka RoDH-4, RDH-E, Rdh1), RDH10, DHRS9 (aka retSDR8) and RDHE2. Two of these, Rdh1 (human ortholog RDH16) and Rdh10 (human ortholog RDH10), have been knocked out in mice and display RA-associated phenotypes. Both are membrane bound oxidoreductases that reversibly catalyse the first and rate limiting step in retinoic acid biosynthesis, and use NAD+ as cofactor to the corresponding aldehyde all trans retinal (atRAL) (Gough et al. 1998, Jurukovski et al. 1999, Pecozzi et al. 2003). The other RDH are currently under study, but have not been ablated in mice.",
"cellular_location": "cytosol, endoplasmic reticulum membrane",
"input_participant_list": [
"R-ALL-975599"
],
"output_participant_list": [],
"enzyme_list": [
"Q9BPW9-1",
"Q8IZV5-1",
"O75452-1",
"Q8N3Y7-1"
],
"evidence": [
{
"id": "R-HSA-5362518",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5362518"
}
]
}
],
"reaction_participants": [
{
"participant_id": "R-ALL-975599",
"participant_name": "atROL [cytosol]",
"crossref": [
{
"id": "17336",
"database": "ChEBI",
"url": ""
},
{
"id": "HMDB0000305",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "4053",
"database": "Guide to Pharmacology - Ligands",
"url": ""
},
{
"id": "8144182",
"database": "PubChem Substance",
"url": ""
},
{
"id": "000003831417",
"database": "ZINC",
"url": ""
},
{
"id": "C00473",
"database": "COMPOUND",
"url": ""
},
{
"id": "17336",
"database": "ChEBI",
"url": ""
},
{
"id": "HMDB0000305",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "4053",
"database": "Guide to Pharmacology - Ligands",
"url": ""
},
{
"id": "8144182",
"database": "PubChem Substance",
"url": ""
},
{
"id": "000003831417",
"database": "ZINC",
"url": ""
},
{
"id": "C00473",
"database": "COMPOUND",
"url": ""
},
{
"id": "17336",
"database": "ChEBI",
"url": ""
},
{
"id": "HMDB0000305",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "4053",
"database": "Guide to Pharmacology - Ligands",
"url": ""
},
{
"id": "8144182",
"database": "PubChem Substance",
"url": ""
},
{
"id": "000003831417",
"database": "ZINC",
"url": ""
},
{
"id": "C00473",
"database": "COMPOUND",
"url": ""
},
{
"id": "17336",
"database": "ChEBI",
"url": ""
},
{
"id": "HMDB0000305",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "4053",
"database": "Guide to Pharmacology - Ligands",
"url": ""
},
{
"id": "8144182",
"database": "PubChem Substance",
"url": ""
},
{
"id": "000003831417",
"database": "ZINC",
"url": ""
},
{
"id": "C00473",
"database": "COMPOUND",
"url": ""
},
{
"id": "17336",
"database": "ChEBI",
"url": ""
},
{
"id": "HMDB0000305",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "4053",
"database": "Guide to Pharmacology - Ligands",
"url": ""
},
{
"id": "8144182",
"database": "PubChem Substance",
"url": ""
},
{
"id": "000003831417",
"database": "ZINC",
"url": ""
},
{
"id": "C00473",
"database": "COMPOUND",
"url": ""
},
{
"id": "17336",
"database": "ChEBI",
"url": ""
},
{
"id": "HMDB0000305",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "4053",
"database": "Guide to Pharmacology - Ligands",
"url": ""
},
{
"id": "8144182",
"database": "PubChem Substance",
"url": ""
},
{
"id": "000003831417",
"database": "ZINC",
"url": ""
},
{
"id": "C00473",
"database": "COMPOUND",
"url": ""
},
{
"id": "17336",
"database": "ChEBI",
"url": ""
},
{
"id": "HMDB0000305",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "4053",
"database": "Guide to Pharmacology - Ligands",
"url": ""
},
{
"id": "8144182",
"database": "PubChem Substance",
"url": ""
},
{
"id": "000003831417",
"database": "ZINC",
"url": ""
},
{
"id": "C00473",
"database": "COMPOUND",
"url": ""
}
]
}
],
"reaction_enzymes": [
{
"uniprot_ac": "A6NNS2",
"gene_name": "DHRS7C",
"activity": [
{
"ec_number": "1.1.1.105",
"activity": "all-trans-retinol + NAD(+) = all-trans-retinal + H(+) + NADH.",
"evidence": [
{
"id": "A6NNS2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A6NNS2"
}
]
},
{
"ec_number": "1.1.1.105",
"activity": "",
"evidence": [
{
"id": "A6NNS2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A6NNS2"
}
]
}
]
},
{
"uniprot_ac": "D3ZGP9",
"gene_name": "Dhrs7c",
"activity": [
{
"ec_number": "1.1.1.105",
"activity": "all-trans-retinol + NAD(+) = all-trans-retinal + H(+) + NADH.",
"evidence": [
{
"id": "D3ZGP9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/D3ZGP9"
}
]
},
{
"ec_number": "1.1.1.105",
"activity": "",
"evidence": [
{
"id": "D3ZGP9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/D3ZGP9"
}
]
}
]
},
{
"uniprot_ac": "O08756",
"gene_name": "Hsd17b10",
"activity": [
{
"ec_number": "1.1.1.35",
"activity": "a (3S)-3-hydroxyacyl-CoA + NAD(+) = a 3-oxoacyl-CoA + H(+) + NADH.",
"evidence": [
{
"id": "O08756",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O08756"
}
]
},
{
"ec_number": "1.1.1.62",
"activity": "17beta-estradiol + NAD(+) = estrone + H(+) + NADH.",
"evidence": [
{
"id": "O08756",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O08756"
}
]
},
{
"ec_number": "1.1.1.239",
"activity": "NAD(+) + testosterone = androst-4-ene-3,17-dione + H(+) + NADH.",
"evidence": [
{
"id": "O08756",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O08756"
}
]
},
{
"ec_number": "1.1.1.178",
"activity": "(2S,3S)-3-hydroxy-2-methylbutanoyl-CoA + NAD(+) = 2-methyl-3-oxobutanoyl-CoA + H(+) + NADH.",
"evidence": [
{
"id": "O08756",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O08756"
}
]
},
{
"ec_number": "1.1.1.53",
"activity": "5alpha-androstane-3alpha,17beta-diol + NAD(+) = 17beta-hydroxy-5alpha-androstan-3-one + H(+) + NADH.",
"evidence": [
{
"id": "O08756",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O08756"
}
]
},
{
"ec_number": "1.1.1.159",
"activity": "cholate + NAD(+) = 3alpha,12alpha-dihydroxy-7-oxo-5beta-cholanate + H(+) + NADH.",
"evidence": [
{
"id": "O08756",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O08756"
}
]
},
{
"ec_number": "1.1.1.35",
"activity": "",
"evidence": [
{
"id": "O08756",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O08756"
}
]
}
]
},
{
"uniprot_ac": "O14756",
"gene_name": "HSD17B6",
"activity": [
{
"ec_number": "1.1.1.62",
"activity": "17beta-estradiol + NAD(+) = estrone + H(+) + NADH.",
"evidence": [
{
"id": "O14756",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O14756"
}
]
},
{
"ec_number": "1.1.1.239",
"activity": "NAD(+) + testosterone = androst-4-ene-3,17-dione + H(+) + NADH.",
"evidence": [
{
"id": "O14756",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O14756"
}
]
},
{
"ec_number": "1.1.1.105",
"activity": "all-trans-retinol + NAD(+) = all-trans-retinal + H(+) + NADH.",
"evidence": [
{
"id": "O14756",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O14756"
}
]
},
{
"ec_number": "1.1.1.209",
"activity": "androsterone + NADP(+) = 5alpha-androstan-3,17-dione + H(+) + NADPH.",
"evidence": [
{
"id": "O14756",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O14756"
}
]
},
{
"ec_number": "1.1.1.53",
"activity": "5alpha-androstane-3alpha,17beta-diol + NAD(+) = 17beta-hydroxy-5alpha-androstan-3-one + H(+) + NADH.",
"evidence": [
{
"id": "O14756",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O14756"
}
]
},
{
"ec_number": "1.1.1.62",
"activity": "",
"evidence": [
{
"id": "O14756",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O14756"
}
]
},
{
"ec_number": "1.1.1.105",
"activity": "",
"evidence": [
{
"id": "O14756",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O14756"
}
]
},
{
"ec_number": "1.1.1.53",
"activity": "",
"evidence": [
{
"id": "O14756",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O14756"
}
]
},
{
"ec_number": "1.1.1.209",
"activity": "",
"evidence": [
{
"id": "O14756",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O14756"
}
]
},
{
"ec_number": "1.1.1.239",
"activity": "",
"evidence": [
{
"id": "O14756",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O14756"
}
]
}
]
},
{
"uniprot_ac": "O18404",
"gene_name": "scu",
"activity": [
{
"ec_number": "1.1.1.-",
"activity": "",
"evidence": [
{
"id": "O18404",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O18404"
}
]
},
{
"ec_number": "1.1.1.62",
"activity": "17beta-estradiol + NAD(+) = estrone + H(+) + NADH.",
"evidence": [
{
"id": "O18404",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O18404"
}
]
},
{
"ec_number": "1.1.1.239",
"activity": "NAD(+) + testosterone = androst-4-ene-3,17-dione + H(+) + NADH.",
"evidence": [
{
"id": "O18404",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O18404"
}
]
},
{
"ec_number": "1.1.1.201",
"activity": "a 7beta-hydroxysteroid + NADP(+) = a 7-oxosteroid + H(+) + NADPH.",
"evidence": [
{
"id": "O18404",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O18404"
}
]
},
{
"ec_number": "1.1.1.36",
"activity": "a (3R)-3-hydroxyacyl-CoA + NADP(+) = a 3-oxoacyl-CoA + H(+) + NADPH.",
"evidence": [
{
"id": "O18404",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O18404"
}
]
},
{
"ec_number": "1.1.1.35",
"activity": "a (3S)-3-hydroxyacyl-CoA + NAD(+) = a 3-oxoacyl-CoA + H(+) + NADH.",
"evidence": [
{
"id": "O18404",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O18404"
}
]
},
{
"ec_number": "1.1.1.51",
"activity": "NAD(+) + testosterone = androst-4-ene-3,17-dione + H(+) + NADH.",
"evidence": [
{
"id": "O18404",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O18404"
}
]
},
{
"ec_number": "1.1.1.53",
"activity": "5alpha-androstane-3alpha,17beta-diol + NAD(+) = 17beta-hydroxy-5alpha-androstan-3-one + H(+) + NADH.",
"evidence": [
{
"id": "O18404",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O18404"
}
]
},
{
"ec_number": "1.1.1.35",
"activity": "",
"evidence": [
{
"id": "O18404",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O18404"
}
]
}
]
},
{
"uniprot_ac": "O54753",
"gene_name": "Hsd17b6",
"activity": [
{
"ec_number": "1.1.1.62",
"activity": "17beta-estradiol + NAD(+) = estrone + H(+) + NADH.",
"evidence": [
{
"id": "O54753",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O54753"
}
]
},
{
"ec_number": "1.1.1.239",
"activity": "NAD(+) + testosterone = androst-4-ene-3,17-dione + H(+) + NADH.",
"evidence": [
{
"id": "O54753",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O54753"
}
]
},
{
"ec_number": "1.1.1.105",
"activity": "all-trans-retinol + NAD(+) = all-trans-retinal + H(+) + NADH.",
"evidence": [
{
"id": "O54753",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O54753"
}
]
},
{
"ec_number": "1.1.1.209",
"activity": "androsterone + NADP(+) = 5alpha-androstan-3,17-dione + H(+) + NADPH.",
"evidence": [
{
"id": "O54753",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O54753"
}
]
},
{
"ec_number": "1.1.1.53",
"activity": "5alpha-androstane-3alpha,17beta-diol + NAD(+) = 17beta-hydroxy-5alpha-androstan-3-one + H(+) + NADH.",
"evidence": [
{
"id": "O54753",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O54753"
}
]
},
{
"ec_number": "1.1.1.239",
"activity": "",
"evidence": [
{
"id": "O54753",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O54753"
}
]
},
{
"ec_number": "1.1.1.209",
"activity": "",
"evidence": [
{
"id": "O54753",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O54753"
}
]
},
{
"ec_number": "1.1.1.53",
"activity": "",
"evidence": [
{
"id": "O54753",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O54753"
}
]
},
{
"ec_number": "1.1.1.105",
"activity": "",
"evidence": [
{
"id": "O54753",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O54753"
}
]
},
{
"ec_number": "1.1.1.62",
"activity": "",
"evidence": [
{
"id": "O54753",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O54753"
}
]
}
]
},
{
"uniprot_ac": "O54909",
"gene_name": "Rdh16",
"activity": [
{
"ec_number": "1.1.1.105",
"activity": "all-trans-retinol + NAD(+) = all-trans-retinal + H(+) + NADH.",
"evidence": [
{
"id": "O54909",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O54909"
}
]
},
{
"ec_number": "1.1.1.315",
"activity": "11-cis-retinol--[retinol-binding protein] + NAD(+) = 11-cis-retinal--[retinol-binding protein] + H(+) + NADH.",
"evidence": [
{
"id": "O54909",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O54909"
}
]
},
{
"ec_number": "1.1.1.209",
"activity": "androsterone + NADP(+) = 5alpha-androstan-3,17-dione + H(+) + NADPH.",
"evidence": [
{
"id": "O54909",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O54909"
}
]
},
{
"ec_number": "1.1.1.53",
"activity": "5alpha-androstane-3alpha,17beta-diol + NAD(+) = 17beta-hydroxy-5alpha-androstan-3-one + H(+) + NADH.",
"evidence": [
{
"id": "O54909",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O54909"
}
]
},
{
"ec_number": "1.1.1.315",
"activity": "",
"evidence": [
{
"id": "O54909",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O54909"
}
]
},
{
"ec_number": "1.1.1.53",
"activity": "",
"evidence": [
{
"id": "O54909",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O54909"
}
]
},
{
"ec_number": "1.1.1.209",
"activity": "",
"evidence": [
{
"id": "O54909",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O54909"
}
]
},
{
"ec_number": "1.1.1.105",
"activity": "",
"evidence": [
{
"id": "O54909",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O54909"
}
]
}
]
},
{
"uniprot_ac": "O55240",
"gene_name": "Rdh5",
"activity": [
{
"ec_number": "1.1.1.315",
"activity": "11-cis-retinol--[retinol-binding protein] + NAD(+) = 11-cis-retinal--[retinol-binding protein] + H(+) + NADH.",
"evidence": [
{
"id": "O55240",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O55240"
}
]
},
{
"ec_number": "1.1.1.209",
"activity": "androsterone + NADP(+) = 5alpha-androstan-3,17-dione + H(+) + NADPH.",
"evidence": [
{
"id": "O55240",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O55240"
}
]
},
{
"ec_number": "1.1.1.53",
"activity": "5alpha-androstane-3alpha,17beta-diol + NAD(+) = 17beta-hydroxy-5alpha-androstan-3-one + H(+) + NADH.",
"evidence": [
{
"id": "O55240",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O55240"
}
]
},
{
"ec_number": "1.1.1.209",
"activity": "",
"evidence": [
{
"id": "O55240",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O55240"
}
]
},
{
"ec_number": "1.1.1.315",
"activity": "",
"evidence": [
{
"id": "O55240",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O55240"
}
]
},
{
"ec_number": "1.1.1.53",
"activity": "",
"evidence": [
{
"id": "O55240",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O55240"
}
]
}
]
},
{
"uniprot_ac": "O70351",
"gene_name": "Hsd17b10",
"activity": [
{
"ec_number": "1.1.1.35",
"activity": "a (3S)-3-hydroxyacyl-CoA + NAD(+) = a 3-oxoacyl-CoA + H(+) + NADH.",
"evidence": [
{
"id": "O70351",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O70351"
}
]
},
{
"ec_number": "1.1.1.62",
"activity": "17beta-estradiol + NAD(+) = estrone + H(+) + NADH.",
"evidence": [
{
"id": "O70351",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O70351"
}
]
},
{
"ec_number": "1.1.1.239",
"activity": "NAD(+) + testosterone = androst-4-ene-3,17-dione + H(+) + NADH.",
"evidence": [
{
"id": "O70351",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O70351"
}
]
},
{
"ec_number": "1.1.1.178",
"activity": "(2S,3S)-3-hydroxy-2-methylbutanoyl-CoA + NAD(+) = 2-methyl-3-oxobutanoyl-CoA + H(+) + NADH.",
"evidence": [
{
"id": "O70351",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O70351"
}
]
},
{
"ec_number": "1.1.1.53",
"activity": "5alpha-androstane-3alpha,17beta-diol + NAD(+) = 17beta-hydroxy-5alpha-androstan-3-one + H(+) + NADH.",
"evidence": [
{
"id": "O70351",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O70351"
}
]
},
{
"ec_number": "1.1.1.159",
"activity": "cholate + NAD(+) = 3alpha,12alpha-dihydroxy-7-oxo-5beta-cholanate + H(+) + NADH.",
"evidence": [
{
"id": "O70351",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O70351"
}
]
},
{
"ec_number": "1.1.1.35",
"activity": "",
"evidence": [
{
"id": "O70351",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O70351"
}
]
}
]
},
{
"uniprot_ac": "O75452",
"gene_name": "RDH16",
"activity": [
{
"ec_number": "1.1.1.105",
"activity": "all-trans-retinol + NAD(+) = all-trans-retinal + H(+) + NADH.",
"evidence": [
{
"id": "O75452",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O75452"
}
]
},
{
"ec_number": "1.1.1.315",
"activity": "11-cis-retinol--[retinol-binding protein] + NAD(+) = 11-cis-retinal--[retinol-binding protein] + H(+) + NADH.",
"evidence": [
{
"id": "O75452",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O75452"
}
]
},
{
"ec_number": "1.1.1.209",
"activity": "androsterone + NADP(+) = 5alpha-androstan-3,17-dione + H(+) + NADPH.",
"evidence": [
{
"id": "O75452",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O75452"
}
]
},
{
"ec_number": "1.1.1.53",
"activity": "5alpha-androstane-3alpha,17beta-diol + NAD(+) = 17beta-hydroxy-5alpha-androstan-3-one + H(+) + NADH.",
"evidence": [
{
"id": "O75452",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O75452"
}
]
},
{
"ec_number": "1.1.1.209",
"activity": "",
"evidence": [
{
"id": "O75452",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O75452"
}
]
},
{
"ec_number": "1.1.1.105",
"activity": "",
"evidence": [
{
"id": "O75452",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O75452"
}
]
},
{
"ec_number": "1.1.1.315",
"activity": "",
"evidence": [
{
"id": "O75452",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O75452"
}
]
},
{
"ec_number": "1.1.1.53",
"activity": "",
"evidence": [
{
"id": "O75452",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O75452"
}
]
}
]
},
{
"uniprot_ac": "O88451",
"gene_name": "Rdh7",
"activity": [
{
"ec_number": "1.1.1.105",
"activity": "all-trans-retinol + NAD(+) = all-trans-retinal + H(+) + NADH.",
"evidence": [
{
"id": "O88451",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O88451"
}
]
},
{
"ec_number": "1.1.1.105",
"activity": "",
"evidence": [
{
"id": "O88451",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O88451"
}
]
}
]
},
{
"uniprot_ac": "P00325",
"gene_name": "ADH1B",
"activity": [
{
"ec_number": "1.1.1.105",
"activity": "all-trans-retinol + NAD(+) = all-trans-retinal + H(+) + NADH.",
"evidence": [
{
"id": "P00325",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00325"
}
]
},
{
"ec_number": "1.1.1.105",
"activity": "",
"evidence": [
{
"id": "P00325",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P00325"
}
]
}
]
},
{
"uniprot_ac": "P08319",
"gene_name": "ADH4",
"activity": [
{
"ec_number": "1.1.1.105",
"activity": "all-trans-retinol + NAD(+) = all-trans-retinal + H(+) + NADH.",
"evidence": [
{
"id": "P08319",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08319"
}
]
},
{
"ec_number": "1.1.1.105",
"activity": "",
"evidence": [
{
"id": "P08319",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P08319"
}
]
}
]
},
{
"uniprot_ac": "P17516",
"gene_name": "AKR1C4",
"activity": [
{
"ec_number": "1.1.1.-",
"activity": "",
"evidence": [
{
"id": "P17516",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P17516"
}
]
},
{
"ec_number": "1.1.1.225",
"activity": "chlordecone alcohol + NADP(+) = chlordecone + H(+) + NADPH.",
"evidence": [
{
"id": "P17516",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P17516"
}
]
},
{
"ec_number": "1.1.1.357",
"activity": "a 3alpha-hydroxysteroid + NADP(+) = a 3-oxosteroid + H(+) + NADPH.",
"evidence": [
{
"id": "P17516",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P17516"
}
]
},
{
"ec_number": "1.1.1.62",
"activity": "17beta-estradiol + NAD(+) = estrone + H(+) + NADH.",
"evidence": [
{
"id": "P17516",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P17516"
}
]
},
{
"ec_number": "1.1.1.209",
"activity": "androsterone + NADP(+) = 5alpha-androstan-3,17-dione + H(+) + NADPH.",
"evidence": [
{
"id": "P17516",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P17516"
}
]
},
{
"ec_number": "1.1.1.51",
"activity": "NAD(+) + testosterone = androst-4-ene-3,17-dione + H(+) + NADH.",
"evidence": [
{
"id": "P17516",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P17516"
}
]
},
{
"ec_number": "1.1.1.210",
"activity": "5alpha-androstane-3beta,17beta-diol + NADP(+) = 17beta-hydroxy-5alpha-androstan-3-one + H(+) + NADPH.",
"evidence": [
{
"id": "P17516",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P17516"
}
]
},
{
"ec_number": "1.1.1.53",
"activity": "5alpha-androstane-3alpha,17beta-diol + NAD(+) = 17beta-hydroxy-5alpha-androstan-3-one + H(+) + NADH.",
"evidence": [
{
"id": "P17516",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P17516"
}
]
},
{
"ec_number": "1.1.1.62",
"activity": "",
"evidence": [
{
"id": "P17516",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P17516"
}
]
},
{
"ec_number": "1.1.1.209",
"activity": "",
"evidence": [
{
"id": "P17516",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P17516"
}
]
},
{
"ec_number": "1.1.1.53",
"activity": "",
"evidence": [
{
"id": "P17516",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P17516"
}
]
},
{
"ec_number": "1.1.1.51",
"activity": "",
"evidence": [
{
"id": "P17516",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P17516"
}
]
},
{
"ec_number": "1.1.1.210",
"activity": "",
"evidence": [
{
"id": "P17516",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P17516"
}
]
}
]
},
{
"uniprot_ac": "P40394",
"gene_name": "ADH7",
"activity": [
{
"ec_number": "1.1.1.1",
"activity": "ethanol + NAD(+) = acetaldehyde + H(+) + NADH.",
"evidence": [
{
"id": "P40394",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P40394"
}
]
},
{
"ec_number": "1.1.1.105",
"activity": "all-trans-retinol + NAD(+) = all-trans-retinal + H(+) + NADH.",
"evidence": [
{
"id": "P40394",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P40394"
}
]
},
{
"ec_number": "1.1.1.66",
"activity": "10-hydroxydecanoate + NAD(+) = 10-oxodecanoate + H(+) + NADH.",
"evidence": [
{
"id": "P40394",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P40394"
}
]
},
{
"ec_number": "1.1.1.105",
"activity": "",
"evidence": [
{
"id": "P40394",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P40394"
}
]
}
]
},
{
"uniprot_ac": "P41682",
"gene_name": "Adh7",
"activity": [
{
"ec_number": "1.1.1.1",
"activity": "ethanol + NAD(+) = acetaldehyde + H(+) + NADH.",
"evidence": [
{
"id": "P41682",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P41682"
}
]
},
{
"ec_number": "1.1.1.105",
"activity": "all-trans-retinol + NAD(+) = all-trans-retinal + H(+) + NADH.",
"evidence": [
{
"id": "P41682",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P41682"
}
]
},
{
"ec_number": "1.1.1.66",
"activity": "10-hydroxydecanoate + NAD(+) = 10-oxodecanoate + H(+) + NADH.",
"evidence": [
{
"id": "P41682",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P41682"
}
]
},
{
"ec_number": "1.1.1.105",
"activity": "",
"evidence": [
{
"id": "P41682",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P41682"
}
]
}
]
},
{
"uniprot_ac": "P42330",
"gene_name": "AKR1C3",
"activity": [
{
"ec_number": "1.1.1.-",
"activity": "",
"evidence": [
{
"id": "P42330",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P42330"
}
]
},
{
"ec_number": "1.1.1.357",
"activity": "a 3alpha-hydroxysteroid + NADP(+) = a 3-oxosteroid + H(+) + NADPH.",
"evidence": [
{
"id": "P42330",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P42330"
}
]
},
{
"ec_number": "1.1.1.62",
"activity": "17beta-estradiol + NAD(+) = estrone + H(+) + NADH.",
"evidence": [
{
"id": "P42330",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P42330"
}
]
},
{
"ec_number": "1.1.1.188",
"activity": "NADP(+) + prostaglandin F2alpha = H(+) + NADPH + prostaglandin D2.",
"evidence": [
{
"id": "P42330",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P42330"
}
]
},
{
"ec_number": "1.1.1.239",
"activity": "NAD(+) + testosterone = androst-4-ene-3,17-dione + H(+) + NADH.",
"evidence": [
{
"id": "P42330",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P42330"
}
]
},
{
"ec_number": "1.1.1.64",
"activity": "NADP(+) + testosterone = androst-4-ene-3,17-dione + H(+) + NADPH.",
"evidence": [
{
"id": "P42330",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P42330"
}
]
},
{
"ec_number": "1.1.1.210",
"activity": "5alpha-androstane-3beta,17beta-diol + NADP(+) = 17beta-hydroxy-5alpha-androstan-3-one + H(+) + NADPH.",
"evidence": [
{
"id": "P42330",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P42330"
}
]
},
{
"ec_number": "1.1.1.53",
"activity": "5alpha-androstane-3alpha,17beta-diol + NAD(+) = 17beta-hydroxy-5alpha-androstan-3-one + H(+) + NADH.",
"evidence": [
{
"id": "P42330",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P42330"
}
]
},
{
"ec_number": "1.1.1.210",
"activity": "",
"evidence": [
{
"id": "P42330",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P42330"
}
]
},
{
"ec_number": "1.1.1.53",
"activity": "",
"evidence": [
{
"id": "P42330",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P42330"
}
]
},
{
"ec_number": "1.1.1.62",
"activity": "",
"evidence": [
{
"id": "P42330",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P42330"
}
]
}
]
},
{
"uniprot_ac": "P50170",
"gene_name": "Rdh16",
"activity": [
{
"ec_number": "1.1.1.105",
"activity": "all-trans-retinol + NAD(+) = all-trans-retinal + H(+) + NADH.",
"evidence": [
{
"id": "P50170",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P50170"
}
]
},
{
"ec_number": "1.1.1.315",
"activity": "11-cis-retinol--[retinol-binding protein] + NAD(+) = 11-cis-retinal--[retinol-binding protein] + H(+) + NADH.",
"evidence": [
{
"id": "P50170",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P50170"
}
]
},
{
"ec_number": "1.1.1.209",
"activity": "androsterone + NADP(+) = 5alpha-androstan-3,17-dione + H(+) + NADPH.",
"evidence": [
{
"id": "P50170",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P50170"
}
]
},
{
"ec_number": "1.1.1.53",
"activity": "5alpha-androstane-3alpha,17beta-diol + NAD(+) = 17beta-hydroxy-5alpha-androstan-3-one + H(+) + NADH.",
"evidence": [
{
"id": "P50170",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P50170"
}
]
},
{
"ec_number": "1.1.1.209",
"activity": "",
"evidence": [
{
"id": "P50170",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P50170"
}
]
},
{
"ec_number": "1.1.1.105",
"activity": "",
"evidence": [
{
"id": "P50170",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P50170"
}
]
},
{
"ec_number": "1.1.1.53",
"activity": "",
"evidence": [
{
"id": "P50170",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P50170"
}
]
},
{
"ec_number": "1.1.1.315",
"activity": "",
"evidence": [
{
"id": "P50170",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P50170"
}
]
}
]
},
{
"uniprot_ac": "P52895",
"gene_name": "AKR1C2",
"activity": [
{
"ec_number": "1.-.-.-",
"activity": "",
"evidence": [
{
"id": "P52895",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P52895"
}
]
},
{
"ec_number": "1.1.1.357",
"activity": "a 3alpha-hydroxysteroid + NADP(+) = a 3-oxosteroid + H(+) + NADPH.",
"evidence": [
{
"id": "P52895",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P52895"
}
]
},
{
"ec_number": "1.1.1.62",
"activity": "17beta-estradiol + NAD(+) = estrone + H(+) + NADH.",
"evidence": [
{
"id": "P52895",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P52895"
}
]
},
{
"ec_number": "1.1.1.112",
"activity": "(S)-indan-1-ol + NAD(+) = H(+) + indan-1-one + NADH.",
"evidence": [
{
"id": "P52895",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P52895"
}
]
},
{
"ec_number": "1.3.1.20",
"activity": "(1R,2R)-1,2-dihydrobenzene-1,2-diol + NADP(+) = catechol + H(+) + NADPH.",
"evidence": [
{
"id": "P52895",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P52895"
}
]
},
{
"ec_number": "1.1.1.209",
"activity": "androsterone + NADP(+) = 5alpha-androstan-3,17-dione + H(+) + NADPH.",
"evidence": [
{
"id": "P52895",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P52895"
}
]
},
{
"ec_number": "1.1.1.53",
"activity": "5alpha-androstane-3alpha,17beta-diol + NAD(+) = 17beta-hydroxy-5alpha-androstan-3-one + H(+) + NADH.",
"evidence": [
{
"id": "P52895",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P52895"
}
]
},
{
"ec_number": "1.1.1.112",
"activity": "",
"evidence": [
{
"id": "P52895",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P52895"
}
]
},
{
"ec_number": "1.1.1.209",
"activity": "",
"evidence": [
{
"id": "P52895",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P52895"
}
]
},
{
"ec_number": "1.1.1.53",
"activity": "",
"evidence": [
{
"id": "P52895",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P52895"
}
]
},
{
"ec_number": "1.1.1.62",
"activity": "",
"evidence": [
{
"id": "P52895",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P52895"
}
]
},
{
"ec_number": "1.3.1.20",
"activity": "",
"evidence": [
{
"id": "P52895",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P52895"
}
]
}
]
},
{
"uniprot_ac": "P55006",
"gene_name": "Rdh7",
"activity": [
{
"ec_number": "1.1.1.105",
"activity": "all-trans-retinol + NAD(+) = all-trans-retinal + H(+) + NADH.",
"evidence": [
{
"id": "P55006",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P55006"
}
]
},
{
"ec_number": "1.1.1.105",
"activity": "",
"evidence": [
{
"id": "P55006",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P55006"
}
]
}
]
},
{
"uniprot_ac": "Q04828",
"gene_name": "AKR1C1",
"activity": [
{
"ec_number": "1.1.1.-",
"activity": "",
"evidence": [
{
"id": "Q04828",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q04828"
}
]
},
{
"ec_number": "1.1.1.357",
"activity": "a 3alpha-hydroxysteroid + NADP(+) = a 3-oxosteroid + H(+) + NADPH.",
"evidence": [
{
"id": "Q04828",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q04828"
}
]
},
{
"ec_number": "1.1.1.62",
"activity": "17beta-estradiol + NAD(+) = estrone + H(+) + NADH.",
"evidence": [
{
"id": "Q04828",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q04828"
}
]
},
{
"ec_number": "1.1.1.112",
"activity": "(S)-indan-1-ol + NAD(+) = H(+) + indan-1-one + NADH.",
"evidence": [
{
"id": "Q04828",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q04828"
}
]
},
{
"ec_number": "1.1.1.149",
"activity": "(17R,20S)-17,20-dihydroxypregn-4-en-3-one + NAD(+) = 17alpha-hydroxyprogesterone + H(+) + NADH.",
"evidence": [
{
"id": "Q04828",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q04828"
}
]
},
{
"ec_number": "1.3.1.20",
"activity": "(1R,2R)-1,2-dihydrobenzene-1,2-diol + NADP(+) = catechol + H(+) + NADPH.",
"evidence": [
{
"id": "Q04828",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q04828"
}
]
},
{
"ec_number": "1.1.1.209",
"activity": "androsterone + NADP(+) = 5alpha-androstan-3,17-dione + H(+) + NADPH.",
"evidence": [
{
"id": "Q04828",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q04828"
}
]
},
{
"ec_number": "1.1.1.51",
"activity": "NAD(+) + testosterone = androst-4-ene-3,17-dione + H(+) + NADH.",
"evidence": [
{
"id": "Q04828",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q04828"
}
]
},
{
"ec_number": "1.1.1.210",
"activity": "5alpha-androstane-3beta,17beta-diol + NADP(+) = 17beta-hydroxy-5alpha-androstan-3-one + H(+) + NADPH.",
"evidence": [
{
"id": "Q04828",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q04828"
}
]
},
{
"ec_number": "1.1.1.53",
"activity": "5alpha-androstane-3alpha,17beta-diol + NAD(+) = 17beta-hydroxy-5alpha-androstan-3-one + H(+) + NADH.",
"evidence": [
{
"id": "Q04828",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q04828"
}
]
},
{
"ec_number": "1.1.1.62",
"activity": "",
"evidence": [
{
"id": "Q04828",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q04828"
}
]
},
{
"ec_number": "1.1.1.209",
"activity": "",
"evidence": [
{
"id": "Q04828",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q04828"
}
]
},
{
"ec_number": "1.3.1.20",
"activity": "",
"evidence": [
{
"id": "Q04828",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q04828"
}
]
},
{
"ec_number": "1.1.1.53",
"activity": "",
"evidence": [
{
"id": "Q04828",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q04828"
}
]
},
{
"ec_number": "1.1.1.112",
"activity": "",
"evidence": [
{
"id": "Q04828",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q04828"
}
]
},
{
"ec_number": "1.1.1.210",
"activity": "",
"evidence": [
{
"id": "Q04828",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q04828"
}
]
},
{
"ec_number": "1.1.1.357",
"activity": "",
"evidence": [
{
"id": "Q04828",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q04828"
}
]
},
{
"ec_number": "1.1.1.51",
"activity": "",
"evidence": [
{
"id": "Q04828",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q04828"
}
]
}
]
},
{
"uniprot_ac": "Q58NB6",
"gene_name": "Dhrs9",
"activity": [
{
"ec_number": "1.1.1.105",
"activity": "all-trans-retinol + NAD(+) = all-trans-retinal + H(+) + NADH.",
"evidence": [
{
"id": "Q58NB6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q58NB6"
}
]
},
{
"ec_number": "1.1.1.209",
"activity": "androsterone + NADP(+) = 5alpha-androstan-3,17-dione + H(+) + NADPH.",
"evidence": [
{
"id": "Q58NB6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q58NB6"
}
]
},
{
"ec_number": "1.1.1.53",
"activity": "5alpha-androstane-3alpha,17beta-diol + NAD(+) = 17beta-hydroxy-5alpha-androstan-3-one + H(+) + NADH.",
"evidence": [
{
"id": "Q58NB6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q58NB6"
}
]
},
{
"ec_number": "1.1.1.53",
"activity": "",
"evidence": [
{
"id": "Q58NB6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q58NB6"
}
]
},
{
"ec_number": "1.1.1.209",
"activity": "",
"evidence": [
{
"id": "Q58NB6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q58NB6"
}
]
}
]
},
{
"uniprot_ac": "Q5M875",
"gene_name": "Hsd17b13",
"activity": [
{
"ec_number": "1.1.1.-",
"activity": "",
"evidence": [
{
"id": "Q5M875",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5M875"
}
]
},
{
"ec_number": "1.1.1.62",
"activity": "17beta-estradiol + NAD(+) = estrone + H(+) + NADH.",
"evidence": [
{
"id": "Q5M875",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5M875"
}
]
},
{
"ec_number": "1.1.1.105",
"activity": "all-trans-retinol + NAD(+) = all-trans-retinal + H(+) + NADH.",
"evidence": [
{
"id": "Q5M875",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5M875"
}
]
},
{
"ec_number": "1.1.1.62",
"activity": "",
"evidence": [
{
"id": "Q5M875",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5M875"
}
]
}
]
},
{
"uniprot_ac": "Q64437",
"gene_name": "Adh7",
"activity": [
{
"ec_number": "1.1.1.1",
"activity": "ethanol + NAD(+) = acetaldehyde + H(+) + NADH.",
"evidence": [
{
"id": "Q64437",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q64437"
}
]
},
{
"ec_number": "1.1.1.105",
"activity": "all-trans-retinol + NAD(+) = all-trans-retinal + H(+) + NADH.",
"evidence": [
{
"id": "Q64437",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q64437"
}
]
},
{
"ec_number": "1.1.1.66",
"activity": "10-hydroxydecanoate + NAD(+) = 10-oxodecanoate + H(+) + NADH.",
"evidence": [
{
"id": "Q64437",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q64437"
}
]
},
{
"ec_number": "1.1.1.105",
"activity": "",
"evidence": [
{
"id": "Q64437",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q64437"
}
]
}
]
},
{
"uniprot_ac": "Q64563",
"gene_name": "Adh4",
"activity": [
{
"ec_number": "1.1.1.105",
"activity": "all-trans-retinol + NAD(+) = all-trans-retinal + H(+) + NADH.",
"evidence": [
{
"id": "Q64563",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q64563"
}
]
},
{
"ec_number": "1.1.1.105",
"activity": "",
"evidence": [
{
"id": "Q64563",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q64563"
}
]
}
]
},
{
"uniprot_ac": "Q6AYQ2",
"gene_name": "Akr1c21",
"activity": [
{
"ec_number": "1.1.1.-",
"activity": "",
"evidence": [
{
"id": "Q6AYQ2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6AYQ2"
}
]
},
{
"ec_number": "1.1.1.209",
"activity": "androsterone + NADP(+) = 5alpha-androstan-3,17-dione + H(+) + NADPH.",
"evidence": [
{
"id": "Q6AYQ2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6AYQ2"
}
]
}
]
},
{
"uniprot_ac": "Q7TQA3",
"gene_name": "Sdr16c5",
"activity": [
{
"ec_number": "1.1.1.105",
"activity": "all-trans-retinol + NAD(+) = all-trans-retinal + H(+) + NADH.",
"evidence": [
{
"id": "Q7TQA3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q7TQA3"
}
]
},
{
"ec_number": "1.1.1.105",
"activity": "",
"evidence": [
{
"id": "Q7TQA3",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q7TQA3"
}
]
}
]
},
{
"uniprot_ac": "Q7Z5P4",
"gene_name": "HSD17B13",
"activity": [
{
"ec_number": "1.1.1.-",
"activity": "",
"evidence": [
{
"id": "Q7Z5P4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q7Z5P4"
}
]
},
{
"ec_number": "1.1.1.62",
"activity": "17beta-estradiol + NAD(+) = estrone + H(+) + NADH.",
"evidence": [
{
"id": "Q7Z5P4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q7Z5P4"
}
]
},
{
"ec_number": "1.1.1.105",
"activity": "all-trans-retinol + NAD(+) = all-trans-retinal + H(+) + NADH.",
"evidence": [
{
"id": "Q7Z5P4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q7Z5P4"
}
]
},
{
"ec_number": "1.1.1.62",
"activity": "",
"evidence": [
{
"id": "Q7Z5P4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q7Z5P4"
}
]
}
]
},
{
"uniprot_ac": "Q8CHS7",
"gene_name": "Dhrs7c",
"activity": [
{
"ec_number": "1.1.1.105",
"activity": "all-trans-retinol + NAD(+) = all-trans-retinal + H(+) + NADH.",
"evidence": [
{
"id": "Q8CHS7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8CHS7"
}
]
},
{
"ec_number": "1.1.1.105",
"activity": "",
"evidence": [
{
"id": "Q8CHS7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8CHS7"
}
]
}
]
},
{
"uniprot_ac": "Q8IZV5",
"gene_name": "RDH10",
"activity": [
{
"ec_number": "1.1.1.300",
"activity": "all-trans-retinol + NADP(+) = all-trans-retinal + H(+) + NADPH.",
"evidence": [
{
"id": "Q8IZV5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8IZV5"
}
]
},
{
"ec_number": "1.1.1.300",
"activity": "",
"evidence": [
{
"id": "Q8IZV5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8IZV5"
}
]
}
]
},
{
"uniprot_ac": "Q8N3Y7",
"gene_name": "SDR16C5",
"activity": [
{
"ec_number": "1.1.1.105",
"activity": "all-trans-retinol + NAD(+) = all-trans-retinal + H(+) + NADH.",
"evidence": [
{
"id": "Q8N3Y7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8N3Y7"
}
]
},
{
"ec_number": "1.1.1.105",
"activity": "",
"evidence": [
{
"id": "Q8N3Y7",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8N3Y7"
}
]
}
]
},
{
"uniprot_ac": "Q8NEX9",
"gene_name": "SDR9C7",
"activity": [
{
"ec_number": "1.1.1.-",
"activity": "",
"evidence": [
{
"id": "Q8NEX9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8NEX9"
}
]
}
]
},
{
"uniprot_ac": "Q8VCR2",
"gene_name": "Hsd17b13",
"activity": [
{
"ec_number": "1.1.1.-",
"activity": "",
"evidence": [
{
"id": "Q8VCR2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8VCR2"
}
]
},
{
"ec_number": "1.1.1.62",
"activity": "17beta-estradiol + NAD(+) = estrone + H(+) + NADH.",
"evidence": [
{
"id": "Q8VCR2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8VCR2"
}
]
},
{
"ec_number": "1.1.1.105",
"activity": "all-trans-retinol + NAD(+) = all-trans-retinal + H(+) + NADH.",
"evidence": [
{
"id": "Q8VCR2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8VCR2"
}
]
},
{
"ec_number": "1.1.1.62",
"activity": "",
"evidence": [
{
"id": "Q8VCR2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8VCR2"
}
]
}
]
},
{
"uniprot_ac": "Q8VD48",
"gene_name": "Dhrs9",
"activity": [
{
"ec_number": "1.1.1.105",
"activity": "all-trans-retinol + NAD(+) = all-trans-retinal + H(+) + NADH.",
"evidence": [
{
"id": "Q8VD48",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8VD48"
}
]
},
{
"ec_number": "1.1.1.209",
"activity": "androsterone + NADP(+) = 5alpha-androstan-3,17-dione + H(+) + NADPH.",
"evidence": [
{
"id": "Q8VD48",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8VD48"
}
]
},
{
"ec_number": "1.1.1.53",
"activity": "5alpha-androstane-3alpha,17beta-diol + NAD(+) = 17beta-hydroxy-5alpha-androstan-3-one + H(+) + NADH.",
"evidence": [
{
"id": "Q8VD48",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8VD48"
}
]
},
{
"ec_number": "1.1.1.53",
"activity": "",
"evidence": [
{
"id": "Q8VD48",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8VD48"
}
]
},
{
"ec_number": "1.1.1.209",
"activity": "",
"evidence": [
{
"id": "Q8VD48",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8VD48"
}
]
}
]
},
{
"uniprot_ac": "Q91WR5",
"gene_name": "Akr1c21",
"activity": [
{
"ec_number": "1.1.1.-",
"activity": "",
"evidence": [
{
"id": "Q91WR5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q91WR5"
}
]
},
{
"ec_number": "1.1.1.209",
"activity": "androsterone + NADP(+) = 5alpha-androstan-3,17-dione + H(+) + NADPH.",
"evidence": [
{
"id": "Q91WR5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q91WR5"
}
]
}
]
},
{
"uniprot_ac": "Q92781",
"gene_name": "RDH5",
"activity": [
{
"ec_number": "1.1.1.315",
"activity": "11-cis-retinol--[retinol-binding protein] + NAD(+) = 11-cis-retinal--[retinol-binding protein] + H(+) + NADH.",
"evidence": [
{
"id": "Q92781",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q92781"
}
]
},
{
"ec_number": "1.1.1.209",
"activity": "androsterone + NADP(+) = 5alpha-androstan-3,17-dione + H(+) + NADPH.",
"evidence": [
{
"id": "Q92781",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q92781"
}
]
},
{
"ec_number": "1.1.1.53",
"activity": "5alpha-androstane-3alpha,17beta-diol + NAD(+) = 17beta-hydroxy-5alpha-androstan-3-one + H(+) + NADH.",
"evidence": [
{
"id": "Q92781",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q92781"
}
]
},
{
"ec_number": "1.1.1.315",
"activity": "",
"evidence": [
{
"id": "Q92781",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q92781"
}
]
},
{
"ec_number": "1.1.1.53",
"activity": "",
"evidence": [
{
"id": "Q92781",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q92781"
}
]
},
{
"ec_number": "1.1.1.209",
"activity": "",
"evidence": [
{
"id": "Q92781",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q92781"
}
]
}
]
},
{
"uniprot_ac": "Q99714",
"gene_name": "HSD17B10",
"activity": [
{
"ec_number": "1.1.1.35",
"activity": "a (3S)-3-hydroxyacyl-CoA + NAD(+) = a 3-oxoacyl-CoA + H(+) + NADH.",
"evidence": [
{
"id": "Q99714",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q99714"
}
]
},
{
"ec_number": "1.1.1.62",
"activity": "17beta-estradiol + NAD(+) = estrone + H(+) + NADH.",
"evidence": [
{
"id": "Q99714",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q99714"
}
]
},
{
"ec_number": "1.1.1.239",
"activity": "NAD(+) + testosterone = androst-4-ene-3,17-dione + H(+) + NADH.",
"evidence": [
{
"id": "Q99714",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q99714"
}
]
},
{
"ec_number": "1.1.1.178",
"activity": "(2S,3S)-3-hydroxy-2-methylbutanoyl-CoA + NAD(+) = 2-methyl-3-oxobutanoyl-CoA + H(+) + NADH.",
"evidence": [
{
"id": "Q99714",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q99714"
}
]
},
{
"ec_number": "1.1.1.53",
"activity": "5alpha-androstane-3alpha,17beta-diol + NAD(+) = 17beta-hydroxy-5alpha-androstan-3-one + H(+) + NADH.",
"evidence": [
{
"id": "Q99714",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q99714"
}
]
},
{
"ec_number": "1.1.1.159",
"activity": "cholate + NAD(+) = 3alpha,12alpha-dihydroxy-7-oxo-5beta-cholanate + H(+) + NADH.",
"evidence": [
{
"id": "Q99714",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q99714"
}
]
},
{
"ec_number": "1.1.1.35",
"activity": "",
"evidence": [
{
"id": "Q99714",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q99714"
}
]
}
]
},
{
"uniprot_ac": "Q9BPW9",
"gene_name": "DHRS9",
"activity": [
{
"ec_number": "1.1.1.105",
"activity": "all-trans-retinol + NAD(+) = all-trans-retinal + H(+) + NADH.",
"evidence": [
{
"id": "Q9BPW9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9BPW9"
}
]
},
{
"ec_number": "1.1.1.209",
"activity": "androsterone + NADP(+) = 5alpha-androstan-3,17-dione + H(+) + NADPH.",
"evidence": [
{
"id": "Q9BPW9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9BPW9"
}
]
},
{
"ec_number": "1.1.1.53",
"activity": "5alpha-androstane-3alpha,17beta-diol + NAD(+) = 17beta-hydroxy-5alpha-androstan-3-one + H(+) + NADH.",
"evidence": [
{
"id": "Q9BPW9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9BPW9"
}
]
},
{
"ec_number": "1.1.1.53",
"activity": "",
"evidence": [
{
"id": "Q9BPW9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9BPW9"
}
]
},
{
"ec_number": "1.1.1.209",
"activity": "",
"evidence": [
{
"id": "Q9BPW9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9BPW9"
}
]
}
]
},
{
"uniprot_ac": "Q9QYY9",
"gene_name": "Adh4",
"activity": [
{
"ec_number": "1.1.1.105",
"activity": "all-trans-retinol + NAD(+) = all-trans-retinal + H(+) + NADH.",
"evidence": [
{
"id": "Q9QYY9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9QYY9"
}
]
},
{
"ec_number": "1.1.1.105",
"activity": "",
"evidence": [
{
"id": "Q9QYY9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9QYY9"
}
]
}
]
},
{
"uniprot_ac": "Q9R092",
"gene_name": "Hsd17b6",
"activity": [
{
"ec_number": "1.1.1.62",
"activity": "17beta-estradiol + NAD(+) = estrone + H(+) + NADH.",
"evidence": [
{
"id": "Q9R092",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9R092"
}
]
},
{
"ec_number": "1.1.1.239",
"activity": "NAD(+) + testosterone = androst-4-ene-3,17-dione + H(+) + NADH.",
"evidence": [
{
"id": "Q9R092",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9R092"
}
]
},
{
"ec_number": "1.1.1.105",
"activity": "all-trans-retinol + NAD(+) = all-trans-retinal + H(+) + NADH.",
"evidence": [
{
"id": "Q9R092",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9R092"
}
]
},
{
"ec_number": "1.1.1.209",
"activity": "androsterone + NADP(+) = 5alpha-androstan-3,17-dione + H(+) + NADPH.",
"evidence": [
{
"id": "Q9R092",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9R092"
}
]
},
{
"ec_number": "1.1.1.53",
"activity": "5alpha-androstane-3alpha,17beta-diol + NAD(+) = 17beta-hydroxy-5alpha-androstan-3-one + H(+) + NADH.",
"evidence": [
{
"id": "Q9R092",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9R092"
}
]
},
{
"ec_number": "1.1.1.62",
"activity": "",
"evidence": [
{
"id": "Q9R092",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9R092"
}
]
},
{
"ec_number": "1.1.1.105",
"activity": "",
"evidence": [
{
"id": "Q9R092",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9R092"
}
]
},
{
"ec_number": "1.1.1.53",
"activity": "",
"evidence": [
{
"id": "Q9R092",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9R092"
}
]
},
{
"ec_number": "1.1.1.209",
"activity": "",
"evidence": [
{
"id": "Q9R092",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9R092"
}
]
},
{
"ec_number": "1.1.1.239",
"activity": "",
"evidence": [
{
"id": "Q9R092",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9R092"
}
]
}
]
}
],
"biomarkers": [],
"synthesized_glycans": [],
"cluster_types": [
{
"name": "homologset.oma",
"label": "OMA Homologs"
},
{
"name": "homologset.mgi",
"label": "MGI Homologs"
}
],
"sequence_features": {
"n_linked_sites": [],
"o_linked_sites": [],
"snv_sites": [],
"glycation_sites": [],
"phosphorylation_sites": [],
"sequon_annotation_sites": [
{
"start_pos": 161,
"end_pos": 163
}
]
},
"section_stats": [
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "snv",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "snv_disease",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "snv_non_disease",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "publication",
"table_stats": [
{
"field": "total",
"count": 64
}
],
"sort_fields": [
"title",
"journal",
"date",
"authors"
]
}
]
}