{ "uniprot_canonical_ac": "O75175-1", "uniprot_ac": "O75175", "uniprot_id": "CNOT3_HUMAN", "mass": { "chemical_mass": 81872.0, "monoisotopic_mass": 81872.0 }, "refseq": { "ac": "NP_055331", "name": "CCR4-NOT transcription complex subunit 3", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_055331" }, "gene_names": [ { "name": "CNOT3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O75175", "id": "O75175" }, { "name": "CNOT3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_055331", "id": "NP_055331" }, { "name": "IDDSADF; LENG2; NOT3; NOT3H", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_055331", "id": "NP_055331" }, { "name": "KIAA0691", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O75175", "id": "O75175" }, { "name": "LENG2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O75175", "id": "O75175" }, { "name": "NOT3", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O75175", "id": "O75175" } ], "protein_names": [ { "name": "CCR4-NOT transcription complex subunit 3", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O75175" }, { "name": "CCR4-NOT transcription complex subunit 3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_055331", "id": "NP_055331" }, { "name": "CCR4-associated factor 3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O75175" }, { "name": "Leukocyte receptor cluster member 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O75175" }, { "name": "NOT3 (negative regulator of transcription 3, yeast) homolog; CCR4-associated factor 3; leukocyte receptor cluster member 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_055331", "id": "NP_055331" } ], "function": [ { "annotation": "A Genetic Study of Cerebral Atherosclerosis Reveals Novel Associations with NTNG1 and CNOT3. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_055331", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_055331" }, { "database": "PubMed", "id": "34073619", "url": "https://glygen.org/publication/PubMed/34073619" } ] }, { "annotation": "CCR4-NOT differentially controls host versus virus poly(a)-tail length and regulates HCMV infection.", "evidence": [ { "database": "RefSeq", "id": "NP_055331", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_055331" }, { "database": "PubMed", "id": "37846490", "url": "https://glygen.org/publication/PubMed/37846490" } ] }, { "annotation": "CNOT3 interacts with the Aurora B and MAPK/ERK kinases to promote survival of differentiating mesendodermal progenitor cells.", "evidence": [ { "database": "RefSeq", "id": "NP_055331", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_055331" }, { "database": "PubMed", "id": "34613789", "url": "https://glygen.org/publication/PubMed/34613789" } ] }, { "annotation": "Clinical features of CNOT3-associated neurodevelopmental disorder in three Chinese patients.", "evidence": [ { "database": "RefSeq", "id": "NP_055331", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_055331" }, { "database": "PubMed", "id": "36802310", "url": "https://glygen.org/publication/PubMed/36802310" } ] }, { "annotation": "Component of the CCR4-NOT complex which is one of the major cellular mRNA deadenylases and is linked to various cellular processes including bulk mRNA degradation, miRNA-mediated repression, translational repression during translational initiation and general transcription regulation. Additional complex functions may be a consequence of its influence on mRNA expression. May be involved in metabolic regulation; may be involved in recruitment of the CCR4-NOT complex to deadenylation target mRNAs involved in energy metabolism. Involved in mitotic progression and regulation of the spindle assembly checkpoint by regulating the stability of MAD1L1 mRNA. Can repress transcription and may link the CCR4-NOT complex to transcriptional regulation; the repressive function may involve histone deacetylases. Involved in the maintenance of embryonic stem (ES) cell identity.", "evidence": [ { "database": "UniProtKB", "id": "O75175", "url": "https://www.uniprot.org/uniprot/O75175#function" }, { "database": "PubMed", "id": "22342980", "url": "https://glygen.org/publication/PubMed/22342980" }, { "database": "PubMed", "id": "22367759", "url": "https://glygen.org/publication/PubMed/22367759" }, { "database": "PubMed", "id": "14707134", "url": "https://glygen.org/publication/PubMed/14707134" }, { "database": "UniProtKB", "id": "A0A2H2FJL5", "url": "https://www.uniprot.org/uniprot/A0A2H2FJL5#function" }, { "database": "UniProtKB", "id": "PIRNR005290", "url": "https://www.uniprot.org/uniprot/PIRNR005290#function" }, { "database": "UniProtKB", "id": "B7Z6J7", "url": "https://www.uniprot.org/uniprot/B7Z6J7#function" } ] }, { "annotation": "Determinants of Disease Penetrance in PRPF31-Associated Retinopathy. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_055331", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_055331" }, { "database": "PubMed", "id": "34680937", "url": "https://glygen.org/publication/PubMed/34680937" } ] }, { "annotation": "TBP-interacting protein 120B binds to NOT3", "evidence": [ { "database": "RefSeq", "id": "NP_055331", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_055331" }, { "database": "PubMed", "id": "12207886", "url": "https://glygen.org/publication/PubMed/12207886" } ] } ], "disease": [ { "disease_id": "MONDO:0032864", "recommended_name": { "id": "MONDO:0032864", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0032864", "name": "intellectual developmental disorder with speech delay, autism, and dysmorphic facies", "description": "" }, "synonyms": [ { "id": "MONDO:0032864", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0032864", "name": "IDDSADF", "description": "" }, { "id": "MONDO:0032864", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0032864", "name": "INTELLECTUAL DEVELOPMENTAL DISORDER WITH SPEECH DELAY, AUTISM, AND DYSMORPHIC FACIES", "description": "" }, { "id": "MIM:618672", "resource": "MIM", "url": "https://www.omim.org/entry/618672", "name": "Intellectual developmental disorder with speech delay, autism and dysmorphic facies", "description": "Intellectual developmental disorder with speech delay, autism and dysmorphic facies" } ], "evidence": [ { "id": "618672", "database": "MIM", "url": "https://www.omim.org/entry/618672" } ] } ], "snv": [ { "evidence": [ { "id": "rs1471126548", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1471126548" }, { "id": "rs1471126548", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1471126548#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 245, "end_pos": 245, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SHS->NHS).", "chr_id": "19", "chr_pos": "54145940", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S245", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs751645336", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751645336" }, { "id": "rs751645336", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751645336" }, { "id": "rs751645336", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs751645336" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 366, "end_pos": 366, "sequence_org": "G", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NSG->NSS).", "chr_id": "19", "chr_pos": "54148349", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "G366", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1383177429", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1383177429" }, { "id": "rs1383177429", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1383177429" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 384, "end_pos": 384, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (STT->NTT).", "chr_id": "19", "chr_pos": "54148404", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S384", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1474433851", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1474433851" }, { "id": "rs1474433851", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1474433851" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 408, "end_pos": 408, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SSS->NSS).", "chr_id": "19", "chr_pos": "54148476", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S408", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs758848913", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758848913" }, { "id": "rs758848913", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758848913" }, { "id": "rs758848913", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs758848913#frequency_tab" }, { "id": "rs758848913", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs758848913" }, { "id": "rs1474433851", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1474433851" }, { "id": "rs1474433851", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1474433851" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 409, "end_pos": 409, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SSS->NSS).", "chr_id": "19", "chr_pos": "54148479", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S409", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs758848913", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758848913" }, { "id": "rs758848913", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758848913" }, { "id": "rs758848913", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs758848913#frequency_tab" }, { "id": "rs758848913", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs758848913" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 410, "end_pos": 410, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SSS->NSS).", "chr_id": "19", "chr_pos": "54148479", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S410", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs770957095", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770957095" }, { "id": "rs770957095", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770957095" }, { "id": "rs770957095", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs770957095#frequency_tab" }, { "id": "rs770957095", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs770957095" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 426, "end_pos": 426, "sequence_org": "A", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NGA->NGT).", "chr_id": "19", "chr_pos": "54148529", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A426", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs746440950", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746440950" }, { "id": "rs746440950", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746440950" }, { "id": "rs746440950", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746440950" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 525, "end_pos": 525, "sequence_org": "P", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NGP->NGS).", "chr_id": "19", "chr_pos": "54149726", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P525", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1356524719", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1356524719" }, { "id": "rs1356524719", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1356524719" }, { "id": "rs1356524719", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1356524719" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 573, "end_pos": 573, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SST->NST).", "chr_id": "19", "chr_pos": "54152440", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S573", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "76.52", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000088038", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000088038" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "66.29", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000088038", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000088038" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "76.16", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000088038", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000088038" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "49.96", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000088038", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000088038" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "91.9", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000088038", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000088038" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "85.23", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000088038", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000088038" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "68.73", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000088038", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000088038" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "82.6", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000088038", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000088038" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "90.8", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000088038", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000088038" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "68.56", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000088038", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000088038" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "77.73", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000088038", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000088038" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "93.81", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000088038", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000088038" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "89.48", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000088038", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000088038" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O75175", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75175" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O75175", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75175" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O75175", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75175" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O75175", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75175" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O75175", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75175" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O75175", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75175" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O75175", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75175" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O75175", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75175" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O75175", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75175" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O75175", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75175" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O75175", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75175" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O75175", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O75175" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O75175", "url": "https://www.uniprot.org/uniprot/O75175" } ], "common_name": "Human" } ], "gene": [ { "name": "CNOT3", "url": "https://www.uniprot.org/uniprot/O75175", "locus": { "chromosome": "HSCHR19LRC_LRC_I_CTG3_1", "start_pos": 130558, "end_pos": 112549, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000274941", "url": "https://www.ensembl.org/id/ENSG00000274941" } ] } } ], "crossref": [ { "id": "ENSG00000088038", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000088038", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "CHEMBL4105769", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL4105769", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "CNOT3", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=CNOT3", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "4849", "url": "https://www.ncbi.nlm.nih.gov/gene/4849", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "7879", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=7879", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O75175", "url": "https://www.ebi.ac.uk/intact/interactors/id:O75175*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR007207", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007207", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR007282", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007282", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR012270", "url": "https://www.ebi.ac.uk/interpro/entry/IPR012270", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR038635", "url": "https://www.ebi.ac.uk/interpro/entry/IPR038635", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR040168", "url": "https://www.ebi.ac.uk/interpro/entry/IPR040168", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:4849", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:4849", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "604910", "url": "http://www.omim.org/entry/604910", "database": "MIM", "categories": [ "Other" ] }, { "id": "618672", "url": "http://www.omim.org/entry/618672", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O75175", "url": "https://www.nextprot.org/entry/NX_O75175", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "O75175", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75175", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "YKPQTPY", "url": "https://omabrowser.org/oma/group/YKPQTPY/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "10289at2759", "url": "http://www.orthodb.org/?query=10289at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR23326", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23326", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23326:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23326:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "4C0D", "url": "https://www.rcsb.org/structure/4C0D", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4C0G", "url": "https://www.rcsb.org/structure/4C0G", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5FU6", "url": "https://www.rcsb.org/structure/5FU6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5FU7", "url": "https://www.rcsb.org/structure/5FU7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8BHF", "url": "https://www.rcsb.org/structure/8BHF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF04065", "url": "http://pfam.xfam.org/family/PF04065", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF04153", "url": "http://pfam.xfam.org/family/PF04153", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O75175", "url": "https://pharos.nih.gov/targets/O75175", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O75175", "url": "http://purl.obolibrary.org/obo/PR_O75175", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6804115", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804115", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9820841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9820841", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_055331", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_055331", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A087X0F9", "url": "https://www.uniprot.org/uniprot/A0A087X0F9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A087X0F9-1", "url": "https://www.uniprot.org/uniprot/A0A087X0F9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JN65", "url": "https://www.uniprot.org/uniprot/A0A0G2JN65", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JN65-1", "url": "https://www.uniprot.org/uniprot/A0A0G2JN65-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JNJ7", "url": "https://www.uniprot.org/uniprot/A0A0G2JNJ7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JNJ7-1", "url": "https://www.uniprot.org/uniprot/A0A0G2JNJ7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JPP0", "url": "https://www.uniprot.org/uniprot/A0A0G2JPP0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0G2JPP0-1", "url": "https://www.uniprot.org/uniprot/A0A0G2JPP0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A2H2FJL5", "url": "https://www.uniprot.org/uniprot/A0A2H2FJL5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A2H2FJL5-1", "url": "https://www.uniprot.org/uniprot/A0A2H2FJL5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A2R8Y4W0", "url": "https://www.uniprot.org/uniprot/A0A2R8Y4W0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A2R8Y4W0-1", "url": "https://www.uniprot.org/uniprot/A0A2R8Y4W0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A2R8Y691", "url": "https://www.uniprot.org/uniprot/A0A2R8Y691", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A2R8Y691-1", "url": "https://www.uniprot.org/uniprot/A0A2R8Y691-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A2R8Y6N5", "url": "https://www.uniprot.org/uniprot/A0A2R8Y6N5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A2R8Y6N5-1", "url": "https://www.uniprot.org/uniprot/A0A2R8Y6N5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A2R8Y7Z8", "url": "https://www.uniprot.org/uniprot/A0A2R8Y7Z8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A2R8Y7Z8-1", "url": "https://www.uniprot.org/uniprot/A0A2R8Y7Z8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B7Z6J7", "url": "https://www.uniprot.org/uniprot/B7Z6J7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B7Z6J7-1", "url": "https://www.uniprot.org/uniprot/B7Z6J7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0Y5X7", "url": "https://www.uniprot.org/uniprot/H0Y5X7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0Y5X7-1", "url": "https://www.uniprot.org/uniprot/H0Y5X7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H7C148", "url": "https://www.uniprot.org/uniprot/H7C148", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H7C148-1", "url": "https://www.uniprot.org/uniprot/H7C148-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H7C5J4", "url": "https://www.uniprot.org/uniprot/H7C5J4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H7C5J4-1", "url": "https://www.uniprot.org/uniprot/H7C5J4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O75175", "url": "https://www.uniprot.org/uniprot/O75175", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O75175-1", "url": "https://www.uniprot.org/uniprot/O75175-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MADKRKLQGEIDRCLKKVSEGVEQFEDIWQKLHNAANANQKEKYEADLKKEIKKLQRLRDQIKTWVASNEIKDKRQLIDNRKLIETQMERFKVVERETKTKAYSKEGLGLAQKVDPAQKEKEEVGQWLTNTIDTLNMQVDQFESEVESLSVQTRKKKGDKDKQDRIEGLKRHIEKHRYHVRMLETILRMLDNDSILVDAIRKIKDDVEYYVDSSQDPDFEENEFLYDDLDLEDIPQALVATSPPSHSHMEDEIFNQSSSTPTSTTSSSPIPPSPANCTTENSEDDKKRGRSTDSEVSQSPAKNGSKPVHSNQHPQSPAVPPTYPSGPPPAASALSTTPGNNGVPAPAAPPSALGPKASPAPSHNSGTPAPYAQAVAPPAPSGPSTTQPRPPSVQPSGGGGGGSGGGGSSSSSNSSAGGGAGKQNGATSYSSVVADSPAEVALSSSGGNNASSQALGPPSGPHNPPPSTSKEPSAAAPTGAGGVAPGSGNNSGGPSLLVPLPVNPPSSPTPSFSDAKAAGALLNGPPQFSTAPEIKAPEPLSSLKSMAERAAISSGIEDPVPTLHLTERDIILSSTSAPPASAQPPLQLSEVNIPLSLGVCPLGPVPLTKEQLYQQAMEEAAWHHMPHPSDSERIRQYLPRNPCPTPPYHHQMPPPHSDTVEFYQRLSTETLFFIFYYLEGTKAQYLAAKALKKQSWRFHTKYMMWFQRHEEPKTITDEFEQGTYIYFDYEKWGQRKKEGFTFEYRYLEDRDLQ", "length": 753, "header": "sp|O75175-1|CNOT3_HUMAN Isoform 1 of CCR4-NOT transcription complex subunit 3 OS=Homo sapiens OX=9606 GN=CNOT3 PE=1 SV=1 CANONICAL=O75175-1" }, "isoforms": [ { "isoform_ac": "A0A087X0F9-1", "url": "", "sequence": { "sequence": "XLIETQMERFKVVERETKTKAYSKEGLGLAQKVDPAQKEKEEVGQWLTNTIDTLNMQVDQFESEVESLSVQTRKKKGDKDEGPSRCSAAPEPGPGLASRSRTGLRA", "length": 106, "header": "tr|A0A087X0F9-1|CNOT3_HUMAN Computationally mapped isoform of CCR4-NOT transcription complex subunit 3 OS=Homo sapiens OX=9606 GN=CNOT3 PE=1 SV=1 CANONICAL=O75175-1" }, "locus": { "chromosome": "19", "start_pos": 54145621, "end_pos": 54143737, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000613073.4", "url": "https://www.ensembl.org/id/ENST00000613073.4" }, { "database": "Ensembl Peptide", "id": "ENSP00000483360.1", "url": "https://www.ensembl.org/id/ENSP00000483360.1" } ] } }, { "isoform_ac": "A0A0G2JN65-1", "url": "", "sequence": { "sequence": "EFYQRLSTETLFFIFYYLEGTKAQYLAAKALKKQSWRFHTKYMMWFQRHEEPKTITDEFEQLAQSLSLTKYSSLWLSAQPGTPPSHPPLGQLLGLL", "length": 96, "header": "tr|A0A0G2JN65-1|CNOT3_HUMAN Computationally mapped isoform of CCR4-NOT transcription complex subunit 3 OS=Homo sapiens OX=9606 GN=CNOT3 PE=1 SV=1 CANONICAL=O75175-1" }, "locus": { "chromosome": "HSCHR19LRC_PGF1_CTG3_1", "start_pos": 128898, "end_pos": 127793, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000616264.4", "url": "https://www.ensembl.org/id/ENST00000616264.4" }, { "database": "Ensembl Peptide", "id": "ENSP00000480755.1", "url": "https://www.ensembl.org/id/ENSP00000480755.1" } ] } }, { "isoform_ac": "A0A0G2JNJ7-1", "url": "", "sequence": { "sequence": "XRKLIETQMERFKVVERETKTKAYSKEGLGLAQKVDPAQKEKEEVGQWLTNTIDTLNMQVDQFESEVESLSVQTRKKKGDKDQKQDRIEGLKRHIEKHRYHVRMLETILRMLDNDSILVDAIRKIKDDVEYYVDSSQDPDFEENEFLYDDLDLEDIPQALVATSPPSHSHMEDEIFNQSSSTPTSTTSSSPIPPSPANCTTENSEDDKKRGRSTDSEVSQSPAKNGSKPVHSNQHPQSPAVPPTYPSGPPPAASALSTTPGNNGVPAPAAPPSALGPKASPAPSHNSGTPAPYAQAVAPPAPSGPSTTQPRPPSVQPSGGGGGGSGGGGSSSSSNSSAGGGAGKQNGATSYSSVVADSPAEVALSSSGGNNASSQ", "length": 375, "header": "tr|A0A0G2JNJ7-1|A0A0G2JNJ7_HUMAN Computationally mapped isoform of CCR4-NOT transcription complex subunit 3 OS=Homo sapiens OX=9606 GN=CNOT3 PE=1 SV=1 CANONICAL=O75175-1" }, "locus": { "chromosome": "HSCHR19_4_CTG3_1", "start_pos": 123545, "end_pos": 118579, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000612729.4", "url": "https://www.ensembl.org/id/ENST00000612729.4" }, { "database": "Ensembl Peptide", "id": "ENSP00000481527.1", "url": "https://www.ensembl.org/id/ENSP00000481527.1" } ] } }, { "isoform_ac": "A0A0G2JPP0-1", "url": "", "sequence": { "sequence": "EFYQRLSTETLFFIFYYLEGTKAQYLAAKALKKQSWRFHTKYMMWFQRHEEPKTITDEFEQGTYIYFDYEKWGQRKKEGFTFEYRYLEDRDLQ", "length": 93, "header": "tr|A0A0G2JPP0-1|A0A0G2JPP0_HUMAN Computationally mapped isoform of CCR4-NOT transcription complex subunit 3 OS=Homo sapiens OX=9606 GN=CNOT3 PE=1 SV=1 CANONICAL=O75175-1" }, "locus": { "chromosome": "HSCHR19LRC_PGF1_CTG3_1", "start_pos": 130255, "end_pos": 127793, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000618717.4", "url": "https://www.ensembl.org/id/ENST00000618717.4" }, { "database": "Ensembl Peptide", "id": "ENSP00000484020.1", "url": "https://www.ensembl.org/id/ENSP00000484020.1" } ] } }, { "isoform_ac": "A0A2H2FJL5-1", "url": "", "sequence": { "sequence": "MLETILRMLDNDSILVDAIRKIKDDVEYYVDSSQDPDFEENEFLYDDLDLEDIPQALVATSPPSHSHMEDEIFNQSSSTPTSTTSSSPIPPSPANCTTENSEDDKKRGRSTDSEVSQSPAKNGSKPVHSNQHPQSPAVPPTYPSGPPPAASALSTTPGNNGVPAPAAPPSALGPKASPAPSHNSGTPAPYAQAVAPPAPSGPSTTQPRPPSVQPSGGGGGGSGGGGSSSSSNSSAGGGAGKQNGATSYSSVVADSPAEVALSSSGGNNASSQALGPPSGPHNPPPSTSKEPSAAAPTGAGGVAPGSGNNSGGPSLLVPLPVNPPSSPTPSFSDAKAAGALLNGPPQFSTAPEIKAPEPLSSLKSMAERAAISSGIEDPVPTLHLTERDIILSSTSAPPASAQPPLQLSEVNIPLSLGVCPLGPVPLTKEQLYQQAMEEAAWHHMPHPSDSERIRQYLPRNPCPTPPYHHQMPPPHSDTVEFYQRLSTETLFFIFYYLEPRDVRTAWVDSEAGPLRHTSAPLPVAHWLTRGPSPALLQQPQSRPTPLCSSAHSQASLETTGELSSPLPTPLL", "length": 571, "header": "tr|A0A2H2FJL5-1|A0A2H2FJL5_HUMAN Computationally mapped isoform of CCR4-NOT transcription complex subunit 3 OS=Homo sapiens OX=9606 GN=CNOT3 PE=1 SV=1 CANONICAL=O75175-1" }, "locus": { "chromosome": "HSCHR19LRC_COX1_CTG3_1", "start_pos": 128352, "end_pos": 120507, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000616102.4", "url": "https://www.ensembl.org/id/ENST00000616102.4" }, { "database": "Ensembl Peptide", "id": "ENSP00000477620.1", "url": "https://www.ensembl.org/id/ENSP00000477620.1" } ] } }, { "isoform_ac": "A0A2R8Y4W0-1", "url": "", "sequence": { "sequence": "XKEPSAAAPTGAGGVAPGSGNNSGGPSLLVPLPVNPPSSPTPSFSDAKAAGALLNGPPQFSTAPEIKAPEPLSSLKSMAERAAISSGIEDPVPTLHLTERGSTSPGTPVRRPPTTTRCHPHTRTLWNSTSACRPRHSSSSSTIWRALRHSIWQPRP", "length": 156, "header": "tr|A0A2R8Y4W0-1|A0A2R8Y4W0_HUMAN Computationally mapped isoform of CCR4-NOT transcription complex subunit 3 OS=Homo sapiens OX=9606 GN=CNOT3 PE=1 SV=1 CANONICAL=O75175-1" }, "locus": { "chromosome": "19", "start_pos": 54153750, "end_pos": 54149560, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000647082.1", "url": "https://www.ensembl.org/id/ENST00000647082.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000494008.1", "url": "https://www.ensembl.org/id/ENSP00000494008.1" } ] } }, { "isoform_ac": "A0A2R8Y691-1", "url": "", "sequence": { "sequence": "XQFSTAPEIKAPEPLSSLKSMAERAAISSGIEDPVPTLHLTERDIILSSTSAPPASAQPPLQLSEVNIPLSLGVCPLGPVPLTKEQLYQQAMEEAAWHHMPHPSDSERIRQYLPRNPCPTPPYHHQMPPPHSDTVEFYQRLSTETLFFIFYYLELL", "length": 156, "header": "tr|A0A2R8Y691-1|A0A2R8Y691_HUMAN Computationally mapped isoform of CCR4-NOT transcription complex subunit 3 OS=Homo sapiens OX=9606 GN=CNOT3 PE=1 SV=1 CANONICAL=O75175-1" }, "locus": { "chromosome": "19", "start_pos": 54153503, "end_pos": 54149730, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000496327.2", "url": "https://www.ensembl.org/id/ENST00000496327.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000495366.1", "url": "https://www.ensembl.org/id/ENSP00000495366.1" } ] } }, { "isoform_ac": "A0A2R8Y6N5-1", "url": "", "sequence": { "sequence": "MLETILRMLDNDSILVDAIR", "length": 20, "header": "tr|A0A2R8Y6N5-1|A0A2R8Y6N5_HUMAN Computationally mapped isoform of CCR4-NOT transcription complex subunit 3 OS=Homo sapiens OX=9606 GN=CNOT3 PE=1 SV=1 CANONICAL=O75175-1" }, "locus": { "chromosome": "19", "start_pos": 54145717, "end_pos": 54145658, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000646002.1", "url": "https://www.ensembl.org/id/ENST00000646002.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000495445.1", "url": "https://www.ensembl.org/id/ENSP00000495445.1" } ] } }, { "isoform_ac": "A0A2R8Y7Z8-1", "url": "", "sequence": { "sequence": "MADKRKLQGEIDRCLKKVSEGVEQFEDIWQKLHNAANANQKEKYEADLKKEIKKLQRLRDQIKTWVASNEIKDKRQLIDNRKLIETQMERFKVVERETKTKAYSKEGLGLAQKVDPAQKEKEEVGQWLTNTIDTLNMQVDQFESEVESLSVQTRKKKGDKDKQDRIEGLKRHIEKHRYHVRMLETILRMLDNDS", "length": 194, "header": "tr|A0A2R8Y7Z8-1|A0A2R8Y7Z8_HUMAN Computationally mapped isoform of CCR4-NOT transcription complex subunit 3 OS=Homo sapiens OX=9606 GN=CNOT3 PE=1 SV=1 CANONICAL=O75175-1" }, "locus": { "chromosome": "19", "start_pos": 54145696, "end_pos": 54142979, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000644245.1", "url": "https://www.ensembl.org/id/ENST00000644245.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000496534.1", "url": "https://www.ensembl.org/id/ENSP00000496534.1" } ] } }, { "isoform_ac": "B7Z6J7-1", "url": "", "sequence": { "sequence": "MADKRKLQGEIDRCLKKVSEGVEQFEDIWQKLHNAANANQKEKYEADLKKEIKKLQRLRDQIKTWVASNEIKDKRQLIDNRKLIETQMERFKVVERETKTKAYSKEGLGLAQKVDPAQKEKEEVGQWLTNTIDTLNMQVDQFESEVESLSVQTRKKKGDKDKQDRIEGLKRHIEKHRYHVRMLETILRMLDNDSILVDAIRKIKDDVEYYVDSSQDPDFEENEFLYDDLDLEDIPQALVATSPPSHSHMEDEIFNQSSSTPTSTTSSSPIPPSPANCTTENSEDDKKRGRSTDSEVSQSPAKNGSKPVHSNQHPQSPAVPPTYPSGPPPAASALSTTPGNNGVPAPAAPPSALGPKASPAPSHNSGTPAPYAQAVAPPAPSGPSTTQPRPPSVQPSGGGGGGSGGGGSSSSSNSSAGGGAGKQNGATSYSSVVADSPAEVALSSSGGNNASSQALGPPSGPHNPPPSTSKEPSAAAPTGAGGVAPGSGNNSGGPSLLVPLPVNPPSSPTPSFSDAKAAGALLNGPPQFSTAPEIKAPEPLSSLKSMAERAAISSGIEDPVPTLHLTERDIILSSTSAPPASAQPPLQLSEVNIPLSLGVCPLGPVPLTKEQLYQQAMEEAAWHHMPHPSDSERIRQYLPRNPCPTPPYHHQMPPPHSDTVEFYQRLSTETLFFIFYYLEVQQGPRGSLGPPGFAATAAVPPRAGGVRALRHSIWQPRP", "length": 718, "header": "tr|B7Z6J7-1|B7Z6J7_HUMAN Computationally mapped isoform of CCR4-NOT transcription complex subunit 3 OS=Homo sapiens OX=9606 GN=CNOT3 PE=1 SV=1 CANONICAL=O75175-1" }, "locus": { "chromosome": "19", "start_pos": 54153748, "end_pos": 54142979, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000617930.2", "url": "https://www.ensembl.org/id/ENST00000617930.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000496602.1", "url": "https://www.ensembl.org/id/ENSP00000496602.1" } ] } }, { "isoform_ac": "H0Y5X7-1", "url": "", "sequence": { "sequence": "XKEPSAAAPTGAGGVAPGSGNNSGGPSLLVPLPVNPPSSPTPSFSDAKAAGALLNGPPQFSTAPEIKAPEPLSSLKSMAERAAISSGIEDPVPTLHLTERDIILSSTSAPPASAQPPLQLSEVNIPLSLGVCPLGPVPLTKEQLYQQAMEEAAWHHMPHPSDSERIRQYLPRNPCPTPPYHHQMPPPHSDTVEFYQRLSTETLFFIFYYLEGTKAQYLAAKALKKQSWRFHTKYMMWFQRHEEPKTITDEFEQLAQSLSLTKYSSLWLSAQPGTPPSHPPLGQLLGLL", "length": 288, "header": "tr|H0Y5X7-1|H0Y5X7_HUMAN Computationally mapped isoform of CCR4-NOT transcription complex subunit 3 OS=Homo sapiens OX=9606 GN=CNOT3 PE=1 SV=1 CANONICAL=O75175-1" }, "locus": { "chromosome": "19", "start_pos": 54154050, "end_pos": 54149560, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000457463.1", "url": "https://www.ensembl.org/id/ENST00000457463.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000401703.1", "url": "https://www.ensembl.org/id/ENSP00000401703.1" } ] } }, { "isoform_ac": "H7C148-1", "url": "", "sequence": { "sequence": "MADKRKLQGEIDRCLKKVSEGVEQFEDIWQKLHNAANANQKEKYEADLKKEIKKLQRLRDQIKTWVASNEIKDKRQLIDNRKLIETQMERFKVVERETKTKAYSKEGLGLAQKVDPAQKEKEEVGQWLTNTIDTLNMQVDQFESEVESLSVQTRKKKGDKDQKQDRIEGLKRHIEKHRYHVRMLETILRMLDNDSILVDAIRKIKDDVEYYVDSSQDPDFEENEFLYDDLDLEDIPQALVATSPPSHSHMEDEIFNQSSSTPTSTTSSSPIPPSPANCTTENSEDDKKRGRSTDSEVSQSPAKNGSKPVHSNQHPQSPAVPPTYPSGPPPAASALSTTPGNNGVPAPAAPPSALGPKASPAPSHNSGTPAPYAQAVAPPAPSGPSTTQPRPPSVQPSGGGGGGSGGGGSSSSSNSSAGGGAGKQNGATSYSSVVADSPAEVALSSSGGNNASSQA", "length": 455, "header": "tr|H7C148-1|H7C148_HUMAN Computationally mapped isoform of CCR4-NOT transcription complex subunit 3 OS=Homo sapiens OX=9606 GN=CNOT3 PE=1 SV=2 CANONICAL=O75175-1" }, "locus": { "chromosome": "19", "start_pos": 54148699, "end_pos": 54142979, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000440571.6", "url": "https://www.ensembl.org/id/ENST00000440571.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000398463.2", "url": "https://www.ensembl.org/id/ENSP00000398463.2" } ] } }, { "isoform_ac": "H7C5J4-1", "url": "", "sequence": { "sequence": "AQYLAAKALKKQSWRFHTKYMMWFQRHEEPKTITDEFEQIPDHLLVHSLTAFSPGQGTYIYFDYEKWGQRKKEGFTFEYRYLEDRDLQ", "length": 88, "header": "tr|H7C5J4-1|H7C5J4_HUMAN Computationally mapped isoform of CCR4-NOT transcription complex subunit 3 OS=Homo sapiens OX=9606 GN=CNOT3 PE=1 SV=1 CANONICAL=O75175-1" }, "locus": { "chromosome": "19", "start_pos": 54155404, "end_pos": 54153724, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000471126.1", "url": "https://www.ensembl.org/id/ENST00000471126.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000420064.1", "url": "https://www.ensembl.org/id/ENSP00000420064.1" } ] } }, { "isoform_ac": "O75175-1", "url": "", "sequence": { "sequence": "MADKRKLQGEIDRCLKKVSEGVEQFEDIWQKLHNAANANQKEKYEADLKKEIKKLQRLRDQIKTWVASNEIKDKRQLIDNRKLIETQMERFKVVERETKTKAYSKEGLGLAQKVDPAQKEKEEVGQWLTNTIDTLNMQVDQFESEVESLSVQTRKKKGDKDKQDRIEGLKRHIEKHRYHVRMLETILRMLDNDSILVDAIRKIKDDVEYYVDSSQDPDFEENEFLYDDLDLEDIPQALVATSPPSHSHMEDEIFNQSSSTPTSTTSSSPIPPSPANCTTENSEDDKKRGRSTDSEVSQSPAKNGSKPVHSNQHPQSPAVPPTYPSGPPPAASALSTTPGNNGVPAPAAPPSALGPKASPAPSHNSGTPAPYAQAVAPPAPSGPSTTQPRPPSVQPSGGGGGGSGGGGSSSSSNSSAGGGAGKQNGATSYSSVVADSPAEVALSSSGGNNASSQALGPPSGPHNPPPSTSKEPSAAAPTGAGGVAPGSGNNSGGPSLLVPLPVNPPSSPTPSFSDAKAAGALLNGPPQFSTAPEIKAPEPLSSLKSMAERAAISSGIEDPVPTLHLTERDIILSSTSAPPASAQPPLQLSEVNIPLSLGVCPLGPVPLTKEQLYQQAMEEAAWHHMPHPSDSERIRQYLPRNPCPTPPYHHQMPPPHSDTVEFYQRLSTETLFFIFYYLEGTKAQYLAAKALKKQSWRFHTKYMMWFQRHEEPKTITDEFEQGTYIYFDYEKWGQRKKEGFTFEYRYLEDRDLQ", "length": 753, "header": "sp|O75175-1|CNOT3_HUMAN Isoform 1 of CCR4-NOT transcription complex subunit 3 OS=Homo sapiens OX=9606 GN=CNOT3 PE=1 SV=1 CANONICAL=O75175-1" }, "locus": { "chromosome": "19", "start_pos": 54155404, "end_pos": 54142979, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000221232.11", "url": "https://www.ensembl.org/id/ENST00000221232.11" }, { "database": "Ensembl Peptide", "id": "ENSP00000221232.5", "url": "https://www.ensembl.org/id/ENSP00000221232.5" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 529, "start_aa": "Ser", "end_pos": 529, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser529", "evidence": [ { "id": "O75175", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75175" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" } ] } ], "phosphorylation": [ { "start_pos": 100, "end_pos": 100, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75175", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75175" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Thr100" }, { "start_pos": 104, "end_pos": 104, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75175", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75175" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser104" }, { "start_pos": 194, "end_pos": 194, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75175", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75175" }, { "database": "PubMed", "id": "20230923", "url": "https://glygen.org/publication/PubMed/20230923" } ], "site_lbl": "Ser194" }, { "start_pos": 292, "end_pos": 292, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "O75175", "url": "https://www.uniprot.org/uniprot/O75175" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "iPTMnet", "id": "O75175", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75175" }, { "database": "phospho.ELM", "id": "O75175", "url": "http://phospho.elm.eu.org/byAccession/O75175.html" } ], "site_lbl": "Thr292" }, { "start_pos": 294, "end_pos": 294, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75175", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75175" }, { "database": "PubMed", "id": "18212344", "url": "https://glygen.org/publication/PubMed/18212344" }, { "database": "PubMed", "id": "19415658", "url": "https://glygen.org/publication/PubMed/19415658" } ], "site_lbl": "Ser294" }, { "start_pos": 299, "end_pos": 299, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O75175", "url": "https://www.uniprot.org/uniprot/O75175" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "iPTMnet", "id": "O75175", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75175" }, { "database": "PubMed", "id": "15302935", "url": "https://glygen.org/publication/PubMed/15302935" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "phospho.ELM", "id": "O75175", "url": "http://phospho.elm.eu.org/byAccession/O75175.html" } ], "site_lbl": "Ser299" }, { "start_pos": 507, "end_pos": 507, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O75175", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75175" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" } ], "site_lbl": "Ser507" }, { "start_pos": 542, "end_pos": 542, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O75175", "url": "https://www.uniprot.org/uniprot/O75175" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "iPTMnet", "id": "O75175", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75175" } ], "site_lbl": "Ser542" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Isolation and characterization of human orthologs of yeast CCR4-NOT complex subunits.", "journal": "Nucleic Acids Res.", "date": "2000", "authors": "Albert TK, Lemaire M, van Berkum NL, Gentz R, Collart MA, Timmers HT", "evidence": [ { "database": "UniProtKB", "id": "O75175", "url": "https://www.uniprot.org/uniprot/O75175" }, { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "10637334", "url": "https://glygen.org/publication/PubMed/10637334" } ] }, { "title": "Interaction between a poly(A)-specific ribonuclease and the 5' cap influences mRNA deadenylation rates in vitro.", "journal": "Molecular cell", "date": "2000", "authors": "Gao M, Fritz DT, Ford LP, Wilusz J", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "10882133", "url": "https://glygen.org/publication/PubMed/10882133" } ] }, { "title": "The cap-to-tail guide to mRNA turnover.", "journal": "Nature reviews. Molecular cell biology", "date": "2001", "authors": "Wilusz CJ, Wormington M, Peltz SW", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "11283721", "url": "https://glygen.org/publication/PubMed/11283721" } ] }, { "title": "The human BTG2/TIS21/PC3 gene: genomic structure, transcriptional regulation and evaluation as a candidate tumor suppressor gene.", "journal": "Gene", "date": "2002", "authors": "Duriez C, Falette N, Audoynaud C, Moyret-Lalle C, Bensaad K, Courtois S, Wang Q, Soussi T, Puisieux A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804115", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804115" } ], "reference": [ { "type": "PubMed", "id": "11814693", "url": "https://glygen.org/publication/PubMed/11814693" } ] }, { "title": "CCR4, a 3'-5' poly(A) RNA and ssDNA exonuclease, is the catalytic component of the cytoplasmic deadenylase.", "journal": "The EMBO journal", "date": "2002", "authors": "Chen J, Chiang YC, Denis CL", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "11889047", "url": "https://glygen.org/publication/PubMed/11889047" } ] }, { "title": "A positive feedback mechanism in the transcriptional activation of Apaf-1 by p53 and the coactivator Zac-1.", "journal": "Oncogene", "date": "2002", "authors": "Rozenfeld-Granot G, Krishnamurthy J, Kannan K, Toren A, Amariglio N, Givol D, Rechavi G", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804115", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804115" } ], "reference": [ { "type": "PubMed", "id": "11896574", "url": "https://glygen.org/publication/PubMed/11896574" } ] }, { "title": "TBP-interacting protein 120B, which is induced in relation to myogenesis, binds to NOT3.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2002", "authors": "Aoki T, Okada N, Wakamatsu T, Tamura TA", "evidence": [ { "database": "UniProtKB", "id": "O75175", "url": "https://www.uniprot.org/uniprot/O75175" }, { "database": "RefSeq", "id": "NP_055331", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_055331" } ], "reference": [ { "type": "PubMed", "id": "12207886", "url": "https://glygen.org/publication/PubMed/12207886" } ] }, { "title": "Silencing of the novel p53 target gene Snk/Plk2 leads to mitotic catastrophe in paclitaxel (taxol)-exposed cells.", "journal": "Molecular and cellular biology", "date": "2003", "authors": "Burns TF, Fei P, Scata KA, Dicker DT, El-Deiry WS", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804115", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804115" } ], "reference": [ { "type": "PubMed", "id": "12897130", "url": "https://glygen.org/publication/PubMed/12897130" } ] }, { "title": "Properties of a HeLa cell 3' exonuclease specific for degrading poly(A) tails of mammalian mRNA.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Astrom J, Astrom A, Virtanen A", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "1355481", "url": "https://glygen.org/publication/PubMed/1355481" } ] }, { "title": "Identification of a human cytoplasmic poly(A) nuclease complex stimulated by poly(A)-binding protein.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Uchida N, Hoshino S, Katada T", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "14583602", "url": "https://glygen.org/publication/PubMed/14583602" } ] }, { "title": "Repression of promoter activity by CNOT2, a subunit of the transcription regulatory Ccr4-not complex.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Zwartjes CG, Jayne S, van den Berg DL, Timmers HT", "evidence": [ { "database": "UniProtKB", "id": "O75175", "url": "https://www.uniprot.org/uniprot/O75175" } ], "reference": [ { "type": "PubMed", "id": "14707134", "url": "https://glygen.org/publication/PubMed/14707134" } ] }, { "title": "The enzymes and control of eukaryotic mRNA turnover.", "journal": "Nature structural & molecular biology", "date": "2004", "authors": "Parker R, Song H", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "14749774", "url": "https://glygen.org/publication/PubMed/14749774" } ] }, { "title": "Cdc25C phosphorylation on serine 191 by Plk3 promotes its nuclear translocation.", "journal": "Oncogene", "date": "2004", "authors": "Bahassi el M, Hennigan RF, Myer DL, Stambrook PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804115", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804115" } ], "reference": [ { "type": "PubMed", "id": "14968113", "url": "https://glygen.org/publication/PubMed/14968113" } ] }, { "title": "Large-scale characterization of HeLa cell nuclear phosphoproteins.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP", "evidence": [ { "database": "iPTMnet", "id": "O75175", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75175" } ], "reference": [ { "type": "PubMed", "id": "15302935", "url": "https://glygen.org/publication/PubMed/15302935" } ] }, { "title": "Messenger RNA decay in mammalian cells: the exonuclease perspective.", "journal": "Cell biochemistry and biophysics", "date": "2004", "authors": "Fritz DT, Bergman N, Kilpatrick WJ, Wilusz CJ, Wilusz J", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "15475613", "url": "https://glygen.org/publication/PubMed/15475613" } ] }, { "title": "Overexpression of RGC-32 in colon cancer and other tumors.", "journal": "Experimental and molecular pathology", "date": "2005", "authors": "Fosbrink M, Cudrici C, Niculescu F, Badea TC, David S, Shamsuddin A, Shin ML, Rus H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804115", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804115" } ], "reference": [ { "type": "PubMed", "id": "15713436", "url": "https://glygen.org/publication/PubMed/15713436" } ] }, { "title": "Identification of novel p53 target genes in ionizing radiation response.", "journal": "Cancer research", "date": "2005", "authors": "Jen KY, Cheung VG", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804115", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804115" } ], "reference": [ { "type": "PubMed", "id": "16140933", "url": "https://glygen.org/publication/PubMed/16140933" } ] }, { "title": "From birth to death: the complex lives of eukaryotic mRNAs.", "journal": "Science (New York, N.Y.)", "date": "2005", "authors": "Moore MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "16141059", "url": "https://glygen.org/publication/PubMed/16141059" } ] }, { "title": "Transcriptional silencing of Polo-like kinase 2 (SNK/PLK2) is a frequent event in B-cell malignancies.", "journal": "Blood", "date": "2006", "authors": "Syed N, Smith P, Sullivan A, Spender LC, Dyer M, Karran L, O'Nions J, Allday M, Hoffmann I, Crawford D, Griffin B, Farrell PJ, Crook T", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804115", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804115" } ], "reference": [ { "type": "PubMed", "id": "16160013", "url": "https://glygen.org/publication/PubMed/16160013" } ] }, { "title": "Concerted action of poly(A) nucleases and decapping enzyme in mammalian mRNA turnover.", "journal": "Nature structural & molecular biology", "date": "2005", "authors": "Yamashita A, Chang TC, Yamashita Y, Zhu W, Zhong Z, Chen CY, Shyu AB", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "16284618", "url": "https://glygen.org/publication/PubMed/16284618" } ] }, { "title": "Opposing polymerase-deadenylase activities regulate cytoplasmic polyadenylation.", "journal": "Molecular cell", "date": "2006", "authors": "Kim JH, Richter JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "17052452", "url": "https://glygen.org/publication/PubMed/17052452" } ] }, { "title": "RGC32, a novel p53-inducible gene, is located on centrosomes during mitosis and results in G2/M arrest.", "journal": "Oncogene", "date": "2007", "authors": "Saigusa K, Imoto I, Tanikawa C, Aoyagi M, Ohno K, Nakamura Y, Inazawa J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804115", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804115" } ], "reference": [ { "type": "PubMed", "id": "17146433", "url": "https://glygen.org/publication/PubMed/17146433" } ] }, { "title": "The highways and byways of mRNA decay.", "journal": "Nature reviews. Molecular cell biology", "date": "2007", "authors": "Garneau NL, Wilusz J, Wilusz CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "17245413", "url": "https://glygen.org/publication/PubMed/17245413" } ] }, { "title": "Poly(A) nuclease interacts with the C-terminal domain of polyadenylate-binding protein domain from poly(A)-binding protein.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Siddiqui N, Mangus DA, Chang TC, Palermino JM, Shyu AB, Gehring K", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "17595167", "url": "https://glygen.org/publication/PubMed/17595167" } ] }, { "title": "Hydrophilic interaction chromatography reduces the complexity of the phosphoproteome and improves global phosphopeptide isolation and detection.", "journal": "Molecular & cellular proteomics : MCP", "date": "2008", "authors": "McNulty DE, Annan RS", "evidence": [ { "database": "iPTMnet", "id": "O75175", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75175" } ], "reference": [ { "type": "PubMed", "id": "18212344", "url": "https://glygen.org/publication/PubMed/18212344" } ] }, { "title": "The BTG2 protein is a general activator of mRNA deadenylation.", "journal": "The EMBO journal", "date": "2008", "authors": "Mauxion F, Faux C, Seraphin B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804115", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804115" } ], "reference": [ { "type": "PubMed", "id": "18337750", "url": "https://glygen.org/publication/PubMed/18337750" } ] }, { "title": "Deadenylation is prerequisite for P-body formation and mRNA decay in mammalian cells.", "journal": "The Journal of cell biology", "date": "2008", "authors": "Zheng D, Ezzeddine N, Chen CY, Zhu W, He X, Shyu AB", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "18625844", "url": "https://glygen.org/publication/PubMed/18625844" } ] }, { "title": "A quantitative atlas of mitotic phosphorylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "O75175", "url": "https://www.uniprot.org/uniprot/O75175" }, { "database": "iPTMnet", "id": "O75175", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75175" } ], "reference": [ { "type": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ] }, { "title": "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.", "journal": "Mol. Cell", "date": "2008", "authors": "Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M", "evidence": [ { "database": "UniProtKB", "id": "H7C148", "url": "https://www.uniprot.org/uniprot/H7C148" }, { "database": "iPTMnet", "id": "O75175", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75175" } ], "reference": [ { "type": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" } ] }, { "title": "The many pathways of RNA degradation.", "journal": "Cell", "date": "2009", "authors": "Houseley J, Tollervey D", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "19239894", "url": "https://glygen.org/publication/PubMed/19239894" } ] }, { "title": "Structural basis for the antiproliferative activity of the Tob-hCaf1 complex.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Horiuchi M, Takeuchi K, Noda N, Muroya N, Suzuki T, Nakamura T, Kawamura-Tsuzuku J, Takahasi K, Yamamoto T, Inagaki F", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804115", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804115" } ], "reference": [ { "type": "PubMed", "id": "19276069", "url": "https://glygen.org/publication/PubMed/19276069" } ] }, { "title": "Phosphoproteomic analysis of distinct tumor cell lines in response to nocodazole treatment.", "journal": "Proteomics", "date": "2009", "authors": "Nagano K, Shinkawa T, Mutoh H, Kondoh O, Morimoto S, Inomata N, Ashihara M, Ishii N, Aoki Y, Haramura M", "evidence": [ { "database": "iPTMnet", "id": "O75175", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75175" } ], "reference": [ { "type": "PubMed", "id": "19415658", "url": "https://glygen.org/publication/PubMed/19415658" } ] }, { "title": "Human Ccr4-Not complexes contain variable deadenylase subunits.", "journal": "Biochem. J.", "date": "2009", "authors": "Lau NC, Kolkman A, van Schaik FM, Mulder KW, Pijnappel WW, Heck AJ, Timmers HT", "evidence": [ { "database": "UniProtKB", "id": "O75175", "url": "https://www.uniprot.org/uniprot/O75175" }, { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "19558367", "url": "https://glygen.org/publication/PubMed/19558367" } ] }, { "title": "Global effects of kinase inhibitors on signaling networks revealed by quantitative phosphoproteomics.", "journal": "Molecular & cellular proteomics : MCP", "date": "2009", "authors": "Pan C, Olsen JV, Daub H, Mann M", "evidence": [ { "database": "iPTMnet", "id": "O75175", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75175" } ], "reference": [ { "type": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "iPTMnet", "id": "O75175", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75175" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "Phosphoproteomic analysis of primary human multiple myeloma cells.", "journal": "Journal of proteomics", "date": "2010", "authors": "Ge F, Xiao CL, Yin XF, Lu CH, Zeng HL, He QY", "evidence": [ { "database": "iPTMnet", "id": "O75175", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75175" } ], "reference": [ { "type": "PubMed", "id": "20230923", "url": "https://glygen.org/publication/PubMed/20230923" } ] }, { "title": "Polo-like kinase 2-dependent phosphorylation of NPM/B23 on serine 4 triggers centriole duplication.", "journal": "PloS one", "date": "2010", "authors": "Krause A, Hoffmann I", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804115", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804115" } ], "reference": [ { "type": "PubMed", "id": "20352051", "url": "https://glygen.org/publication/PubMed/20352051" } ] }, { "title": "PLK2 phosphorylation is critical for CPAP function in procentriole formation during the centrosome cycle.", "journal": "The EMBO journal", "date": "2010", "authors": "Chang J, Cizmecioglu O, Hoffmann I, Rhee K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804115", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804115" } ], "reference": [ { "type": "PubMed", "id": "20531387", "url": "https://glygen.org/publication/PubMed/20531387" } ] }, { "title": "CNOT2 depletion disrupts and inhibits the CCR4-NOT deadenylase complex and induces apoptotic cell death.", "journal": "Genes Cells", "date": "2011", "authors": "Ito Kentaro, Inoue Takeshi, Yokoyama Kazumasa, Morita Masahiro, Suzuki Toru, Yamamoto Tadashi", "evidence": [ { "database": "UniProtKB", "id": "O75175", "url": "https://www.uniprot.org/uniprot/O75175" } ], "reference": [ { "type": "PubMed", "id": "21299754", "url": "https://glygen.org/publication/PubMed/21299754" } ] }, { "title": "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.", "journal": "Science signaling", "date": "2011", "authors": "Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B", "evidence": [ { "database": "UniProtKB", "id": "O75175", "url": "https://www.uniprot.org/uniprot/O75175" }, { "database": "iPTMnet", "id": "O75175", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75175" } ], "reference": [ { "type": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" } ] }, { "title": "Evidence providing new insights into TOB-promoted deadenylation and supporting a link between TOB's deadenylation-enhancing and antiproliferative activities.", "journal": "Molecular and cellular biology", "date": "2012", "authors": "Ezzeddine N, Chen CY, Shyu AB", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804115", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804115" } ], "reference": [ { "type": "PubMed", "id": "22252318", "url": "https://glygen.org/publication/PubMed/22252318" } ] }, { "title": "Involvement of CNOT3 in mitotic progression through inhibition of MAD1 expression.", "journal": "Biochemical and biophysical research communications", "date": "2012-03-09", "authors": "Takahashi Akinori, Kikuguchi Chisato, Morita Masahiro, Shimodaira Tetsuhiro, Tokai-Nishizumi Noriko, Yokoyama Kazumasa, Ohsugi Miho, Suzuki Toru, Yamamoto Tadashi", "evidence": [ { "database": "UniProtKB", "id": "O75175", "url": "https://www.uniprot.org/uniprot/O75175" } ], "reference": [ { "type": "PubMed", "id": "22342980", "url": "https://glygen.org/publication/PubMed/22342980" } ] }, { "title": "Cnot1, Cnot2, and Cnot3 maintain mouse and human ESC identity and inhibit extraembryonic differentiation.", "journal": "Stem cells (Dayton, Ohio)", "date": "2012", "authors": "Zheng X, Dumitru R, Lackford BL, Freudenberg JM, Singh AP, Archer TK, Jothi R, Hu G", "evidence": [ { "database": "UniProtKB", "id": "O75175", "url": "https://www.uniprot.org/uniprot/O75175" } ], "reference": [ { "type": "PubMed", "id": "22367759", "url": "https://glygen.org/publication/PubMed/22367759" } ] }, { "title": "The anti-proliferative activity of BTG/TOB proteins is mediated via the Caf1a (CNOT7) and Caf1b (CNOT8) deadenylase subunits of the Ccr4-not complex.", "journal": "PloS one", "date": "2012", "authors": "Doidge R, Mittal S, Aslam A, Winkler GS", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804115", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804115" } ], "reference": [ { "type": "PubMed", "id": "23236473", "url": "https://glygen.org/publication/PubMed/23236473" } ] }, { "title": "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.", "journal": "Journal of proteomics", "date": "2014", "authors": "Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H", "evidence": [ { "database": "UniProtKB", "id": "O75175", "url": "https://www.uniprot.org/uniprot/O75175" }, { "database": "iPTMnet", "id": "O75175", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O75175" } ], "reference": [ { "type": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" } ] }, { "title": "Uridylation by TUT4 and TUT7 marks mRNA for degradation.", "journal": "Cell", "date": "2014", "authors": "Lim J, Ha M, Chang H, Kwon SC, Simanshu DK, Patel DJ, Kim VN", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "25480299", "url": "https://glygen.org/publication/PubMed/25480299" } ] }, { "title": "Interaction of CCR4-NOT with EBF1 regulates gene-specific transcription and mRNA stability in B lymphopoiesis.", "journal": "Genes Dev.", "date": "2016", "authors": "Yang CY, Ramamoorthy S, Boller S, Rosenbaum M, Rodriguez Gil A, Mittler G, Imai Y, Kuba K, Grosschedl R", "evidence": [ { "database": "UniProtKB", "id": "O75175", "url": "https://www.uniprot.org/uniprot/O75175" } ], "reference": [ { "type": "PubMed", "id": "27807034", "url": "https://glygen.org/publication/PubMed/27807034" } ] }, { "title": "De novo variants in CNOT3 cause a variable neurodevelopmental disorder.", "journal": "European journal of human genetics : EJHG", "date": "2019", "authors": "Martin R, Splitt M, Genevieve D, Aten E, Collins A, de Bie CI, Faivre L, Foulds N, Giltay J, Ibitoye R, Joss S, Kennedy J, Kerr B, Kivuva E, Koopmans M, Newbury-Ecob R, Jean-Marcais N, Peeters EAJ, Smithson S, Tomkins S, Tranmauthem F, Piton A, van Haeringen A", "evidence": [ { "database": "UniProtKB", "id": "O75175", "url": "https://www.uniprot.org/uniprot/O75175" } ], "reference": [ { "type": "PubMed", "id": "31201375", "url": "https://glygen.org/publication/PubMed/31201375" } ] }, { "title": "Homozygous Mutations in BTG4 Cause Zygotic Cleavage Failure and Female Infertility.", "journal": "American journal of human genetics", "date": "2020", "authors": "Zheng W, Zhou Z, Sha Q, Niu X, Sun X, Shi J, Zhao L, Zhang S, Dai J, Cai S, Meng F, Hu L, Gong F, Li X, Fu J, Shi R, Lu G, Chen B, Fan H, Wang L, Lin G, Sang Q", "evidence": [ { "database": "Reactome", "id": "R-HSA-9820841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9820841" } ], "reference": [ { "type": "PubMed", "id": "32502391", "url": "https://glygen.org/publication/PubMed/32502391" } ] }, { "title": "O-GlcNAc modification regulates MTA1 transcriptional activity during breast cancer cell genotoxic adaptation.", "journal": "Biochimica et biophysica acta. General subjects", "date": "2021", "authors": "Xie X, Wu Q, Zhang K, Liu Y, Zhang N, Chen Q, Wang L, Li W, Zhang J, Liu Y", "evidence": [ { "database": "O-GlcNAc Database", "id": "O75175", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75175" } ], "reference": [ { "type": "PubMed", "id": "34019948", "url": "https://glygen.org/publication/PubMed/34019948" } ] }, { "title": "A Genetic Study of Cerebral Atherosclerosis Reveals Novel Associations with NTNG1 and CNOT3.", "journal": "Genes", "date": "2021", "authors": "Vattathil SM, Liu Y, Harerimana NV, Lori A, Gerasimov ES, Beach TG, Reiman EM, De Jager PL, Schneider JA, Bennett DA, Seyfried NT, Levey AI, Wingo AP, Wingo TS", "evidence": [ { "database": "RefSeq", "id": "NP_055331", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_055331" } ], "reference": [ { "type": "PubMed", "id": "34073619", "url": "https://glygen.org/publication/PubMed/34073619" } ] }, { "title": "CNOT3 interacts with the Aurora B and MAPK/ERK kinases to promote survival of differentiating mesendodermal progenitor cells.", "journal": "Molecular biology of the cell", "date": "2021", "authors": "Sarkar M, Martufi M, Roman-Trufero M, Wang YF, Whilding C, Dormann D, Sabbattini P, Dillon N", "evidence": [ { "database": "RefSeq", "id": "NP_055331", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_055331" } ], "reference": [ { "type": "PubMed", "id": "34613789", "url": "https://glygen.org/publication/PubMed/34613789" } ] }, { "title": "A novel homozygous missense variant in BTG4 causes zygotic cleavage failure and female infertility.", "journal": "Journal of assisted reproduction and genetics", "date": "2021", "authors": "Liu R, Zhou Y, Li Q, Chen B, Zhou Z, Wang L, Wang L, Sang Q, Jin L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9820841", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9820841" } ], "reference": [ { "type": "PubMed", "id": "34647228", "url": "https://glygen.org/publication/PubMed/34647228" } ] }, { "title": "Determinants of Disease Penetrance in PRPF31-Associated Retinopathy.", "journal": "Genes", "date": "2021", "authors": "McLenachan S, Zhang D, Grainok J, Zhang X, Huang Z, Chen SC, Zaw K, Lima A, Jennings L, Roshandel D, Moon SY, Heath Jeffery RC, Attia MS, Thompson JA, Lamey TM, McLaren TL, De Roach J, Fletcher S, Chen FK", "evidence": [ { "database": "RefSeq", "id": "NP_055331", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_055331" } ], "reference": [ { "type": "PubMed", "id": "34680937", "url": "https://glygen.org/publication/PubMed/34680937" } ] }, { "title": "An Optimized Isotopic Photocleavable Tagging Strategy for Site-Specific and Quantitative Profiling of Protein O-GlcNAcylation in Colorectal Cancer Metastasis.", "journal": "ACS chemical biology", "date": "2022", "authors": "Liu J, Hao Y, Wang C, Jin Y, Yang Y, Gu J, Chen X", "evidence": [ { "database": "O-GlcNAc Database", "id": "O75175", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O75175" } ], "reference": [ { "type": "PubMed", "id": "35254053", "url": "https://glygen.org/publication/PubMed/35254053" } ] }, { "title": "Clinical features of CNOT3-associated neurodevelopmental disorder in three Chinese patients.", "journal": "Neurogenetics", "date": "2023-04", "authors": "Zhao Peiwei, Meng Qingjie, Wan Chunhui, Lei Tao, Zhang Lei, Zhang Xiankai, Tan Li, Zhu Hongmin, He Xuelian", "evidence": [ { "database": "RefSeq", "id": "NP_055331", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_055331" } ], "reference": [ { "type": "PubMed", "id": "36802310", "url": "https://glygen.org/publication/PubMed/36802310" } ] }, { "title": "CCR4-NOT differentially controls host versus virus poly(a)-tail length and regulates HCMV infection.", "journal": "EMBO reports", "date": "2023-12-06", "authors": "Burgess Hannah M, Grande Rebecca, Riccio Sofia, Dinesh Ikshitaa, Winkler Gerlof Sebastiaan, Depledge Daniel P, Mohr Ian", "evidence": [ { "database": "RefSeq", "id": "NP_055331", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_055331" } ], "reference": [ { "type": "PubMed", "id": "37846490", "url": "https://glygen.org/publication/PubMed/37846490" } ] }, { "title": "Identification of BTG2, an antiproliferative p53-dependent component of the DNA damage cellular response pathway.", "journal": "Nature genetics", "date": "1996", "authors": "Rouault JP, Falette N, Guehenneux F, Guillot C, Rimokh R, Wang Q, Berthet C, Moyret-Lalle C, Savatier P, Pain B, Shaw P, Berger R, Samarut J, Magaud JP, Ozturk M, Samarut C, Puisieux A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804115", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804115" } ], "reference": [ { "type": "PubMed", "id": "8944033", "url": "https://glygen.org/publication/PubMed/8944033" } ] }, { "title": "Poly(A) tail shortening by a mammalian poly(A)-specific 3'-exoribonuclease.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Korner CG, Wahle E", "evidence": [ { "database": "Reactome", "id": "R-HSA-429947", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947" } ], "reference": [ { "type": "PubMed", "id": "9099687", "url": "https://glygen.org/publication/PubMed/9099687" } ] }, { "title": "Regulation of apoptosis and cell cycle arrest by Zac1, a novel zinc finger protein expressed in the pituitary gland and the brain.", "journal": "The EMBO journal", "date": "1997", "authors": "Spengler D, Villalba M, Hoffmann A, Pantaloni C, Houssami S, Bockaert J, Journot L", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804115", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804115" } ], "reference": [ { "type": "PubMed", "id": "9184226", "url": "https://glygen.org/publication/PubMed/9184226" } ] }, { "title": "hZAC encodes a zinc finger protein with antiproliferative properties and maps to a chromosomal region frequently lost in cancer.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Varrault A, Ciani E, Apiou F, Bilanges B, Hoffmann A, Pantaloni C, Bockaert J, Spengler D, Journot L", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804115", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804115" } ], "reference": [ { "type": "PubMed", "id": "9671765", "url": "https://glygen.org/publication/PubMed/9671765" } ] }, { "title": "Interaction of BTG1 and p53-regulated BTG2 gene products with mCaf1, the murine homolog of a component of the yeast CCR4 transcriptional regulatory complex.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Rouault JP, Prevot D, Berthet C, Birot AM, Billaud M, Magaud JP, Corbo L", "evidence": [ { "database": "Reactome", "id": "R-HSA-6804115", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804115" } ], "reference": [ { "type": "PubMed", "id": "9712883", "url": "https://glygen.org/publication/PubMed/9712883" } ] } ], "pathway": [ { "id": "hsa:4849", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:4849", "resource": "KEGG Pathway" }, { "id": "R-HSA-429947", "name": "Deadenylation of mRNA", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-429947", "resource": "Reactome", "description": "Deadenylation of mRNA" }, { "id": "R-HSA-6804115", "name": "TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6804115", "resource": "Reactome", "description": "TP53 regulates transcription of additional cell cycle genes whose exact role in the p53 pathway remain uncertain" }, { "id": "R-HSA-9820841", "name": "M-decay: degradation of maternal mRNAs by maternally stored factors", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9820841", "resource": "Reactome", "description": "M-decay: degradation of maternal mRNAs by maternally stored factors" } ], "orthologs": [ { "uniprot_canonical_ac": "Q8K0V4-1", "protein_name": "CCR4-NOT transcription complex subunit 3", "gene_name": "Cnot3", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MADKRKLQGEIDRCLKKVSEGVEQFEDIWQKLHNAANANQKEKYEADLKKEIKKLQRLRDQIKTWVASNEIKDKRQLIENRKLIETQMERFKVVERETKTKAYSKEGLGLAQKVDPAQKEKEEVGQWLTNTIDTLNMQVDQFESEVESLSVQTRKKKGDKDKQDRIEGLKRHIEKHRYHVRMLETILRMLDNDSILVDAIRKIKDDVEYYVDSSQDPDFEENEFLYDDLDLEDIPQALVATSPPSHSHMEDEIFNQSSSTPTSTTSSSPIPPSPANCTTENSEDDKKRGRSTDSEVSQSPAKNGSKPVHSNQHPQSPAVPPTYPSGPPPTTSALSSTPGNNGASTPAAPTSALGPKASPAPSHNSGTPAPYAQAVAPPNASGPSNAQPRPPSAQPSGGSGGGSGGSSSNSNSGTGGGAGKQNGATSYSSVVADSPAEVTLSSSGGSSASSQALGPTSGPHNPAPSTSKESSTAAPSGAGNVASGSGNNSGGPSLLVPLPVNPPSSPTPSFSEAKAAGTLLNGPPQFSTTPEIKAPEPLSSLKSMAERAAISSGIEDPVPTLHLTDRDIILSSTSAPPTSSQPPLQLSEVNIPLSLGVCPLGPVSLTKEQLYQQAMEEAAWHHMPHPSDSERIRQYLPRNPCPTPPYHHQMPPPHSDTVEFYQRLSTETLFFIFYYLEGTKAQYLAAKALKKQSWRFHTKYMMWFQRHEEPKTITDEFEQGTYIYFDYEKWGQRKKEGFTFEYRYLEDRDLQ", "length": 751 }, "evidence": [ { "id": "45919227", "url": "http://www.informatics.jax.org/homology/45919227", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 6, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "O75175", "url": "https://www.uniprot.org/uniprot/O75175" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "O75175", "url": "https://www.uniprot.org/uniprot/O75175" } ], "pmid": "" }, { "name": "CCR4-NOT core complex", "id": "GO:0030015", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030015", "evidence": [ { "database": "UniProtKB", "id": "O75175", "url": "https://www.uniprot.org/uniprot/O75175" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "O75175", "url": "https://www.uniprot.org/uniprot/O75175" } ], "pmid": "" }, { "name": "P-body", "id": "GO:0000932", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000932", "evidence": [ { "database": "UniProtKB", "id": "O75175", "url": "https://www.uniprot.org/uniprot/O75175" } ], "pmid": "" }, { "name": "CCR4-NOT complex", "id": "GO:0030014", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030014", "evidence": [ { "database": "UniProtKB", "id": "O75175", "url": "https://www.uniprot.org/uniprot/O75175" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 6, "go_terms": [ { "name": "regulation of DNA-templated transcription", "id": "GO:0006355", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006355", "evidence": [ { "database": "UniProtKB", "id": "O75175", "url": "https://www.uniprot.org/uniprot/O75175" } ], "pmid": "" }, { "name": "regulation of stem cell population maintenance", "id": "GO:2000036", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000036", "evidence": [ { "database": "UniProtKB", "id": "O75175", "url": "https://www.uniprot.org/uniprot/O75175" } ], "pmid": "" }, { "name": "trophectodermal cell differentiation", "id": "GO:0001829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001829", "evidence": [ { "database": "UniProtKB", "id": "O75175", "url": "https://www.uniprot.org/uniprot/O75175" } ], "pmid": "" }, { "name": "regulatory ncRNA-mediated gene silencing", "id": "GO:0031047", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031047", "evidence": [ { "database": "UniProtKB", "id": "O75175", "url": "https://www.uniprot.org/uniprot/O75175" } ], "pmid": "" }, { "name": "nuclear-transcribed mRNA poly(A) tail shortening", "id": "GO:0000289", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000289", "evidence": [ { "database": "UniProtKB", "id": "O75175", "url": "https://www.uniprot.org/uniprot/O75175" } ], "pmid": "" }, { "name": "positive regulation of cold-induced thermogenesis", "id": "GO:0120162", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0120162", "evidence": [ { "database": "UniProtKB", "id": "O75175", "url": "https://www.uniprot.org/uniprot/O75175" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 192, "end_pos": 194, "annotation": "n_glycosylation_sequon" }, { "start_pos": 255, "end_pos": 257, "annotation": "n_glycosylation_sequon" }, { "start_pos": 276, "end_pos": 278, "annotation": "n_glycosylation_sequon" }, { "start_pos": 303, "end_pos": 305, "annotation": "n_glycosylation_sequon" }, { "start_pos": 413, "end_pos": 415, "annotation": "n_glycosylation_sequon" }, { "start_pos": 449, "end_pos": 451, "annotation": "n_glycosylation_sequon" }, { "start_pos": 489, "end_pos": 491, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 529 ], "snv_sites": [ 245, 366, 384, 408, 409, 410, 426, 525, 573 ], "glycation_sites": [], "phosphorylation_sites": [ 100, 104, 194, 292, 294, 299, 507, 542 ], "sequon_annotation_sites": [ { "start_pos": 192, "end_pos": 194 }, { "start_pos": 255, "end_pos": 257 }, { "start_pos": 276, "end_pos": 278 }, { "start_pos": 303, "end_pos": 305 }, { "start_pos": 413, "end_pos": 415 }, { "start_pos": 449, "end_pos": 451 }, { "start_pos": 489, "end_pos": 491 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 8 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 9 }, { "field": "total_sites", "count": 9 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 9 }, { "field": "total_sites", "count": 9 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 62 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }