{ "uniprot_canonical_ac": "O75310-1", "uniprot_ac": "O75310", "uniprot_id": "UDB11_HUMAN", "mass": { "chemical_mass": 61038.0, "monoisotopic_mass": 61038.0 }, "refseq": { "ac": "NP_001064", "name": "UDP-glucuronosyltransferase 2B11 precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001064" }, "gene_names": [ { "name": "UGT2B11", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O75310", "id": "O75310" }, { "name": "UGT2B11", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001064", "id": "NP_001064" } ], "protein_names": [ { "name": "UDP-glucuronosyltransferase 2B11", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O75310" }, { "name": "2.4.1.17", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O75310" }, { "name": "UDP-glucuronosyltransferase 2B11 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001064", "id": "NP_001064" }, { "name": "UDPGT 2B11; UDP glycosyltransferase 2 family, polypeptide B11; UDP glycosyltransferase 2 family protein; UDP glucuronosyltransferase 2 family, polypeptide B11; UDP-glucuronosyltransferase 2B11", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001064", "id": "NP_001064" }, { "name": "UDPGT 2B11", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O75310" } ], "function": [ { "annotation": "CYP3A4, CYP3A7, UGT2B11 and UGT2B15 genes are significantly downregulated in melanosis coli.", "evidence": [ { "database": "RefSeq", "id": "NP_001064", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001064" }, { "database": "PubMed", "id": "26238215", "url": "https://glygen.org/publication/PubMed/26238215" } ] }, { "annotation": "Significant expression of UGT2B11 was detected in the liver, breast and kidney, and was clearly different from the distribution of UGT2B28", "evidence": [ { "database": "RefSeq", "id": "NP_001064", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001064" }, { "database": "PubMed", "id": "21679149", "url": "https://glygen.org/publication/PubMed/21679149" } ] }, { "annotation": "UDPGT is of major importance in the conjugation and subsequent elimination of potentially toxic xenobiotics and endogenous compounds.", "evidence": [ { "database": "UniProtKB", "id": "O75310", "url": "https://www.uniprot.org/uniprot/O75310#function" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "O75310", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O75310" } ], "glycoeffect": [], "start_pos": 162, "end_pos": 162, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "A", "sequence_mut": "V", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "4", "chr_pos": "69214238", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "A162", "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] }, { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] }, { "disease_id": "DOID:1319", "recommended_name": { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain cancer", "description": "A central nervous system cancer that is characterized by the growth of abnormal cells in the tissues of the brain." }, "synonyms": [ { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "BT - Brain tumour", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "adult brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "adult malignant brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain neoplasm, adult", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant brain tumour", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant primary brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant primary brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant tumor of Brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant tumor of adult brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "neoplasm of brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary malignant neoplasm of brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "tumor of the Brain", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs748035775", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748035775" }, { "id": "rs748035775", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748035775" }, { "id": "rs748035775", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs748035775" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 215, "end_pos": 215, "sequence_org": "I", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NMI->NMT).", "chr_id": "4", "chr_pos": "69214079", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "I215", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1240388353", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1240388353" }, { "id": "rs1240388353", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1240388353" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 315, "end_pos": 315, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NMT->IMT).", "chr_id": "4", "chr_pos": "69208409", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N315", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1461258293", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1461258293" }, { "id": "rs1461258293", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1461258293" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 317, "end_pos": 317, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NMT->NMI).", "chr_id": "4", "chr_pos": "69208403", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T317", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O75310", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O75310" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 317, "end_pos": 317, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NMT->NMK).", "chr_id": "4", "chr_pos": "69208403", "ref_nt": "G", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "T317", "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs201637982", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201637982" }, { "id": "rs201637982", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201637982" }, { "id": "rs201637982", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs201637982#frequency_tab" }, { "id": "rs201637982", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs201637982" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 344, "end_pos": 344, "sequence_org": "P", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NKP->NKS).", "chr_id": "4", "chr_pos": "69205540", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P344", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs201637982", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201637982" }, { "id": "rs201637982", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201637982" }, { "id": "rs201637982", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs201637982#frequency_tab" }, { "id": "rs201637982", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs201637982" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 344, "end_pos": 344, "sequence_org": "P", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NKP->NKT).", "chr_id": "4", "chr_pos": "69205540", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P344", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O75310", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O75310" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 436, "end_pos": 436, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "P", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NDP->NDS).", "chr_id": "4", "chr_pos": "69204434", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "P436", "disease": [ { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1316028362", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1316028362" }, { "id": "rs1316028362", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1316028362" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 443, "end_pos": 443, "sequence_org": "M", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NIM->NIT).", "chr_id": "4", "chr_pos": "69200702", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "M443", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs756939149", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756939149" }, { "id": "rs756939149", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756939149" }, { "id": "rs756939149", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs756939149#frequency_tab" }, { "id": "rs756939149", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs756939149" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 69, "end_pos": 69, "sequence_org": "A", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NDA->NDS).", "chr_id": "4", "chr_pos": "69214518", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A69", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs756939149", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756939149" }, { "id": "rs756939149", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756939149" }, { "id": "rs756939149", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756939149" }, { "id": "rs756939149", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs756939149#frequency_tab" }, { "id": "rs756939149", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs756939149" }, { "id": "22810696", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22810696" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 69, "end_pos": 69, "sequence_org": "A", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NDA->NDT).", "chr_id": "4", "chr_pos": "69214518", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A69", "keywords": [ "ebi", "somatic" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "63.81", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000213759", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000213759" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "50.71", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000213759", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000213759" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "17.43", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000213759", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000213759" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "46.24", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000213759", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000213759" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "55.84", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000213759", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000213759" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "52.7", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000213759", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000213759" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "72.95", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000213759", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000213759" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "27.34", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000213759", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000213759" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "55.54", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000213759", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000213759" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O75310", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75310" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O75310", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75310" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O75310", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75310" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O75310", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75310" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O75310", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75310" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O75310", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75310" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O75310", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75310" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O75310", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75310" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O75310", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75310" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O75310", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75310" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O75310", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75310" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O75310", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75310" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75310", "url": "https://www.uniprot.org/uniprot/O75310" } ], "common_name": "Human" } ], "gene": [ { "name": "UGT2B11", "url": "https://www.uniprot.org/uniprot/O75310", "locus": { "chromosome": "4", "start_pos": 69199951, "end_pos": 69214748, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000213759", "url": "https://www.ensembl.org/id/ENSG00000213759" } ] } } ], "crossref": [ { "id": "ENSG00000213759", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000213759", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "O75310", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O75310", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "2.4.1.17", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.4.1.17&UniProtAcc=O75310", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "GT1", "url": "http://www.cazy.org/GT1.html", "database": "CAZy", "categories": [ "Protein Classification" ] }, { "id": "cd03784", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd03784", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL4523985", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL4523985", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "UGT2B11", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=UGT2B11", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "10720", "url": "https://www.ncbi.nlm.nih.gov/gene/10720", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "12545", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=12545", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O75310", "url": "https://www.ebi.ac.uk/intact/interactors/id:O75310*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR002213", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002213", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR035595", "url": "https://www.ebi.ac.uk/interpro/entry/IPR035595", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:10720", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:10720", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "603064", "url": "http://www.omim.org/entry/603064", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O75310", "url": "https://www.nextprot.org/entry/NX_O75310", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "NHHITIV", "url": "https://omabrowser.org/oma/group/NHHITIV/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "382054at2759", "url": "http://www.orthodb.org/?query=382054at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR48043", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48043", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR48043:SF86", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48043:SF86", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00201", "url": "http://pfam.xfam.org/family/PF00201", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O75310", "url": "https://pharos.nih.gov/targets/O75310", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O75310", "url": "http://purl.obolibrary.org/obo/PR_O75310", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-156588", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156588", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001064", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001064", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "21032", "url": "https://www.rhea-db.org/rhea/21032", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "O75310", "url": "https://www.uniprot.org/uniprot/O75310", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O75310-1", "url": "https://www.uniprot.org/uniprot/O75310-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MTLKWTSVLLLIHLSCYFSSGSCGKVLVWAAEYSHWMNMKTILKELVQRGHEVTVLASSASILFDPNDASTLKFEVYPTSLTKTEFENIIMQQVKRWSDIRKDSFWLYFSQEQEILWELYDIFRNFCKDVVSNKKVMKKLQESRFDIVFADAVFPCGELLAALLNIRFVYSLRFTPGYTIERHSGGLIFPPSYIPIVMSKLSDQMTFMERVKNMIYVLYFDFWFQMSDMKKWDQFYSEVLGRPTTLFETMGKADIWLMRNSWSFQFPHPFLPNVDFVGGFHCKPAKPLPKEMEEFVQSSGENGVVVFSLGSVISNMTAERANVIATALAKIPQKVLWRFDGNKPDALGLNTRLYKWIPQNDLLGHPKTRAFITHGGANGIYEAIYHGIPMVGIPLFFDQPDNIAHMKAKGAAVRLDFNTMSSTDLLNALKTVINDPLYKENIMKLSRIQHDQPVKPLDRAVFWIEFVMPHKGAKHLRVAAHDLTWFQYHSLDVIGFLLACVATVIFIITKFCLFCFWKFARKGKKGKRD", "length": 529, "header": "sp|O75310-1|UDB11_HUMAN Isoform 1 of UDP-glucuronosyltransferase 2B11 OS=Homo sapiens OX=9606 GN=UGT2B11 PE=1 SV=1 CANONICAL=O75310-1" }, "isoforms": [ { "isoform_ac": "O75310-1", "url": "", "sequence": { "sequence": "MTLKWTSVLLLIHLSCYFSSGSCGKVLVWAAEYSHWMNMKTILKELVQRGHEVTVLASSASILFDPNDASTLKFEVYPTSLTKTEFENIIMQQVKRWSDIRKDSFWLYFSQEQEILWELYDIFRNFCKDVVSNKKVMKKLQESRFDIVFADAVFPCGELLAALLNIRFVYSLRFTPGYTIERHSGGLIFPPSYIPIVMSKLSDQMTFMERVKNMIYVLYFDFWFQMSDMKKWDQFYSEVLGRPTTLFETMGKADIWLMRNSWSFQFPHPFLPNVDFVGGFHCKPAKPLPKEMEEFVQSSGENGVVVFSLGSVISNMTAERANVIATALAKIPQKVLWRFDGNKPDALGLNTRLYKWIPQNDLLGHPKTRAFITHGGANGIYEAIYHGIPMVGIPLFFDQPDNIAHMKAKGAAVRLDFNTMSSTDLLNALKTVINDPLYKENIMKLSRIQHDQPVKPLDRAVFWIEFVMPHKGAKHLRVAAHDLTWFQYHSLDVIGFLLACVATVIFIITKFCLFCFWKFARKGKKGKRD", "length": 529, "header": "sp|O75310-1|UDB11_HUMAN Isoform 1 of UDP-glucuronosyltransferase 2B11 OS=Homo sapiens OX=9606 GN=UGT2B11 PE=1 SV=1 CANONICAL=O75310-1" }, "locus": { "chromosome": "4", "start_pos": 69214722, "end_pos": 69200443, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000446444.2", "url": "https://www.ensembl.org/id/ENST00000446444.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000387683.1", "url": "https://www.ensembl.org/id/ENSP00000387683.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 315, "start_aa": "Asn", "end_pos": 315, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn315", "evidence": [ { "id": "O75310", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75310#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme", "glycosyltransferase-activity", "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "Drug resistance and ATP-dependent conjugate transport mediated by the apical multidrug resistance protein, MRP2, permanently expressed in human and canine cells.", "journal": "Molecular pharmacology", "date": "1999", "authors": "Cui Y, Konig J, Buchholz JK, Spring H, Leier I, Keppler D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "10220572", "url": "https://glygen.org/publication/PubMed/10220572" } ] }, { "title": "Characterization of the CoA ligases of human liver mitochondria catalyzing the activation of short- and medium-chain fatty acids and xenobiotic carboxylic acids.", "journal": "Biochimica et biophysica acta", "date": "1999", "authors": "Vessey DA, Kelley M, Warren RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "10434065", "url": "https://glygen.org/publication/PubMed/10434065" } ] }, { "title": "Isolation of a family of organic anion transporters from human liver and kidney.", "journal": "Biochemical and biophysical research communications", "date": "2001", "authors": "Sun W, Wu RR, van Poelje PD, Erion MD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "11327718", "url": "https://glygen.org/publication/PubMed/11327718" } ] }, { "title": "Characterization of drug transport by the human multidrug resistance protein 3 (ABCC3).", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Zelcer N, Saeki T, Reid G, Beijnen JH, Borst P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "11581266", "url": "https://glygen.org/publication/PubMed/11581266" } ] }, { "title": "Characterization of nicotine and cotinine N-glucuronidations in human liver microsomes.", "journal": "Drug metabolism and disposition: the biological fate of chemicals", "date": "2002", "authors": "Nakajima M, Tanaka E, Kwon JT, Yokoi T", "evidence": [ { "database": "Reactome", "id": "R-HSA-156588", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156588" } ], "reference": [ { "type": "PubMed", "id": "12433823", "url": "https://glygen.org/publication/PubMed/12433823" } ] }, { "title": "Isolation, sequencing, and expression of a cDNA for the HXM-A form of xenobiotic/medium-chain fatty acid:CoA ligase from human liver mitochondria.", "journal": "Journal of biochemical and molecular toxicology", "date": "2003", "authors": "Vessey DA, Lau E, Kelley M, Warren RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "12616642", "url": "https://glygen.org/publication/PubMed/12616642" } ] }, { "title": "A novel complex locus UGT1 encodes human bilirubin, phenol, and other UDP-glucuronosyltransferase isozymes with identical carboxyl termini.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Ritter JK, Chen F, Sheen YY, Tran HM, Kimura S, Yeatman MT, Owens IS", "evidence": [ { "database": "Reactome", "id": "R-HSA-156588", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156588" } ], "reference": [ { "type": "PubMed", "id": "1339448", "url": "https://glygen.org/publication/PubMed/1339448" } ] }, { "title": "Interaction of serum and sodium salicylate: changes during acute infection and its influence on pharmacological activity.", "journal": "Bulletin of the Johns Hopkins Hospital", "date": "1960", "authors": "REYNOLDS RC, CLUFF LE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "13741103", "url": "https://glygen.org/publication/PubMed/13741103" } ] }, { "title": "N-glucuronidation of nicotine and cotinine by human liver microsomes and heterologously expressed UDP-glucuronosyltransferases.", "journal": "Drug metabolism and disposition: the biological fate of chemicals", "date": "2003", "authors": "Kuehl GE, Murphy SE", "evidence": [ { "database": "Reactome", "id": "R-HSA-156588", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156588" } ], "reference": [ { "type": "PubMed", "id": "14570768", "url": "https://glygen.org/publication/PubMed/14570768" } ] }, { "title": "Quaternary ammonium-linked glucuronidation of tamoxifen by human liver microsomes and UDP-glucuronosyltransferase 1A4.", "journal": "Biochemical pharmacology", "date": "2004", "authors": "Kaku T, Ogura K, Nishiyama T, Ohnuma T, Muro K, Hiratsuka A", "evidence": [ { "database": "Reactome", "id": "R-HSA-156588", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156588" } ], "reference": [ { "type": "PubMed", "id": "15135306", "url": "https://glygen.org/publication/PubMed/15135306" } ] }, { "title": "Glucuronidation of the aspirin metabolite salicylic acid by expressed UDP-glucuronosyltransferases and human liver microsomes.", "journal": "Drug metabolism and disposition: the biological fate of chemicals", "date": "2006", "authors": "Kuehl GE, Bigler J, Potter JD, Lampe JW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "16258079", "url": "https://glygen.org/publication/PubMed/16258079" } ] }, { "title": "Substrate specificity of carboxylesterase isozymes and their contribution to hydrolase activity in human liver and small intestine.", "journal": "Drug metabolism and disposition: the biological fate of chemicals", "date": "2006", "authors": "Imai T, Taketani M, Shii M, Hosokawa M, Chiba K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "16837570", "url": "https://glygen.org/publication/PubMed/16837570" } ] }, { "title": "Human carboxylesterase isozymes: catalytic properties and rational drug design.", "journal": "Drug metabolism and pharmacokinetics", "date": "2006", "authors": "Imai T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "16858120", "url": "https://glygen.org/publication/PubMed/16858120" } ] }, { "title": "Antiplatelet agents aspirin and clopidogrel are hydrolyzed by distinct carboxylesterases, and clopidogrel is transesterificated in the presence of ethyl alcohol.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "2006", "authors": "Tang M, Mukundan M, Yang J, Charpentier N, LeCluyse EL, Black C, Yang D, Shi D, Yan B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "16943252", "url": "https://glygen.org/publication/PubMed/16943252" } ] }, { "title": "Molecular mechanism of phase I and phase II drug-metabolizing enzymes: implications for detoxification.", "journal": "International review of cytology", "date": "2007", "authors": "Iyanagi T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "17482904", "url": "https://glygen.org/publication/PubMed/17482904" } ] }, { "title": "Model representation of salicylate pharmacokinetics using unbound plasma salicylate concentrations and metabolite urinary excretion rates following a single oral dose.", "journal": "Journal of pharmacokinetics and biopharmaceutics", "date": "1991", "authors": "Shen J, Wanwimolruk S, Purves RD, McQueen EG, Roberts MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "1783992", "url": "https://glygen.org/publication/PubMed/1783992" } ] }, { "title": "Commentary: bioavailability of flavonoids and polyphenols: call to arms.", "journal": "Molecular pharmaceutics", "date": "2007", "authors": "Hu M", "evidence": [ { "database": "Reactome", "id": "R-HSA-156588", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156588" } ], "reference": [ { "type": "PubMed", "id": "18052085", "url": "https://glygen.org/publication/PubMed/18052085" } ] }, { "title": "Structure and concentration changes affect characterization of UGT isoform-specific metabolism of isoflavones.", "journal": "Molecular pharmaceutics", "date": "2009", "authors": "Tang L, Singh R, Liu Z, Hu M", "evidence": [ { "database": "Reactome", "id": "R-HSA-156588", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156588" } ], "reference": [ { "type": "PubMed", "id": "19545173", "url": "https://glygen.org/publication/PubMed/19545173" } ] }, { "title": "Reaction of human albumin with aspirin in vitro: mass spectrometric identification of acetylated lysines 199, 402, 519, and 545.", "journal": "Biochemical pharmacology", "date": "2010", "authors": "Liyasova MS, Schopfer LM, Lockridge O", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "19836360", "url": "https://glygen.org/publication/PubMed/19836360" } ] }, { "title": "Quantitative analysis of UGT2B28 mRNA expression by real-time RT-PCR and application to human tissue distribution study.", "journal": "Drug metabolism letters", "date": "2011", "authors": "Ohno S, Nakajin S", "evidence": [ { "database": "RefSeq", "id": "NP_001064", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001064" } ], "reference": [ { "type": "PubMed", "id": "21679149", "url": "https://glygen.org/publication/PubMed/21679149" } ] }, { "title": "Human alpha/beta hydrolase domain containing 10 (ABHD10) is responsible enzyme for deglucuronidation of mycophenolic acid acyl-glucuronide in liver.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Iwamura A, Fukami T, Higuchi R, Nakajima M, Yokoi T", "evidence": [ { "database": "Reactome", "id": "R-HSA-156588", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156588" } ], "reference": [ { "type": "PubMed", "id": "22294686", "url": "https://glygen.org/publication/PubMed/22294686" } ] }, { "title": "Biowaiver monograph for immediate-release solid oral dosage forms: acetylsalicylic acid.", "journal": "Journal of pharmaceutical sciences", "date": "2012", "authors": "Dressman JB, Nair A, Abrahamsson B, Barends DM, Groot DW, Kopp S, Langguth P, Polli JE, Shah VP, Zimmer M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "22674043", "url": "https://glygen.org/publication/PubMed/22674043" } ] }, { "title": "Comprehensive molecular characterization of human colon and rectal cancer.", "journal": "Nature", "date": "2012", "authors": "Muzny DM, Bainbridge MN, Chang K, Dinh HH, Drummond JA, Fowler G, Kovar CL, Lewis LR, Morgan MB, Newsham IF, Reid JG, Santibanez J, Shinbrot E, Trevino LR, Wu YQ, Wang M, Gunaratne P, Donehower LA, Creighton CJ, Wheeler DA, Gibbs RA, Lawrence MS, Voet D, Jing R, Cibulskis K, Sivachenko A, Stojanov P, McKenna A, Lander ES, Gabriel S, Getz G, Ding L, Fulton RS, Koboldt DC, Wylie T, Walker J, Dooling DJ, Fulton L, Delehaunty KD, Fronick CC, Demeter R, Mardis ER, Wilson RK, Chu A, Chun HJ, Mungall AJ, Pleasance E, Robertson A, Stoll D, Balasundaram M, Birol I, Butterfield YS, Chuah E, Coope RJ, Dhalla N, Guin R, Hirst C, Hirst M, Holt RA, Lee D, Li HI, Mayo M, Moore RA, Schein JE, Slobodan JR, Tam A, Thiessen N, Varhol R, Zeng T, Zhao Y, Jones SJ, Marra MA, Bass AJ, Ramos AH, Saksena G, Cherniack AD, Schumacher SE, Tabak B, Carter SL, Pho NH, Nguyen H, Onofrio RC, Crenshaw A, Ardlie K, Beroukhim R, Winckler W, Getz G, Meyerson M, Protopopov A, Zhang J, Hadjipanayis A, Lee E, Xi R, Yang L, Ren X, Zhang H, Sathiamoorthy N, Shukla S, Chen PC, Haseley P, Xiao Y, Lee S, Seidman J, Chin L, Park PJ, Kucherlapati R, Auman JT, Hoadley KA, Du Y, Wilkerson MD, Shi Y, Liquori C, Meng S, Li L, Turman YJ, Topal MD, Tan D, Waring S, Buda E, Walsh J, Jones CD, Mieczkowski PA, Singh D, Wu J, Gulabani A, Dolina P, Bodenheimer T, Hoyle AP, Simons JV, Soloway M, Mose LE, Jefferys SR, Balu S, O'Connor BD, Prins JF, Chiang DY, Hayes D, Perou CM, Hinoue T, Weisenberger DJ, Maglinte DT, Pan F, Berman BP, Van Den Berg DJ, Shen H, Triche T Jr, Baylin SB, Laird PW, Getz G, Noble M, Voet D, Saksena G, Gehlenborg N, DiCara D, Zhang J, Zhang H, Wu CJ, Liu SY, Shukla S, Lawrence MS, Zhou L, Sivachenko A, Lin P, Stojanov P, Jing R, Park RW, Nazaire MD, Robinson J, Thorvaldsdottir H, Mesirov J, Park PJ, Chin L, Thorsson V, Reynolds SM, Bernard B, Kreisberg R, Lin J, Iype L, Bressler R, Erkkila T, Gundapuneni M, Liu Y, Norberg A, Robinson T, Yang D, Zhang W, Shmulevich I, de Ronde JJ, Schultz N, Cerami E, Ciriello G, Goldberg AP, Gross B, Jacobsen A, Gao J, Kaczkowski B, Sinha R, Aksoy B, Antipin Y, Reva B, Shen R, Taylor BS, Chan TA, Ladanyi M, Sander C, Akbani R, Zhang N, Broom BM, Casasent T, Unruh A, Wakefield C, Hamilton SR, Cason R, Baggerly KA, Weinstein JN, Haussler D, Benz CC, Stuart JM, Benz SC, Sanborn J, Vaske CJ, Zhu J, Szeto C, Scott GK, Yau C, Ng S, Goldstein T, Ellrott K, Collisson E, Cozen AE, Zerbino D, Wilks C, Craft B, Spellman P, Penny R, Shelton T, Hatfield M, Morris S, Yena P, Shelton C, Sherman M, Paulauskis J, Gastier-Foster JM, Bowen J, Ramirez NC, Black A, Pyatt R, Wise L, White P, Bertagnolli M, Brown J, Chan TA, Chu GC, Czerwinski C, Denstman F, Dhir R, Dorner A, Fuchs CS, Guillem JG, Iacocca M, Juhl H, Kaufman A, Kohl B 3rd, Van Le X, Mariano MC, Medina EN, Meyers M, Nash GM, Paty PB, Petrelli N, Rabeno B, Richards WG, Solit D, Swanson P, Temple L, Tepper JE, Thorp R, Vakiani E, Weiser MR, Willis JE, Witkin G, Zeng Z, Zinner MJ, Zornig C, Jensen MA, Sfeir R, Kahn AB, Chu AL, Kothiyal P, Wang Z, Snyder EE, Pontius J, Pihl TD, Ayala B, Backus M, Walton J, Whitmore J, Baboud J, Berton DL, Nicholls MC, Srinivasan D, Raman R, Girshik S, Kigonya PA, Alonso S, Sanbhadti RN, Barletta SP, Greene JM, Pot DA, Shaw KR, Dillon LA, Buetow K, Davidsen T, Demchok JA, Eley G, Ferguson M, Fielding P, Schaefer C, Sheth M, Yang L, Guyer MS, Ozenberger BA, Palchik JD, Peterson J, Sofia HJ, Thomson E", "evidence": [ { "database": "dbSNP", "id": "rs756939149", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756939149" } ], "reference": [ { "type": "PubMed", "id": "22810696", "url": "https://glygen.org/publication/PubMed/22810696" } ] }, { "title": "Aromatic hydroxylation of salicylic acid and aspirin by human cytochromes P450.", "journal": "European journal of pharmaceutical sciences : official journal of the European Federation for Pharmaceutical Sciences", "date": "2015", "authors": "Bojic M, Sedgeman CA, Nagy LD, Guengerich FP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "25840124", "url": "https://glygen.org/publication/PubMed/25840124" } ] }, { "title": "Histopathology of melanosis coli and determination of its associated genes by comparative analysis of expression microarrays.", "journal": "Molecular medicine reports", "date": "2015", "authors": "Li XAlpha, Zhou Y, Zhou SChi, Liu HR, Xu JM, Gao L, Yu XJ, Li XH", "evidence": [ { "database": "RefSeq", "id": "NP_001064", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001064" } ], "reference": [ { "type": "PubMed", "id": "26238215", "url": "https://glygen.org/publication/PubMed/26238215" } ] }, { "title": "Natural Polyphenols for Prevention and Treatment of Cancer.", "journal": "Nutrients", "date": "2016", "authors": "Zhou Y, Zheng J, Li Y, Xu DP, Li S, Chen YM, Li HB", "evidence": [ { "database": "Reactome", "id": "R-HSA-156588", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156588" } ], "reference": [ { "type": "PubMed", "id": "27556486", "url": "https://glygen.org/publication/PubMed/27556486" } ] }, { "title": "Carboxylesterases in lipid metabolism: from mouse to human.", "journal": "Protein & cell", "date": "2018", "authors": "Lian J, Nelson R, Lehner R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "28677105", "url": "https://glygen.org/publication/PubMed/28677105" } ] }, { "title": "Microsomal UDP-glucuronyltransferase-catalyzed bilirubin diglucuronide formation in human liver.", "journal": "Journal of hepatology", "date": "1986", "authors": "Peters WH, Jansen PL", "evidence": [ { "database": "Reactome", "id": "R-HSA-156588", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156588" } ], "reference": [ { "type": "PubMed", "id": "3082969", "url": "https://glygen.org/publication/PubMed/3082969" } ] }, { "title": "2,3-Dihydroxybenzoic acid is a product of human aspirin metabolism.", "journal": "Biochemical pharmacology", "date": "1988", "authors": "Grootveld M, Halliwell B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "3342084", "url": "https://glygen.org/publication/PubMed/3342084" } ] }, { "title": "The metabolism of aspirin in man: a population study.", "journal": "Xenobiotica; the fate of foreign compounds in biological systems", "date": "1986", "authors": "Hutt AJ, Caldwell J, Smith RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "3705620", "url": "https://glygen.org/publication/PubMed/3705620" } ] }, { "title": "Bilirubin conjugates in bile of man and rat in the normal state and in liver disease.", "journal": "The Journal of clinical investigation", "date": "1972", "authors": "Fevery J, Van Damme B, Michiels R, De Groote J, Heirwegh KP", "evidence": [ { "database": "Reactome", "id": "R-HSA-156588", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156588" } ], "reference": [ { "type": "PubMed", "id": "4639028", "url": "https://glygen.org/publication/PubMed/4639028" } ] }, { "title": "Absorption kinetics of aspirin in man following oral administration of an aqueous solution.", "journal": "Journal of pharmaceutical sciences", "date": "1972", "authors": "Rowland M, Riegelman S, Harris PA, Sholkoff SD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "5013373", "url": "https://glygen.org/publication/PubMed/5013373" } ] }, { "title": "Structural changes in human serum albumin induced by ingestion of acetylsalicylic acid.", "journal": "The Journal of clinical investigation", "date": "1969", "authors": "Hawkins D, Pinckard RN, Crawford IP, Farr RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "5773090", "url": "https://glygen.org/publication/PubMed/5773090" } ] }, { "title": "Pharmacokinetics of salicylate elimination in man.", "journal": "Journal of pharmaceutical sciences", "date": "1965", "authors": "Levy G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "5862532", "url": "https://glygen.org/publication/PubMed/5862532" } ] }, { "title": "Difference in hepatic uptake kinetics of aspirin and salicylamide in rats.", "journal": "Biochemical pharmacology", "date": "1984", "authors": "Iwamoto K, Furune Y, Watanabe J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "6487359", "url": "https://glygen.org/publication/PubMed/6487359" } ] }, { "title": "The hepatic microsomal formation of bilirubin diglucuronide.", "journal": "The Journal of biological chemistry", "date": "1983", "authors": "Gordon ER, Sommerer U, Goresky CA", "evidence": [ { "database": "Reactome", "id": "R-HSA-156588", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156588" } ], "reference": [ { "type": "PubMed", "id": "6654901", "url": "https://glygen.org/publication/PubMed/6654901" } ] }, { "title": "Plasma aspirin esterases in normal individuals, patients with alcoholic liver disease and rheumatoid arthritis: characterization and the importance of the enzymic components.", "journal": "European journal of clinical investigation", "date": "1980", "authors": "Rainsford KD, Ford NL, Brooks PM, Watson HM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "6777177", "url": "https://glygen.org/publication/PubMed/6777177" } ] }, { "title": "Bilirubin mono- and diglucuronide formation by human liver in vitro: assay by high-pressure liquid chromatography.", "journal": "Hepatology (Baltimore, Md.)", "date": "1981", "authors": "Chowdhury JR, Chowdhury NR, Wu G, Shouval R, Arias IM", "evidence": [ { "database": "Reactome", "id": "R-HSA-156588", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156588" } ], "reference": [ { "type": "PubMed", "id": "6796486", "url": "https://glygen.org/publication/PubMed/6796486" } ] }, { "title": "Identification and partial purification of the major aspirin hydrolyzing enzyme in human blood.", "journal": "Arthritis and rheumatism", "date": "1983", "authors": "Costello PB, Green FA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "6838677", "url": "https://glygen.org/publication/PubMed/6838677" } ] }, { "title": "Comparative study of human intestinal and hepatic esterases as related to enzymatic properties and hydrolizing activity for ester-type drugs.", "journal": "Japanese journal of pharmacology", "date": "1980", "authors": "Inoue M, Morikawa M, Tsuboi M, Ito Y, Sugiura M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "7206363", "url": "https://glygen.org/publication/PubMed/7206363" } ] }, { "title": "Purification to homogeneity of mitochondrial acyl coa:glycine n-acyltransferase from human liver.", "journal": "Biochemical and biophysical research communications", "date": "1994", "authors": "Mawal YR, Qureshi IA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "7802672", "url": "https://glygen.org/publication/PubMed/7802672" } ] }, { "title": "Bilirubin UDP-glucuronosyltransferase 1 is the only relevant bilirubin glucuronidating isoform in man.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Bosma PJ, Seppen J, Goldhoorn B, Bakker C, Oude Elferink RP, Chowdhury JR, Chowdhury NR, Jansen PL", "evidence": [ { "database": "Reactome", "id": "R-HSA-156588", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156588" } ], "reference": [ { "type": "PubMed", "id": "8027054", "url": "https://glygen.org/publication/PubMed/8027054" } ] }, { "title": "Glucuronide conjugates of 4-aminobiphenyl and its N-hydroxy metabolites. pH stability and synthesis by human and dog liver.", "journal": "Biochemical pharmacology", "date": "1996", "authors": "Babu SR, Lakshmi VM, Huang GP, Zenser TV, Davis BB", "evidence": [ { "database": "Reactome", "id": "R-HSA-156588", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156588" } ], "reference": [ { "type": "PubMed", "id": "8687483", "url": "https://glygen.org/publication/PubMed/8687483" } ] }, { "title": "Molecular cloning and characterization of a novel putative carboxylesterase, present in human intestine and liver.", "journal": "Biochemical and biophysical research communications", "date": "1997", "authors": "Schwer H, Langmann T, Daig R, Becker A, Aslanidis C, Schmitz G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "9144407", "url": "https://glygen.org/publication/PubMed/9144407" } ] }, { "title": "Identification of separate acyl- CoA:glycine and acyl-CoA:L-glutamine N-acyltransferase activities in mitochondrial fractions from liver of rhesus monkey and man.", "journal": "The Journal of biological chemistry", "date": "1976", "authors": "Webster LT, Siddiqui UA, Lucas SV, Strong JM, Mieyal JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "931988", "url": "https://glygen.org/publication/PubMed/931988" } ] }, { "title": "Identification of multispecific organic anion transporter 2 expressed predominantly in the liver.", "journal": "FEBS letters", "date": "1998", "authors": "Sekine T, Cha SH, Tsuda M, Apiwattanakul N, Nakajima N, Kanai Y, Endou H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "9650585", "url": "https://glygen.org/publication/PubMed/9650585" } ] }, { "title": "Isolation and characterization of a human orphan UDP-glucuronosyltransferase, UGT2B11.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1998", "authors": "Beaulieu M, Levesque E, Hum DW, Belanger A", "evidence": [ { "database": "UniProtKB", "id": "O75310", "url": "https://www.uniprot.org/uniprot/O75310" } ], "reference": [ { "type": "PubMed", "id": "9675083", "url": "https://glygen.org/publication/PubMed/9675083" } ] }, { "title": "Protein binding of salicylate in uremic and normal plasma.", "journal": "Clinical pharmacology and therapeutics", "date": "1976", "authors": "Borga O, Cederlof IO, Ringberger VA, Norlin A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "975718", "url": "https://glygen.org/publication/PubMed/975718" } ] } ], "pathway": [ { "id": "hsa:10720", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:10720", "resource": "KEGG Pathway" }, { "id": "R-HSA-156588", "name": "Glucuronidation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156588", "resource": "Reactome", "description": "Glucuronidation" }, { "id": "R-HSA-9749641", "name": "Aspirin ADME", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641", "resource": "Reactome", "description": "Aspirin ADME" } ], "orthologs": [ { "uniprot_canonical_ac": "O75795-1", "protein_name": "UDP-glucuronosyltransferase 2B17", "gene_name": "UGT2B17", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MSLKWMSVFLLMQLSCYFSSGSCGKVLVWPTEYSHWINMKTILEELVQRGHEVIVLTSSASILVNASKSSAIKLEVYPTSLTKNDLEDFFMKMFDRWTYSISKNTFWSYFSQLQELCWEYSDYNIKLCEDAVLNKKLMRKLQESKFDVLLADAVNPCGELLAELLNIPFLYSLRFSVGYTVEKNGGGFLFPPSYVPVVMSELSDQMIFMERIKNMIYMLYFDFWFQAYDLKKWDQFYSEVLGRPTTLFETMGKAEMWLIRTYWDFEFPRPFLPNVDFVGGLHCKPAKPLPKEMEEFVQSSGENGIVVFSLGSMISNMSEESANMIASALAQIPQKVLWRFDGKKPNTLGSNTRLYKWLPQNDLLGHPKTKAFITHGGTNGIYEAIYHGIPMVGIPLFADQHDNIAHMKAKGAALSVDIRTMSSRDLLNALKSVINDPIYKENIMKLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHNLTWIQYHSLDVIAFLLACVATMIFMITKCCLFCFRKLAKTGKKKKRD", "length": 530 }, "evidence": [ { "id": "45922684", "url": "http://www.informatics.jax.org/homology/45922684", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P06133-1", "protein_name": "UDP-glucuronosyltransferase 2B4", "gene_name": "UGT2B4", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MSMKWTSALLLIQLSCYFSSGSCGKVLVWPTEFSHWMNIKTILDELVQRGHEVTVLASSASISFDPNSPSTLKFEVYPVSLTKTEFEDIIKQLVKRWAELPKDTFWSYFSQVQEIMWTFNDILRKFCKDIVSNKKLMKKLQESRFDVVLADAVFPFGELLAELLKIPFVYSLRFSPGYAIEKHSGGLLFPPSYVPVVMSELSDQMTFIERVKNMIYVLYFEFWFQIFDMKKWDQFYSEVLGRPTTLSETMAKADIWLIRNYWDFQFPHPLLPNVEFVGGLHCKPAKPLPKEMEEFVQSSGENGVVVFSLGSMVSNTSEERANVIASALAKIPQKVLWRFDGNKPDTLGLNTRLYKWIPQNDLLGHPKTRAFITHGGANGIYEAIYHGIPMVGVPLFADQPDNIAHMKAKGAAVSLDFHTMSSTDLLNALKTVINDPLYKENAMKLSRIHHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHDLTWFQYHSLDVTGFLLACVATVIFIITKCLFCVWKFVRTGKKGKRD", "length": 528 }, "evidence": [ { "id": "45922684", "url": "http://www.informatics.jax.org/homology/45922684", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P09875-1", "protein_name": "UDP-glucuronosyltransferase 2B1", "gene_name": "Ugt2b1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MSMKQTSVFLLIQLICYFRPGACGKVLVWPTEYSHWINIKIILNELAQRGHEVTVLVSSASILIEPTKESSINFEIYSVPLSKSDLEYSFAKWIDEWTRDFETLSIWTYYSKMQKVFNEYSDVVENLCKALIWNKSLMKKLQGSQFDVILADAVGPCGELLAELLKTPLVYSLRFCPGYRCEKFSGGLPLPPSYVPVVLSELSDRMTFVERVKNMLQMLYFDFWFQPFKEKSWSQFYSDVLGRPTTLTEMMGKADIWLIRTFWDLEFPHPFLPNFDFVGGLHCKPAKPLPREMEEFVQSSGEHGVVVFSLGSMVKNLTEEKANVVASALAQIPQKVVWRFDGKKPDTLGSNTRLYKWIPQNDLLGHPKTKAFVAHGGTNGIYEAIYHGIPIVGIPLFADQPDNINHMVAKGAAVRVDFSILSTTGLLTALKIVMNDPSYKENAMRLSRIHHDQPVKPLDRAVFWIEYVMRHKGAKHLRSTLHDLSWFQYHSLDVIGFLLLCVVGVVFIITKFCLFCCRKTANMGKKKKE", "length": 529 }, "evidence": [ { "id": "45922684", "url": "http://www.informatics.jax.org/homology/45922684", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P16662-1", "protein_name": "UDP-glucuronosyltransferase 2B7", "gene_name": "UGT2B7", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MSVKWTSVILLIQLSFCFSSGNCGKVLVWAAEYSHWMNIKTILDELIQRGHEVTVLASSASILFDPNNSSALKIEIYPTSLTKTELENFIMQQIKRWSDLPKDTFWLYFSQVQEIMSIFGDITRKFCKDVVSNKKFMKKVQESRFDVIFADAIFPCSELLAELFNIPFVYSLSFSPGYTFEKHSGGFIFPPSYVPVVMSELTDQMTFMERVKNMIYVLYFDFWFEIFDMKKWDQFYSEVLGRPTTLSETMGKADVWLIRNSWNFQFPYPLLPNVDFVGGLHCKPAKPLPKEMEDFVQSSGENGVVVFSLGSMVSNMTEERANVIASALAQIPQKVLWRFDGNKPDTLGLNTRLYKWIPQNDLLGHPKTRAFITHGGANGIYEAIYHGIPMVGIPLFADQPDNIAHMKARGAAVRVDFNTMSSTDLLNALKRVINDPSYKENVMKLSRIQHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHDLTWFQYHSLDVIGFLLVCVATVIFIVTKCCLFCFWKFARKAKKGKND", "length": 529 }, "evidence": [ { "id": "45922684", "url": "http://www.informatics.jax.org/homology/45922684", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P36537-1", "protein_name": "UDP-glucuronosyltransferase 2B10", "gene_name": "UGT2B10", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MALKWTTVLLIQLSFYFSSGSCGKVLVWAAEYSLWMNMKTILKELVQRGHEVTVLASSASILFDPNDSSTLKLEVYPTSLTKTEFENIIMQLVKRLSEIQKDTFWLPFSQEQEILWAINDIIRNFCKDVVSNKKLMKKLQESRFDIVFADAYLPCGELLAELFNIPFVYSHSFSPGYSFERHSGGFIFPPSYVPVVMSKLSDQMTFMERVKNMLYVLYFDFWFQIFNMKKWDQFYSEVLGRPTTLSETMRKADIWLMRNSWNFKFPHPFLPNVDFVGGLHCKPAKPLPKEMEEFVQSSGENGVVVFSLGSMVSNMTEERANVIATALAKIPQKVLWRFDGNKPDALGLNTRLYKWIPQNDLLGHPKTRAFITHGGANGIYEAIYHGIPMVGIPLFFDQPDNIAHMKAKGAAVRVDFNTMSSTDLLNALKTVINDPSYKENIMKLSRIQHDQPVKPLDRAVFWIEFVMRHKGAKHLRVAAHNLTWFQYHSLDVIGFLLACVATVLFIITKCCLFCFWKFARKGKKGKRD", "length": 528 }, "evidence": [ { "id": "45922684", "url": "http://www.informatics.jax.org/homology/45922684", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "P54855-1", "protein_name": "UDP-glucuronosyltransferase 2B15", "gene_name": "UGT2B15", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MSLKWTSVFLLIQLSCYFSSGSCGKVLVWPTEYSHWINMKTILEELVQRGHEVTVLTSSASTLVNASKSSAIKLEVYPTSLTKNYLEDSLLKILDRWIYGVSKNTFWSYFSQLQELCWEYYDYSNKLCKDAVLNKKLMMKLQESKFDVILADALNPCGELLAELFNIPFLYSLRFSVGYTFEKNGGGFLFPPSYVPVVMSELSDQMIFMERIKNMIHMLYFDFWFQIYDLKKWDQFYSEVLGRPTTLFETMGKAEMWLIRTYWDFEFPRPFLPNVDFVGGLHCKPAKPLPKEMEEFVQSSGENGIVVFSLGSMISNMSEESANMIASALAQIPQKVLWRFDGKKPNTLGSNTRLYKWLPQNDLLGHPKTKAFITHGGTNGIYEAIYHGIPMVGIPLFADQHDNIAHMKAKGAALSVDIRTMSSRDLLNALKSVINDPVYKENVMKLSRIHHDQPMKPLDRAVFWIEFVMRHKGAKHLRVAAHNLTWIQYHSLDVIAFLLACVATVIFIITKFCLFCFRKLAKKGKKKKRD", "length": 530 }, "evidence": [ { "id": "45922684", "url": "http://www.informatics.jax.org/homology/45922684", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q8R084-1", "protein_name": "UDP-glucuronosyltransferase", "gene_name": "Ugt2b1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSMKQASVFLLIQFICYIRPGACGKVLVWPTEYSHWINMKIILDELVQRGHDVTVLISSASILIGPSNESSINFEIYSAPLSKDDLEYAFEKWVGNWTYELKKLPFWTSYSKLQKISSEYSDMIESFCKAVVWNKSLMKKLQGSKFDVVLADALVPCGELLSELLKTPLVYSLRFCPGYKCEKYSGGLPLPPSYVPVVLSELSDHMTFAERVKNMLQVLLFDFWFQTFNEKSWNQFYSDVLGRPTTLTEMMGKADIWLVRTFWDLKFPHPFLPNFDFVGGLHCKPAKPLPKEMEEFVQSSGEHGVVVFSLGSMVKNIKEEKANVVASALAQIPQKVLWRFDGKKPDTLGSNTRLYKWIPQNDLLGHPKTKAFIAHGGTNGIYEAIYHGIPIVGIPLFGDQPDNINHIVAKGAAVRVDFDTMSTTDLLTALKTVINDPSYKENAMRLSRIHHDQPMKPLDRAVFWIEYVMRNKGAKHLRPALHDLTWFQYHSLDVIGFLLVCVVAVVFIIAKCCLFCCHKTANMGKKKKE", "length": 529 }, "evidence": [ { "id": "45922684", "url": "http://www.informatics.jax.org/homology/45922684", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9BY64-1", "protein_name": "UDP-glucuronosyltransferase 2B28", "gene_name": "UGT2B28", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MALKWTSVLLLIHLGCYFSSGSCGKVLVWTGEYSHWMNMKTILKELVQRGHEVTVLASSASILFDPNDAFTLKLEVYPTSLTKTEFENIIMQQVKRWSDIQKDSFWLYFSQEQEILWEFHDIFRNFCKDVVSNKKVMKKLQESRFDIIFADAFFPCGELLAALLNIPFVYSLCFTPGYTIERHSGGLIFPPSYIPVVMSKLSDQMTFMERVKNMIYVLYFDFWFQMCDMKKWDQFYSEVLGRPTTLFETMGKADIWLMRNSWSFQFPHPFLPNIDFVGGLHCKPAKPLPKEMEEFVQSSGENGVVVFSLGSVISNMTAERANVIATALAKIPQKVLWRFDGNKPDALGLNTRLYKWIPQNDLLGLPKTRAFITHGGANGIYEAIYHGIPMVGIPLFWDQPDNIAHMKAKGAAVRLDFHTMSSTDLLNALKTVINDPSYKENVMKLSIIQHDQPVKPLHRAVFWIEFVMCHKGAKHLRVAARDLTWFQYHSLDVIGFLLACVATVIFVVTKFCLFCFWKFARKGKKGKRD", "length": 529 }, "evidence": [ { "id": "45922684", "url": "http://www.informatics.jax.org/homology/45922684", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "estrogen metabolic process", "id": "GO:0008210", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008210", "evidence": [ { "database": "UniProtKB", "id": "O75310", "url": "https://www.uniprot.org/uniprot/O75310" } ], "pmid": "" }, { "name": "cellular glucuronidation", "id": "GO:0052695", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0052695", "evidence": [ { "database": "UniProtKB", "id": "O75310", "url": "https://www.uniprot.org/uniprot/O75310" } ], "pmid": "" }, { "name": "xenobiotic metabolic process", "id": "GO:0006805", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006805", "evidence": [ { "database": "UniProtKB", "id": "O75310", "url": "https://www.uniprot.org/uniprot/O75310" } ], "pmid": "" }, { "name": "xenobiotic glucuronidation", "id": "GO:0052697", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0052697", "evidence": [ { "database": "UniProtKB", "id": "O75310", "url": "https://www.uniprot.org/uniprot/O75310" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "O75310", "url": "https://www.uniprot.org/uniprot/O75310" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "glucuronosyltransferase activity", "id": "GO:0015020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015020", "evidence": [ { "database": "UniProtKB", "id": "O75310", "url": "https://www.uniprot.org/uniprot/O75310" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 315, "end_pos": 317, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "21032", "name": "", "equation": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P08541-1", "P19488-1", "Q64638-1", "Q64550-1", "P08430-1", "P20720-1", "Q62789-1", "Q64633-1", "Q64634-1", "Q64637-1", "P08542-1", "P09875-1", "P36510-1", "P36511-1", "A0A0G2K727-1", "A0A0G2JW02-1", "F1LTB8-1", "F1M3E3-1", "P54855-1", "P16662-1", "Q3SY77-1", "O75310-1", "P19224-1", "Q6NUS8-1", "Q6UWM9-1", "P36537-1", "P06133-1", "Q9BY64-1", "Q9HAW7-1", "Q9HAW9-1", "Q9HAW8-1", "P35503-1", "P35504-1", "O60656-1", "O75795-1", "P22310-1", "P22309-1", "P0DTE5-1", "P0DTE4-5", "Q8JZZ0-1", "P70691-1", "Q3UP75-1", "Q8BWQ1-1", "P17717-1", "Q62452-1", "Q63886-1", "Q8R084-1", "Q8VCN3-1", "Q8BJL9-1", "Q8K154-1", "Q6PDD0-1", "Q80X89-1", "Q3UEP4-1", "Q64435-1", "Q6ZQM8-1", "D3Z748-1", "K9J7B2-1", "B2RT14-1", "Q9VDA5-1", "Q9VGT4-1", "Q9VGT5-1", "Q9VGS7-1", "Q9VJ46-1", "Q8SYL7-1", "Q9VJ45-1", "Q9W2J3-1", "Q9VJ81-1", "Q9VGT2-1", "Q9VGT8-1", "Q9W2J4-1", "Q9V9X9-1", "Q9VJ47-1", "Q9VGT0-1" ], "evidence": [ { "id": "21032", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/21032" } ] }, { "id": "R-HSA-174931", "name": "UGTs transfer GlcA from UDP-GlcA to O-centre substrates", "equation": "", "summary": "Typical O-centred substrates were chosen as examples for these isozymes. Many UDP-glucuronosyltransferases (UGTs) can transfer the glucuronyl moiety (GlcA) from UDP-GlcA to the O-centre functional group of many substrates, including salicylate (ST), to form 4-O-glucuronides (Casarett & Doull 1995, Babu et al. 1996; Kuehl et al, 2006).", "cellular_location": "endoplasmic reticulum lumen, endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P16662-1", "Q3SY77-1", "Q6UWM9-1", "Q9BY64-1", "P0DTE5-1", "P06133-1", "P22310-1", "P35503-1", "Q9HAW7-1", "Q9HAW9-1", "O60656-1", "O75310-1", "O75795-1", "P19224-1", "P22309-1", "P35504-1", "P36537-1", "P54855-1", "Q6NUS8-1", "P0DTE4-5" ], "evidence": [ { "id": "R-HSA-174931", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174931" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "A0A0G2JW02", "gene_name": "Ugt2a3", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "A0A0G2JW02", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2JW02" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "A0A0G2JW02", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2JW02" } ] } ] }, { "uniprot_ac": "A0A0G2K727", "gene_name": "ENSRNOG00000065137", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "A0A0G2K727", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K727" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "A0A0G2K727", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K727" } ] } ] }, { "uniprot_ac": "B2RT14", "gene_name": "Ugt1a5", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "B2RT14", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2RT14" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "B2RT14", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2RT14" } ] } ] }, { "uniprot_ac": "D3Z748", "gene_name": "Ugt1a8", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "D3Z748", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3Z748" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "D3Z748", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3Z748" } ] } ] }, { "uniprot_ac": "F1LTB8", "gene_name": "RGD1559459", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "F1LTB8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1LTB8" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "F1LTB8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1LTB8" } ] } ] }, { "uniprot_ac": "F1M3E3", "gene_name": "AC114845.1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "F1M3E3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M3E3" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "F1M3E3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M3E3" } ] } ] }, { "uniprot_ac": "K9J7B2", "gene_name": "Ugt1a6b", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "K9J7B2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/K9J7B2" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "K9J7B2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/K9J7B2" } ] } ] }, { "uniprot_ac": "O60656", "gene_name": "UGT1A9", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "O60656", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60656" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "O60656", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60656" } ] } ] }, { "uniprot_ac": "O75310", "gene_name": "UGT2B11", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "O75310", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75310" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "O75310", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75310" } ] } ] }, { "uniprot_ac": "O75795", "gene_name": "UGT2B17", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "O75795", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75795" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "O75795", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75795" } ] } ] }, { "uniprot_ac": "P06133", "gene_name": "UGT2B4", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P06133", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06133" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P06133", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06133" } ] } ] }, { "uniprot_ac": "P08430", "gene_name": "Ugt1a6", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P08430", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08430" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P08430", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08430" } ] } ] }, { "uniprot_ac": "P08541", "gene_name": "Ugt2b", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P08541", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08541" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P08541", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08541" } ] } ] }, { "uniprot_ac": "P08542", "gene_name": "Ugt2b17", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P08542", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08542" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P08542", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08542" } ] } ] }, { "uniprot_ac": "P09875", "gene_name": "Ugt2b1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P09875", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09875" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P09875", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09875" } ] } ] }, { "uniprot_ac": "P0DTE4", "gene_name": "UGT2A1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P0DTE4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0DTE4" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P0DTE4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0DTE4" } ] } ] }, { "uniprot_ac": "P0DTE5", "gene_name": "UGT2A2", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P0DTE5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0DTE5" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P0DTE5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0DTE5" } ] } ] }, { "uniprot_ac": "P16662", "gene_name": "UGT2B7", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P16662", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16662" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P16662", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16662" } ] } ] }, { "uniprot_ac": "P17717", "gene_name": "Ugt2b17", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P17717", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17717" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P17717", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17717" } ] } ] }, { "uniprot_ac": "P19224", "gene_name": "UGT1A6", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P19224", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19224" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P19224", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19224" } ] } ] }, { "uniprot_ac": "P19488", "gene_name": "Ugt2b37", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P19488", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19488" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P19488", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19488" } ] } ] }, { "uniprot_ac": "P20720", "gene_name": "Ugt1a2", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P20720", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20720" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P20720", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20720" } ] } ] }, { "uniprot_ac": "P22309", "gene_name": "UGT1A1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P22309", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22309" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P22309", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22309" } ] } ] }, { "uniprot_ac": "P22310", "gene_name": "UGT1A4", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P22310", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22310" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P22310", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22310" } ] } ] }, { "uniprot_ac": "P35503", "gene_name": "UGT1A3", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P35503", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35503" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P35503", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35503" } ] } ] }, { "uniprot_ac": "P35504", "gene_name": "UGT1A5", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P35504", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35504" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P35504", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35504" } ] } ] }, { "uniprot_ac": "P36510", "gene_name": "Ugt2a1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P36510", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36510" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P36510", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36510" } ] } ] }, { "uniprot_ac": "P36511", "gene_name": "Ugt2b15", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P36511", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36511" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P36511", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36511" } ] } ] }, { "uniprot_ac": "P36537", "gene_name": "UGT2B10", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P36537", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36537" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P36537", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36537" } ] } ] }, { "uniprot_ac": "P54855", "gene_name": "UGT2B15", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P54855", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54855" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P54855", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54855" } ] } ] }, { "uniprot_ac": "P70691", "gene_name": "Ugt1a2", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P70691", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70691" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P70691", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70691" } ] } ] }, { "uniprot_ac": "Q3SY77", "gene_name": "UGT3A2", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q3SY77", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3SY77" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q3SY77", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3SY77" } ] } ] }, { "uniprot_ac": "Q3UEP4", "gene_name": "Ugt2b36", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q3UEP4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UEP4" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q3UEP4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UEP4" } ] } ] }, { "uniprot_ac": "Q3UP75", "gene_name": "Ugt3a1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q3UP75", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UP75" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q3UP75", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UP75" } ] } ] }, { "uniprot_ac": "Q62452", "gene_name": "Ugt1a9", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q62452", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62452" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q62452", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62452" } ] } ] }, { "uniprot_ac": "Q62789", "gene_name": "Ugt2b7", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q62789", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62789" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q62789", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62789" } ] } ] }, { "uniprot_ac": "Q63886", "gene_name": "Ugt1a1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q63886", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63886" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q63886", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63886" } ] } ] }, { "uniprot_ac": "Q64435", "gene_name": "Ugt1a6", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q64435", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64435" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q64435", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64435" } ] } ] }, { "uniprot_ac": "Q64550", "gene_name": "Ugt1a1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q64550", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64550" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q64550", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64550" } ] } ] }, { "uniprot_ac": "Q64633", "gene_name": "Ugt1a7", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q64633", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64633" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q64633", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64633" } ] } ] }, { "uniprot_ac": "Q64634", "gene_name": "Ugt1a8", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q64634", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64634" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q64634", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64634" } ] } ] }, { "uniprot_ac": "Q64637", "gene_name": "Ugt1a3", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q64637", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64637" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q64637", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64637" } ] } ] }, { "uniprot_ac": "Q64638", "gene_name": "Ugt1a5", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q64638", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64638" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q64638", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64638" } ] } ] }, { "uniprot_ac": "Q6NUS8", "gene_name": "UGT3A1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q6NUS8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6NUS8" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q6NUS8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6NUS8" } ] } ] }, { "uniprot_ac": "Q6PDD0", "gene_name": "Ugt2a2", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q6PDD0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6PDD0" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q6PDD0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6PDD0" } ] } ] }, { "uniprot_ac": "Q6UWM9", "gene_name": "UGT2A3", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q6UWM9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6UWM9" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q6UWM9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6UWM9" } ] } ] }, { "uniprot_ac": "Q6ZQM8", "gene_name": "Ugt1a7", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q6ZQM8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6ZQM8" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q6ZQM8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6ZQM8" } ] } ] }, { "uniprot_ac": "Q80X89", "gene_name": "Ugt2a1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q80X89", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80X89" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q80X89", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80X89" } ] } ] }, { "uniprot_ac": "Q8BJL9", "gene_name": "Ugt2b35", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q8BJL9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BJL9" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q8BJL9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BJL9" } ] } ] }, { "uniprot_ac": "Q8BWQ1", "gene_name": "Ugt2a3", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q8BWQ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BWQ1" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q8BWQ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BWQ1" } ] } ] }, { "uniprot_ac": "Q8JZZ0", "gene_name": "Ugt3a2", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q8JZZ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8JZZ0" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q8JZZ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8JZZ0" } ] } ] }, { "uniprot_ac": "Q8K154", "gene_name": "Ugt2b34", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q8K154", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K154" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q8K154", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K154" } ] } ] }, { "uniprot_ac": "Q8R084", "gene_name": "Ugt2b1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q8R084", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R084" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q8R084", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R084" } ] } ] }, { "uniprot_ac": "Q8SYL7", "gene_name": "Ugt50B3", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q8SYL7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8SYL7" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q8SYL7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8SYL7" } ] } ] }, { "uniprot_ac": "Q8VCN3", "gene_name": "Ugt2b37", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q8VCN3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VCN3" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q8VCN3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VCN3" } ] } ] }, { "uniprot_ac": "Q9BY64", "gene_name": "UGT2B28", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9BY64", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BY64" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9BY64", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BY64" } ] } ] }, { "uniprot_ac": "Q9HAW7", "gene_name": "UGT1A7", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9HAW7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HAW7" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9HAW7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HAW7" } ] } ] }, { "uniprot_ac": "Q9HAW8", "gene_name": "UGT1A10", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9HAW8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HAW8" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9HAW8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HAW8" } ] } ] }, { "uniprot_ac": "Q9HAW9", "gene_name": "UGT1A8", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9HAW9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HAW9" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9HAW9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HAW9" } ] } ] }, { "uniprot_ac": "Q9V9X9", "gene_name": "Ugt35D1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9V9X9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9V9X9" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9V9X9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9V9X9" } ] } ] }, { "uniprot_ac": "Q9VDA5", "gene_name": "Ugt49B2", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9VDA5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VDA5" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9VDA5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VDA5" } ] } ] }, { "uniprot_ac": "Q9VGS7", "gene_name": "Ugt303A1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9VGS7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VGS7" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9VGS7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VGS7" } ] } ] }, { "uniprot_ac": "Q9VGT0", "gene_name": "Ugt35B1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9VGT0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VGT0" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9VGT0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VGT0" } ] } ] }, { "uniprot_ac": "Q9VGT2", "gene_name": "Ugt35E1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9VGT2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VGT2" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9VGT2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VGT2" } ] } ] }, { "uniprot_ac": "Q9VGT4", "gene_name": "Ugt302E1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9VGT4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VGT4" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9VGT4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VGT4" } ] } ] }, { "uniprot_ac": "Q9VGT5", "gene_name": "Ugt302K1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9VGT5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VGT5" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9VGT5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VGT5" } ] } ] }, { "uniprot_ac": "Q9VGT8", "gene_name": "Ugt35C1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9VGT8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VGT8" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9VGT8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VGT8" } ] } ] }, { "uniprot_ac": "Q9VJ45", "gene_name": "Ugt36E1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9VJ45", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VJ45" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9VJ45", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VJ45" } ] } ] }, { "uniprot_ac": "Q9VJ46", "gene_name": "Ugt36D1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9VJ46", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VJ46" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9VJ46", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VJ46" } ] } ] }, { "uniprot_ac": "Q9VJ47", "gene_name": "Ugt36F1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9VJ47", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VJ47" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9VJ47", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VJ47" } ] } ] }, { "uniprot_ac": "Q9VJ81", "gene_name": "Ugt301D1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9VJ81", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VJ81" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9VJ81", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VJ81" } ] } ] }, { "uniprot_ac": "Q9W2J3", "gene_name": "Ugt49C1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9W2J3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W2J3" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9W2J3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W2J3" } ] } ] }, { "uniprot_ac": "Q9W2J4", "gene_name": "Ugt49B1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9W2J4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W2J4" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9W2J4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W2J4" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [ 315 ], "o_linked_sites": [], "snv_sites": [ 69, 162, 215, 315, 317, 344, 436, 443 ], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 315, "end_pos": 317 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 11 }, { "field": "total_sites", "count": 8 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 6 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 48 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }