{ "uniprot_canonical_ac": "O60884-1", "uniprot_ac": "O60884", "uniprot_id": "DNJA2_HUMAN", "mass": { "chemical_mass": 45746.0, "monoisotopic_mass": 45746.0 }, "refseq": { "ac": "NP_005871", "name": "dnaJ homolog subfamily A member 2", "summary": "The protein encoded by this gene belongs to the evolutionarily conserved DNAJ/HSP40 family of proteins, which regulate molecular chaperone activity by stimulating ATPase activity. DNAJ proteins may have up to 3 distinct domains: a conserved 70-amino acid J domain, usually at the N terminus; a glycine/phenylalanine (G/F)-rich region; and a cysteine-rich domain containing 4 motifs resembling a zinc finger domain. The product of this gene works as a cochaperone of Hsp70s in protein folding and mitochondrial protein import in vitro. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005871" }, "gene_names": [ { "name": "DNAJA2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O60884", "id": "O60884" }, { "name": "CPR3; DJ3; DJA2; DNAJ; DNJ3; HIRIP4; PRO3015; RDJ2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005871", "id": "NP_005871" }, { "name": "CPR3", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O60884", "id": "O60884" }, { "name": "DNAJA2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005871", "id": "NP_005871" }, { "name": "HIRIP4", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O60884", "id": "O60884" } ], "protein_names": [ { "name": "DnaJ homolog subfamily A member 2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O60884" }, { "name": "Cell cycle progression restoration gene 3 protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O60884" }, { "name": "Dj3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O60884" }, { "name": "Dnj3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O60884" }, { "name": "HIRA-interacting protein 4", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O60884" }, { "name": "Renal carcinoma antigen NY-REN-14", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O60884" }, { "name": "cell cycle progression 3 protein; HIRA interacting protein 4; renal carcinoma antigen NY-REN-14; cell cycle progression restoration gene 3 protein; DnaJ (Hsp40) homolog, subfamily A, member 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005871", "id": "NP_005871" }, { "name": "dnaJ homolog subfamily A member 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005871", "id": "NP_005871" } ], "function": [ { "annotation": "Co-chaperone of Hsc70. Stimulates ATP hydrolysis and the folding of unfolded proteins mediated by HSPA1A/B (in vitro) (PubMed:24318877).", "evidence": [ { "database": "UniProtKB", "id": "O60884", "url": "https://www.uniprot.org/uniprot/O60884#function" }, { "database": "PubMed", "id": "24318877", "url": "https://glygen.org/publication/PubMed/24318877" } ] }, { "annotation": "DNAJA2 deficiency activates cGAS-STING pathway via the induction of aberrant mitosis and chromosome instability. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_005871", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005871" }, { "database": "PubMed", "id": "37640708", "url": "https://glygen.org/publication/PubMed/37640708" } ] }, { "annotation": "Hsp40 proteins phase separate to chaperone the assembly and maintenance of membraneless organelles.", "evidence": [ { "database": "RefSeq", "id": "NP_005871", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005871" }, { "database": "PubMed", "id": "33229560", "url": "https://glygen.org/publication/PubMed/33229560" } ] }, { "annotation": "Overexpressing DNAJA2 but not DNAJA1 enhanced CFTR degradation at the endoplasmic reticulum by Hsc70/Hsp70 and the E3 ubiquitin ligase CHIP. Excess Hsp70 also promoted CFTR degradation, but this occurred through the lysosomal pathway and required CHIP but not complex formation with HOP and Hsp90. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_005871", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005871" }, { "database": "PubMed", "id": "31408507", "url": "https://glygen.org/publication/PubMed/31408507" } ] }, { "annotation": "The protein encoded by this gene belongs to the evolutionarily conserved DNAJ/HSP40 family of proteins, which regulate molecular chaperone activity by stimulating ATPase activity. DNAJ proteins may have up to 3 distinct domains: a conserved 70-amino acid J domain, usually at the N terminus; a glycine/phenylalanine (G/F)-rich region; and a cysteine-rich domain containing 4 motifs resembling a zinc finger domain. The product of this gene works as a cochaperone of Hsp70s in protein folding and mitochondrial protein import in vitro. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_005871", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005871" } ] }, { "annotation": "The self-association equilibrium of DNAJA2 regulates its interaction with unfolded substrate proteins and with Hsc70. Erratum:[Nat Commun. 2024 Jan 2;15(1):99. PMID: 38167402] Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_005871", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005871" }, { "database": "PubMed", "id": "37670029", "url": "https://glygen.org/publication/PubMed/37670029" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "87.41", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000069345", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000069345" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "92.42", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000069345", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000069345" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "84.97", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000069345", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000069345" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "73.45", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000069345", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000069345" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "95.05", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000069345", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000069345" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "93.71", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000069345", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000069345" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "82.37", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000069345", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000069345" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "93.17", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000069345", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000069345" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "91.98", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000069345", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000069345" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "81.12", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000069345", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000069345" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "91.84", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000069345", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000069345" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "91.79", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000069345", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000069345" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "92.81", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000069345", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000069345" } ] } ], "expression_disease": [ { "significant": "No", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O60884", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60884" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O60884", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60884" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O60884", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60884" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O60884", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60884" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O60884", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60884" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O60884", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60884" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O60884", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60884" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O60884", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60884" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O60884", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60884" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O60884", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60884" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O60884", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60884" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O60884", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60884" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O60884", "url": "https://www.uniprot.org/uniprot/O60884" } ], "common_name": "Human" } ], "gene": [ { "name": "DNAJA2", "url": "https://www.uniprot.org/uniprot/O60884", "locus": { "chromosome": "16", "start_pos": 46955362, "end_pos": 46973674, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000069345", "url": "https://www.ensembl.org/id/ENSG00000069345" } ] } } ], "crossref": [ { "id": "ENSG00000069345", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000069345", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd06257", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd06257", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd10719", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd10719", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd10747", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd10747", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL4295671", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL4295671", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "DNAJA2", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=DNAJA2", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "10294", "url": "https://www.ncbi.nlm.nih.gov/gene/10294", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "14884", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=14884", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O60884", "url": "https://www.ebi.ac.uk/intact/interactors/id:O60884*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001305", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001305", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001623", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001623", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002939", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002939", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008971", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008971", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR012724", "url": "https://www.ebi.ac.uk/interpro/entry/IPR012724", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018253", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018253", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036410", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036410", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036869", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036869", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR044713", "url": "https://www.ebi.ac.uk/interpro/entry/IPR044713", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:10294", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:10294", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "611322", "url": "http://www.omim.org/entry/611322", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O60884", "url": "https://www.nextprot.org/entry/NX_O60884", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "O60884", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O60884", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "RVCPTCV", "url": "https://omabrowser.org/oma/group/RVCPTCV/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2785358at2759", "url": "http://www.orthodb.org/?query=2785358at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR24074", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24074", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24074:SF56", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24074:SF56", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR43888", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR43888", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR43888:SF31", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR43888:SF31", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "7ZHS", "url": "https://www.rcsb.org/structure/7ZHS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00226", "url": "http://pfam.xfam.org/family/PF00226", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00684", "url": "http://pfam.xfam.org/family/PF00684", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF01556", "url": "http://pfam.xfam.org/family/PF01556", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O60884", "url": "https://pharos.nih.gov/targets/O60884", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O60884", "url": "http://purl.obolibrary.org/obo/PR_O60884", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-3371497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371497", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_005871", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005871", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A087WT48", "url": "https://www.uniprot.org/uniprot/A0A087WT48", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A087WT48-1", "url": "https://www.uniprot.org/uniprot/A0A087WT48-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3L320", "url": "https://www.uniprot.org/uniprot/I3L320", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3L320-1", "url": "https://www.uniprot.org/uniprot/I3L320-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O60884", "url": "https://www.uniprot.org/uniprot/O60884", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O60884-1", "url": "https://www.uniprot.org/uniprot/O60884-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MANVADTKLYDILGVPPGASENELKKAYRKLAKEYHPDKNPNAGDKFKEISFAYEVLSNPEKRELYDRYGEQGLREGSGGGGGMDDIFSHIFGGGLFGFMGNQSRSRNGRRRGEDMMHPLKVSLEDLYNGKTTKLQLSKNVLCSACSGQGGKSGAVQKCSACRGRGVRIMIRQLAPGMVQQMQSVCSDCNGEGEVINEKDRCKKCEGKKVIKEVKILEVHVDKGMKHGQRITFTGEADQAPGVEPGDIVLLLQEKEHEVFQRDGNDLHMTYKIGLVEALCGFQFTFKHLDGRQIVVKYPPGKVIEPGCVRVVRGEGMPQYRNPFEKGDLYIKFDVQFPENNWINPDKLSELEDLLPSRPEVPNIIGETEEVELQEFDSTRGSGGGQRREAYNDSSDEESSSHHGPGVQCAHQ", "length": 412, "header": "sp|O60884-1|DNJA2_HUMAN Isoform 1 of DnaJ homolog subfamily A member 2 OS=Homo sapiens OX=9606 GN=DNAJA2 PE=1 SV=1 CANONICAL=O60884-1" }, "isoforms": [ { "isoform_ac": "A0A087WT48-1", "url": "", "sequence": { "sequence": "MDDIFSHIFGGGLFGFMGNQSRSRNGRRRGEDMMHPLKVSLEDLYNGKTTKLQLSKNVLCSACSGQGGKSGAVQKCSACRGRGVRIMIRQLAPGMVQQMQSVCSDCNGEGEVINEKDRCKKCEGKKVIKEVKIL", "length": 134, "header": "tr|A0A087WT48-1|A0A087WT48_HUMAN Computationally mapped isoform of DnaJ heat shock protein family (Hsp40) member A2 OS=Homo sapiens OX=9606 GN=DNAJA2 PE=1 SV=1 CANONICAL=O60884-1" }, "locus": { "chromosome": "16", "start_pos": 46971461, "end_pos": 46964734, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000617000.1", "url": "https://www.ensembl.org/id/ENST00000617000.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000477579.1", "url": "https://www.ensembl.org/id/ENSP00000477579.1" } ] } }, { "isoform_ac": "I3L320-1", "url": "", "sequence": { "sequence": "MANVADTKLYDILGVPPGASENELKKAYRKLAKEYHPDKNPNAGDKN", "length": 47, "header": "tr|I3L320-1|DNJA2_HUMAN Computationally mapped isoform of DnaJ homolog subfamily A member 2 OS=Homo sapiens OX=9606 GN=DNAJA2 PE=1 SV=1 CANONICAL=O60884-1" }, "locus": { "chromosome": "16", "start_pos": 46973572, "end_pos": 46971657, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000563158.1", "url": "https://www.ensembl.org/id/ENST00000563158.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000460104.1", "url": "https://www.ensembl.org/id/ENSP00000460104.1" } ] } }, { "isoform_ac": "O60884-1", "url": "", "sequence": { "sequence": "MANVADTKLYDILGVPPGASENELKKAYRKLAKEYHPDKNPNAGDKFKEISFAYEVLSNPEKRELYDRYGEQGLREGSGGGGGMDDIFSHIFGGGLFGFMGNQSRSRNGRRRGEDMMHPLKVSLEDLYNGKTTKLQLSKNVLCSACSGQGGKSGAVQKCSACRGRGVRIMIRQLAPGMVQQMQSVCSDCNGEGEVINEKDRCKKCEGKKVIKEVKILEVHVDKGMKHGQRITFTGEADQAPGVEPGDIVLLLQEKEHEVFQRDGNDLHMTYKIGLVEALCGFQFTFKHLDGRQIVVKYPPGKVIEPGCVRVVRGEGMPQYRNPFEKGDLYIKFDVQFPENNWINPDKLSELEDLLPSRPEVPNIIGETEEVELQEFDSTRGSGGGQRREAYNDSSDEESSSHHGPGVQCAHQ", "length": 412, "header": "sp|O60884-1|DNJA2_HUMAN Isoform 1 of DnaJ homolog subfamily A member 2 OS=Homo sapiens OX=9606 GN=DNAJA2 PE=1 SV=1 CANONICAL=O60884-1" }, "locus": { "chromosome": "16", "start_pos": 46973572, "end_pos": 46957032, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000317089.10", "url": "https://www.ensembl.org/id/ENST00000317089.10" }, { "database": "Ensembl Peptide", "id": "ENSP00000314030.5", "url": "https://www.ensembl.org/id/ENSP00000314030.5" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "O60884", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O60884" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "21740066", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/21740066" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "20305658", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/20305658" } ] } ], "phosphorylation": [ { "start_pos": 123, "end_pos": 123, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O60884", "url": "https://www.uniprot.org/uniprot/O60884" } ], "site_lbl": "Ser123" }, { "start_pos": 144, "end_pos": 144, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O60884", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60884" }, { "database": "PubMed", "id": "18491316", "url": "https://glygen.org/publication/PubMed/18491316" } ], "site_lbl": "Ser144" }, { "start_pos": 147, "end_pos": 147, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O60884", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60884" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" } ], "site_lbl": "Ser147" }, { "start_pos": 368, "end_pos": 368, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O60884", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60884" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Thr368" }, { "start_pos": 382, "end_pos": 382, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O60884", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60884" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" } ], "site_lbl": "Ser382" }, { "start_pos": 391, "end_pos": 391, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "O60884", "url": "https://www.uniprot.org/uniprot/O60884" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "iPTMnet", "id": "O60884", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60884" } ], "site_lbl": "Tyr391" }, { "start_pos": 394, "end_pos": 394, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O60884", "url": "https://www.uniprot.org/uniprot/O60884" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "iPTMnet", "id": "O60884", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60884" } ], "site_lbl": "Ser394" }, { "start_pos": 395, "end_pos": 395, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O60884", "url": "https://www.uniprot.org/uniprot/O60884" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "iPTMnet", "id": "O60884", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60884" } ], "site_lbl": "Ser395" }, { "start_pos": 78, "end_pos": 78, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O60884", "url": "https://www.uniprot.org/uniprot/O60884" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "iPTMnet", "id": "O60884", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60884" } ], "site_lbl": "Ser78" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Antigens recognized by autologous antibody in patients with renal-cell carcinoma.", "journal": "Int. J. Cancer", "date": "1999", "authors": "Scanlan MJ, Gordan JD, Williamson B, Stockert E, Bander NH, Jongeneel V, Gure AO, Jager D, Jager E, Knuth A, Chen YT, Old LJ", "evidence": [ { "database": "UniProtKB", "id": "O60884", "url": "https://www.uniprot.org/uniprot/O60884" } ], "reference": [ { "type": "PubMed", "id": "10508479", "url": "https://glygen.org/publication/PubMed/10508479" } ] }, { "title": "Functional probing of the human glucocorticoid receptor steroid-interacting surface by site-directed mutagenesis. Gln-642 plays an important role in steroid recognition and binding.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Lind U, Greenidge P, Gillner M, Koehler KF, Wright A, Carlstedt-Duke J", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371497" } ], "reference": [ { "type": "PubMed", "id": "10747884", "url": "https://glygen.org/publication/PubMed/10747884" } ] }, { "title": "Human DnaJ homologs dj2 and dj3, and bag-1 are positive cochaperones of hsc70.", "journal": "J. Biol. Chem.", "date": "2000", "authors": "Terada K, Mori M", "evidence": [ { "database": "UniProtKB", "id": "O60884", "url": "https://www.uniprot.org/uniprot/O60884" } ], "reference": [ { "type": "PubMed", "id": "10816573", "url": "https://glygen.org/publication/PubMed/10816573" } ] }, { "title": "A review of the chemistry, biological action, and clinical applications of anabolic-androgenic steroids.", "journal": "Clinical therapeutics", "date": "2001", "authors": "Shahidi NT", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371497" } ], "reference": [ { "type": "PubMed", "id": "11589254", "url": "https://glygen.org/publication/PubMed/11589254" } ] }, { "title": "Clinical review 138: Anabolic-androgenic steroid therapy in the treatment of chronic diseases.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2001", "authors": "Basaria S, Wahlstrom JT, Dobs AS", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371497" } ], "reference": [ { "type": "PubMed", "id": "11701661", "url": "https://glygen.org/publication/PubMed/11701661" } ] }, { "title": "A new first step in activation of steroid receptors: hormone-induced switching of FKBP51 and FKBP52 immunophilins.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Davies TH, Ning YM, Sanchez ER", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371497" } ], "reference": [ { "type": "PubMed", "id": "11751894", "url": "https://glygen.org/publication/PubMed/11751894" } ] }, { "title": "Synthesis and biological activity of 5-methylidene 1,2-dihydrochromeno[3,4-f]quinoline derivatives as progesterone receptor modulators.", "journal": "Bioorganic & medicinal chemistry letters", "date": "2003", "authors": "Zhi L, Tegley CM, Pio B, Edwards JP, Jones TK, Marschke KB, Mais DE, Risek B, Schrader WT", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371497" } ], "reference": [ { "type": "PubMed", "id": "12781197", "url": "https://glygen.org/publication/PubMed/12781197" } ] }, { "title": "Action of new steroids in blocking effects of aldosterone and desoxycorticosterone on salt.", "journal": "Science (New York, N.Y.)", "date": "1957", "authors": "KAGAWA CM, CELLA JA, VAN ARMAN CG", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371497" } ], "reference": [ { "type": "PubMed", "id": "13486053", "url": "https://glygen.org/publication/PubMed/13486053" } ] }, { "title": "Dihydrospirorenone (ZK30595): a novel synthetic progestagen--characterization of binding to different receptor proteins.", "journal": "Contraception", "date": "1992", "authors": "Pollow K, Juchem M, Elger W, Jacobi N, Hoffmann G, Mobus V", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371497" } ], "reference": [ { "type": "PubMed", "id": "1493716", "url": "https://glygen.org/publication/PubMed/1493716" } ] }, { "title": "3D structure of human FK506-binding protein 52: implications for the assembly of the glucocorticoid receptor/Hsp90/immunophilin heterocomplex.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Wu B, Li P, Liu Y, Lou Z, Ding Y, Shu C, Ye S, Bartlam M, Shen B, Rao Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371497" } ], "reference": [ { "type": "PubMed", "id": "15159550", "url": "https://glygen.org/publication/PubMed/15159550" } ] }, { "title": "A tagging-via-substrate technology for detection and proteomics of farnesylated proteins.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2004", "authors": "Kho Y, Kim SC, Jiang C, Barma D, Kwon SW, Cheng J, Jaunbergs J, Weinbaum C, Tamanoi F, Falck J, Zhao Y", "evidence": [ { "database": "UniProtKB", "id": "O60884", "url": "https://www.uniprot.org/uniprot/O60884" } ], "reference": [ { "type": "PubMed", "id": "15308774", "url": "https://glygen.org/publication/PubMed/15308774" } ] }, { "title": "FKBP52.", "journal": "The international journal of biochemistry & cell biology", "date": "2005", "authors": "Davies TH, Sanchez ER", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371497" } ], "reference": [ { "type": "PubMed", "id": "15381148", "url": "https://glygen.org/publication/PubMed/15381148" } ] }, { "title": "FK506-binding proteins 51 and 52 differentially regulate dynein interaction and nuclear translocation of the glucocorticoid receptor in mammalian cells.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Wochnik GM, Ruegg J, Abel GA, Schmidt U, Holsboer F, Rein T", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371497" } ], "reference": [ { "type": "PubMed", "id": "15591061", "url": "https://glygen.org/publication/PubMed/15591061" } ] }, { "title": "The co-chaperone p23 arrests the Hsp90 ATPase cycle to trap client proteins.", "journal": "Journal of molecular biology", "date": "2006", "authors": "McLaughlin SH, Sobott F, Yao ZP, Zhang W, Nielsen PR, Grossmann JG, Laue ED, Robinson CV, Jackson SE", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371497" } ], "reference": [ { "type": "PubMed", "id": "16403413", "url": "https://glygen.org/publication/PubMed/16403413" } ] }, { "title": "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.", "journal": "Cell", "date": "2006", "authors": "Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M", "evidence": [ { "database": "UniProtKB", "id": "O60884", "url": "https://www.uniprot.org/uniprot/O60884" }, { "database": "iPTMnet", "id": "O60884", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60884" } ], "reference": [ { "type": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ] }, { "title": "Modulation of androgen receptor activation function 2 by testosterone and dihydrotestosterone.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Askew EB, Gampe RT Jr, Stanley TB, Faggart JL, Wilson EM", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371497" } ], "reference": [ { "type": "PubMed", "id": "17591767", "url": "https://glygen.org/publication/PubMed/17591767" } ] }, { "title": "Activity of androgen receptor antagonist bicalutamide in prostate cancer cells is independent of NCoR and SMRT corepressors.", "journal": "Cancer research", "date": "2007", "authors": "Hodgson MC, Astapova I, Hollenberg AN, Balk SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371497" } ], "reference": [ { "type": "PubMed", "id": "17804755", "url": "https://glygen.org/publication/PubMed/17804755" } ] }, { "title": "hsp70 genes in the human genome: Conservation and differentiation patterns predict a wide array of overlapping and specialized functions.", "journal": "BMC evolutionary biology", "date": "2008", "authors": "Brocchieri L, Conway de Macario E, Macario AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371497" } ], "reference": [ { "type": "PubMed", "id": "18215318", "url": "https://glygen.org/publication/PubMed/18215318" } ] }, { "title": "11-(pyridinylphenyl)steroids--a new class of mixed-profile progesterone agonists/antagonists.", "journal": "Bioorganic & medicinal chemistry", "date": "2008", "authors": "Rewinkel J, Enthoven M, Golstein I, van der Rijst M, Scholten A, van Tilborg M, de Weys D, Wisse J, Hamersma H", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371497" } ], "reference": [ { "type": "PubMed", "id": "18243712", "url": "https://glygen.org/publication/PubMed/18243712" } ] }, { "title": "[Safety of long-term replacement hormonal therapy in patients with erectile dysfunction and androgen deficiency].", "journal": "Urologiia (Moscow, Russia : 1999)", "date": "2007", "authors": "Morgunov LIu, Vertkin AL, Pushkar' DIu", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371497" } ], "reference": [ { "type": "PubMed", "id": "18254226", "url": "https://glygen.org/publication/PubMed/18254226" } ] }, { "title": "Phosphoproteome analysis of the human Chang liver cells using SCX and a complementary mass spectrometric strategy.", "journal": "Proteomics", "date": "2008", "authors": "Sui S, Wang J, Yang B, Song L, Zhang J, Chen M, Liu J, Lu Z, Cai Y, Chen S, Bi W, Zhu Y, He F, Qian X", "evidence": [ { "database": "iPTMnet", "id": "O60884", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60884" } ], "reference": [ { "type": "PubMed", "id": "18491316", "url": "https://glygen.org/publication/PubMed/18491316" } ] }, { "title": "FKBP family proteins: immunophilins with versatile biological functions.", "journal": "Neuro-Signals", "date": "2008", "authors": "Kang CB, Hong Y, Dhe-Paganon S, Yoon HS", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371497" } ], "reference": [ { "type": "PubMed", "id": "18635947", "url": "https://glygen.org/publication/PubMed/18635947" } ] }, { "title": "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.", "journal": "Molecular cell", "date": "2008", "authors": "Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M", "evidence": [ { "database": "iPTMnet", "id": "O60884", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60884" } ], "reference": [ { "type": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" } ] }, { "title": "Development of a second-generation antiandrogen for treatment of advanced prostate cancer.", "journal": "Science (New York, N.Y.)", "date": "2009", "authors": "Tran C, Ouk S, Clegg NJ, Chen Y, Watson PA, Arora V, Wongvipat J, Smith-Jones PM, Yoo D, Kwon A, Wasielewska T, Welsbie D, Chen CD, Higano CS, Beer TM, Hung DT, Scher HI, Jung ME, Sawyers CL", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371497" } ], "reference": [ { "type": "PubMed", "id": "19359544", "url": "https://glygen.org/publication/PubMed/19359544" } ] }, { "title": "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.", "journal": "Analytical chemistry", "date": "2009", "authors": "Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S", "evidence": [ { "database": "iPTMnet", "id": "O60884", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60884" } ], "reference": [ { "type": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" } ] }, { "title": "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.", "journal": "Science signaling", "date": "2009", "authors": "Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK", "evidence": [ { "database": "UniProtKB", "id": "O60884", "url": "https://www.uniprot.org/uniprot/O60884" }, { "database": "iPTMnet", "id": "O60884", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60884" } ], "reference": [ { "type": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" } ] }, { "title": "Molecular chaperones, essential partners of steroid hormone receptors for activity and mobility.", "journal": "Biochimica et biophysica acta", "date": "2010", "authors": "Echeverria PC, Picard D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371497" } ], "reference": [ { "type": "PubMed", "id": "20006655", "url": "https://glygen.org/publication/PubMed/20006655" } ] }, { "title": "The hsp90-FKBP52 complex links the mineralocorticoid receptor to motor proteins and persists bound to the receptor in early nuclear events.", "journal": "Molecular and cellular biology", "date": "2010", "authors": "Galigniana MD, Erlejman AG, Monte M, Gomez-Sanchez C, Piwien-Pilipuk G", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371497" } ], "reference": [ { "type": "PubMed", "id": "20038533", "url": "https://glygen.org/publication/PubMed/20038533" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "UniProtKB", "id": "O60884", "url": "https://www.uniprot.org/uniprot/O60884" }, { "database": "iPTMnet", "id": "O60884", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60884" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "Crystal structures of the ATPase domains of four human Hsp70 isoforms: HSPA1L/Hsp70-hom, HSPA2/Hsp70-2, HSPA6/Hsp70B', and HSPA5/BiP/GRP78.", "journal": "PloS one", "date": "2010", "authors": "Wisniewska M, Karlberg T, Lehtio L, Johansson I, Kotenyova T, Moche M, Schuler H", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371497" } ], "reference": [ { "type": "PubMed", "id": "20072699", "url": "https://glygen.org/publication/PubMed/20072699" } ] }, { "title": "Glycopeptide-specific monoclonal antibodies suggest new roles for O-GlcNAc.", "journal": "Nature chemical biology", "date": "2010", "authors": "Teo CF, Ingale S, Wolfert MA, Elsayed GA, Not LG, Chatham JC, Wells L, Boons GJ", "evidence": [ { "database": "O-GlcNAc Database", "id": "O60884", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O60884" } ], "reference": [ { "type": "PubMed", "id": "20305658", "url": "https://glygen.org/publication/PubMed/20305658" } ] }, { "title": "Therapeutic effects of anabolic androgenic steroids on chronic diseases associated with muscle wasting.", "journal": "Expert opinion on investigational drugs", "date": "2011", "authors": "Woerdeman J, de Ronde W", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371497" } ], "reference": [ { "type": "PubMed", "id": "21158691", "url": "https://glygen.org/publication/PubMed/21158691" } ] }, { "title": "N-terminal domain of human Hsp90 triggers binding to the cochaperone p23.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2011", "authors": "Karagoz GE, Duarte AM, Ippel H, Uetrecht C, Sinnige T, van Rosmalen M, Hausmann J, Heck AJ, Boelens R, Rudiger SG", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371497" } ], "reference": [ { "type": "PubMed", "id": "21183720", "url": "https://glygen.org/publication/PubMed/21183720" } ] }, { "title": "Selectivity and potency of the retroprogesterone dydrogesterone in vitro.", "journal": "Steroids", "date": "2011", "authors": "Rizner TL, Brozic P, Doucette C, Turek-Etienne T, Muller-Vieira U, Sonneveld E, van der Burg B, Bocker C, Husen B", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371497" } ], "reference": [ { "type": "PubMed", "id": "21376746", "url": "https://glygen.org/publication/PubMed/21376746" } ] }, { "title": "Client-loading conformation of the Hsp90 molecular chaperone revealed in the cryo-EM structure of the human Hsp90:Hop complex.", "journal": "Molecular cell", "date": "2011", "authors": "Southworth DR, Agard DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371497" } ], "reference": [ { "type": "PubMed", "id": "21700222", "url": "https://glygen.org/publication/PubMed/21700222" } ] }, { "title": "Combining high-energy C-trap dissociation and electron transfer dissociation for protein O-GlcNAc modification site assignment.", "journal": "Journal of proteome research", "date": "2011", "authors": "Zhao P, Viner R, Teo CF, Boons GJ, Horn D, Wells L", "evidence": [ { "database": "O-GlcNAc Database", "id": "O60884", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O60884" } ], "reference": [ { "type": "PubMed", "id": "21740066", "url": "https://glygen.org/publication/PubMed/21740066" } ] }, { "title": "Molecular mechanisms of androgen action--a historical perspective.", "journal": "Methods in molecular biology (Clifton, N.J.)", "date": "2011", "authors": "Brinkmann AO", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371497" } ], "reference": [ { "type": "PubMed", "id": "21796517", "url": "https://glygen.org/publication/PubMed/21796517" } ] }, { "title": "Heterogeneity and dynamics in the assembly of the heat shock protein 90 chaperone complexes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2011", "authors": "Ebong IO, Morgner N, Zhou M, Saraiva MA, Daturpalli S, Jackson SE, Robinson CV", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371497" } ], "reference": [ { "type": "PubMed", "id": "22011577", "url": "https://glygen.org/publication/PubMed/22011577" } ] }, { "title": "ARN-509: a novel antiandrogen for prostate cancer treatment.", "journal": "Cancer research", "date": "2012", "authors": "Clegg NJ, Wongvipat J, Joseph JD, Tran C, Ouk S, Dilhas A, Chen Y, Grillot K, Bischoff ED, Cai L, Aparicio A, Dorow S, Arora V, Shao G, Qian J, Zhao H, Yang G, Cao C, Sensintaffar J, Wasielewska T, Herbert MR, Bonnefous C, Darimont B, Scher HI, Smith-Jones P, Klang M, Smith ND, De Stanchina E, Wu N, Ouerfelli O, Rix PJ, Heyman RA, Jung ME, Sawyers CL, Hager JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371497" } ], "reference": [ { "type": "PubMed", "id": "22266222", "url": "https://glygen.org/publication/PubMed/22266222" } ] }, { "title": "Structure insights into mechanisms of ATP hydrolysis and the activation of human heat-shock protein 90.", "journal": "Acta biochimica et biophysica Sinica", "date": "2012", "authors": "Li J, Sun L, Xu C, Yu F, Zhou H, Zhao Y, Zhang J, Cai J, Mao C, Tang L, Xu Y, He J", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371497" } ], "reference": [ { "type": "PubMed", "id": "22318716", "url": "https://glygen.org/publication/PubMed/22318716" } ] }, { "title": "Allosteric modulators of steroid hormone receptors: structural dynamics and gene regulation.", "journal": "Endocrine reviews", "date": "2012", "authors": "Kumar R, McEwan IJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371497" } ], "reference": [ { "type": "PubMed", "id": "22433123", "url": "https://glygen.org/publication/PubMed/22433123" } ] }, { "title": "Discovery of BAY 94-8862: a nonsteroidal antagonist of the mineralocorticoid receptor for the treatment of cardiorenal diseases.", "journal": "ChemMedChem", "date": "2012", "authors": "Barfacker L, Kuhl A, Hillisch A, Grosser R, Figueroa-Perez S, Heckroth H, Nitsche A, Erguden JK, Gielen-Haertwig H, Schlemmer KH, Mittendorf J, Paulsen H, Platzek J, Kolkhof P", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371497" } ], "reference": [ { "type": "PubMed", "id": "22791416", "url": "https://glygen.org/publication/PubMed/22791416" } ] }, { "title": "Hsp70 chaperone dynamics and molecular mechanism.", "journal": "Trends in biochemical sciences", "date": "2013", "authors": "Mayer MP", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371497" } ], "reference": [ { "type": "PubMed", "id": "24012426", "url": "https://glygen.org/publication/PubMed/24012426" } ] }, { "title": "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.", "journal": "Journal of proteomics", "date": "2014", "authors": "Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H", "evidence": [ { "database": "UniProtKB", "id": "O60884", "url": "https://www.uniprot.org/uniprot/O60884" }, { "database": "iPTMnet", "id": "O60884", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60884" } ], "reference": [ { "type": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" } ] }, { "title": "Binding of human nucleotide exchange factors to heat shock protein 70 (Hsp70) generates functionally distinct complexes in vitro.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Rauch JN, Gestwicki JE", "evidence": [ { "database": "UniProtKB", "id": "O60884", "url": "https://www.uniprot.org/uniprot/O60884" } ], "reference": [ { "type": "PubMed", "id": "24318877", "url": "https://glygen.org/publication/PubMed/24318877" } ] }, { "title": "Molecular chaperone activity and biological regulatory actions of the TPR-domain immunophilins FKBP51 and FKBP52.", "journal": "Current protein & peptide science", "date": "2014", "authors": "Erlejman AG, Lagadari M, Harris DC, Cox MB, Galigniana MD", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371497" } ], "reference": [ { "type": "PubMed", "id": "24694367", "url": "https://glygen.org/publication/PubMed/24694367" } ] }, { "title": "Pharmacological profile of CS-3150, a novel, highly potent and selective non-steroidal mineralocorticoid receptor antagonist.", "journal": "European journal of pharmacology", "date": "2015", "authors": "Arai K, Homma T, Morikawa Y, Ubukata N, Tsuruoka H, Aoki K, Ishikawa H, Mizuno M, Sada T", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371497" } ], "reference": [ { "type": "PubMed", "id": "26073023", "url": "https://glygen.org/publication/PubMed/26073023" } ] }, { "title": "Finerenone Impedes Aldosterone-dependent Nuclear Import of the Mineralocorticoid Receptor and Prevents Genomic Recruitment of Steroid Receptor Coactivator-1.", "journal": "The Journal of biological chemistry", "date": "2015", "authors": "Amazit L, Le Billan F, Kolkhof P, Lamribet K, Viengchareun S, Fay MR, Khan JA, Hillisch A, Lombes M, Rafestin-Oblin ME, Fagart J", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371497" } ], "reference": [ { "type": "PubMed", "id": "26203193", "url": "https://glygen.org/publication/PubMed/26203193" } ] }, { "title": "ODM-201: a new-generation androgen receptor inhibitor in castration-resistant prostate cancer.", "journal": "Expert review of anticancer therapy", "date": "2015", "authors": "Fizazi K, Albiges L, Loriot Y, Massard C", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371497" } ], "reference": [ { "type": "PubMed", "id": "26313416", "url": "https://glygen.org/publication/PubMed/26313416" } ] }, { "title": "The interchange of immunophilins leads to parallel pathways and different intermediates in the assembly of Hsp90 glucocorticoid receptor complexes.", "journal": "Cell discovery", "date": "2016", "authors": "Ebong IO, Beilsten-Edmands V, Patel NA, Morgner N, Robinson CV", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371497" } ], "reference": [ { "type": "PubMed", "id": "27462449", "url": "https://glygen.org/publication/PubMed/27462449" } ] }, { "title": "Impact of androgen receptor expression in fluoxymesterone-treated estrogen receptor-positive metastatic breast cancer refractory to contemporary hormonal therapy.", "journal": "Breast cancer research and treatment", "date": "2016", "authors": "Kono M, Fujii T, Lyons GR, Huo L, Bassett R, Gong Y, Karuturi MS, Tripathy D, Ueno NT", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371497" } ], "reference": [ { "type": "PubMed", "id": "27663436", "url": "https://glygen.org/publication/PubMed/27663436" } ] }, { "title": "Population Pharmacokinetic-Pharmacodynamic Model of Oral Fludrocortisone and Intravenous Hydrocortisone in Healthy Volunteers.", "journal": "The AAPS journal", "date": "2017", "authors": "Hamitouche N, Comets E, Ribot M, Alvarez JC, Bellissant E, Laviolle B", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371497" } ], "reference": [ { "type": "PubMed", "id": "28083797", "url": "https://glygen.org/publication/PubMed/28083797" } ] }, { "title": "Androgen Receptor Function and Androgen Receptor-Targeted Therapies in Breast Cancer: A Review.", "journal": "JAMA oncology", "date": "2017", "authors": "Kono M, Fujii T, Lim B, Karuturi MS, Tripathy D, Ueno NT", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371497" } ], "reference": [ { "type": "PubMed", "id": "28301631", "url": "https://glygen.org/publication/PubMed/28301631" } ] }, { "title": "Wasting away: How to treat cachexia and muscle wasting in chronic disease?", "journal": "British journal of clinical pharmacology", "date": "2017", "authors": "von Haehling S", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371497" } ], "reference": [ { "type": "PubMed", "id": "28755533", "url": "https://glygen.org/publication/PubMed/28755533" } ] }, { "title": "Androgens and endometrium: New insights and new targets.", "journal": "Molecular and cellular endocrinology", "date": "2018", "authors": "Simitsidellis I, Saunders PTK, Gibson DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371497" } ], "reference": [ { "type": "PubMed", "id": "28919297", "url": "https://glygen.org/publication/PubMed/28919297" } ] }, { "title": "Clinical Development of Darolutamide: A Novel Androgen Receptor Antagonist for the Treatment of Prostate Cancer.", "journal": "Clinical genitourinary cancer", "date": "2018", "authors": "Fizazi K, Smith MR, Tombal B", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371497" } ], "reference": [ { "type": "PubMed", "id": "30197098", "url": "https://glygen.org/publication/PubMed/30197098" } ] }, { "title": "Androgen Deficiency and Phosphodiesterase Type 5 Expression Changes in Aging Male: Therapeutic Implications.", "journal": "Frontiers in endocrinology", "date": "2019", "authors": "Aversa A, Duca Y, Condorelli RA, Calogero AE, La Vignera S", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371497" } ], "reference": [ { "type": "PubMed", "id": "31110491", "url": "https://glygen.org/publication/PubMed/31110491" } ] }, { "title": "Cortexolone 17alpha-propionate (Clascoterone) Is a Novel Androgen Receptor Antagonist that Inhibits Production of Lipids and Inflammatory Cytokines from Sebocytes In Vitro.", "journal": "Journal of drugs in dermatology : JDD", "date": "2019", "authors": "Rosette C, Agan FJ, Mazzetti A, Moro L, Gerloni M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371497" } ], "reference": [ { "type": "PubMed", "id": "31141847", "url": "https://glygen.org/publication/PubMed/31141847" } ] }, { "title": "Hsp70 and DNAJA2 limit CFTR levels through degradation.", "journal": "PloS one", "date": "2019", "authors": "Kim Chiaw P, Hantouche C, Wong MJH, Matthes E, Robert R, Hanrahan JW, Shrier A, Young JC", "evidence": [ { "database": "RefSeq", "id": "NP_005871", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005871" } ], "reference": [ { "type": "PubMed", "id": "31408507", "url": "https://glygen.org/publication/PubMed/31408507" } ] }, { "title": "Androgens and Androgen Receptor Actions on Bone Health and Disease: From Androgen Deficiency to Androgen Therapy.", "journal": "Cells", "date": "2019", "authors": "Chen JF, Lin PW, Tsai YR, Yang YC, Kang HY", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371497" } ], "reference": [ { "type": "PubMed", "id": "31731497", "url": "https://glygen.org/publication/PubMed/31731497" } ] }, { "title": "Acquired and hereditary forms of recurrent angioedema: Update of treatment.", "journal": "Allergologie select", "date": "2018", "authors": "Bork K", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371497" } ], "reference": [ { "type": "PubMed", "id": "31826031", "url": "https://glygen.org/publication/PubMed/31826031" } ] }, { "title": "Hormonal profile of menopausal women receiving androgen replacement therapy: a meta-analysis.", "journal": "Journal of endocrinological investigation", "date": "2020", "authors": "Marina L, Sojat AS, Maseroli E, Spaggiari G, Pandurevic S, Santi D", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371497" } ], "reference": [ { "type": "PubMed", "id": "32016915", "url": "https://glygen.org/publication/PubMed/32016915" } ] }, { "title": "Efficacy and Safety of Topical Clascoterone Cream, 1%, for Treatment in Patients With Facial Acne: Two Phase 3 Randomized Clinical Trials.", "journal": "JAMA dermatology", "date": "2020", "authors": "Hebert A, Thiboutot D, Stein Gold L, Cartwright M, Gerloni M, Fragasso E, Mazzetti A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371497" } ], "reference": [ { "type": "PubMed", "id": "32320027", "url": "https://glygen.org/publication/PubMed/32320027" } ] }, { "title": "Androgen Treatment in Adolescent Males With Hypogonadism.", "journal": "American journal of men's health", "date": "2020", "authors": "Rey RA, Grinspon RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371497" } ], "reference": [ { "type": "PubMed", "id": "32448030", "url": "https://glygen.org/publication/PubMed/32448030" } ] }, { "title": "Androgens, oestrogens and endometrium: a fine balance between perfection and pathology.", "journal": "The Journal of endocrinology", "date": "2020", "authors": "Gibson DA, Simitsidellis I, Collins F, Saunders PTK", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371497" } ], "reference": [ { "type": "PubMed", "id": "32544881", "url": "https://glygen.org/publication/PubMed/32544881" } ] }, { "title": "Androgen Receptor in Breast Cancer: From Bench to Bedside.", "journal": "Frontiers in endocrinology", "date": "2020", "authors": "Chen M, Yang Y, Xu K, Li L, Huang J, Qiu F", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371497" } ], "reference": [ { "type": "PubMed", "id": "32982970", "url": "https://glygen.org/publication/PubMed/32982970" } ] }, { "title": "Proteomic profiling and genome-wide mapping of O-GlcNAc chromatin-associated proteins reveal an O-GlcNAc-regulated genotoxic stress response.", "journal": "Nature communications", "date": "2020", "authors": "Liu Y, Chen Q, Zhang N, Zhang K, Dou T, Cao Y, Liu Y, Li K, Hao X, Xie X, Li W, Ren Y, Zhang J", "evidence": [ { "database": "O-GlcNAc Database", "id": "O60884", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O60884" } ], "reference": [ { "type": "PubMed", "id": "33214551", "url": "https://glygen.org/publication/PubMed/33214551" } ] }, { "title": "Hsp40 proteins phase separate to chaperone the assembly and maintenance of membraneless organelles.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2020", "authors": "Gu J, Liu Z, Zhang S, Li Y, Xia W, Wang C, Xiang H, Liu Z, Tan L, Fang Y, Liu C, Li D", "evidence": [ { "database": "RefSeq", "id": "NP_005871", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005871" } ], "reference": [ { "type": "PubMed", "id": "33229560", "url": "https://glygen.org/publication/PubMed/33229560" } ] }, { "title": "O-GlcNAc modification regulates MTA1 transcriptional activity during breast cancer cell genotoxic adaptation.", "journal": "Biochimica et biophysica acta. General subjects", "date": "2021", "authors": "Xie X, Wu Q, Zhang K, Liu Y, Zhang N, Chen Q, Wang L, Li W, Zhang J, Liu Y", "evidence": [ { "database": "O-GlcNAc Database", "id": "O60884", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O60884" } ], "reference": [ { "type": "PubMed", "id": "34019948", "url": "https://glygen.org/publication/PubMed/34019948" } ] }, { "title": "Truncation of the TPR domain of OGT alters substrate and glycosite selection.", "journal": "Analytical and bioanalytical chemistry", "date": "2021", "authors": "Ramirez DH, Yang B, D'Souza AK, Shen D, Woo CM", "evidence": [ { "database": "O-GlcNAc Database", "id": "O60884", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O60884" } ], "reference": [ { "type": "PubMed", "id": "34725712", "url": "https://glygen.org/publication/PubMed/34725712" } ] }, { "title": "Spatiotemporal Activation of Protein O-GlcNAcylation in Living Cells.", "journal": "Journal of the American Chemical Society", "date": "2022", "authors": "He J, Fan Z, Tian Y, Yang W, Zhou Y, Zhu Q, Zhang W, Qin W, Yi W", "evidence": [ { "database": "O-GlcNAc Database", "id": "O60884", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O60884" } ], "reference": [ { "type": "PubMed", "id": "35138101", "url": "https://glygen.org/publication/PubMed/35138101" } ] }, { "title": "Extracellular arginine availability modulates eIF2\u03b1 O-GlcNAcylation and heme oxygenase 1 translation for cellular homeostasis.", "journal": "Journal of biomedical science", "date": "2023-05-22", "authors": "Hung Yu-Wen, Ouyang Ching, Ping Xiaoli, Qi Yue, Wang Yi-Chang, Kung Hsing-Jien, Ann David K", "evidence": [ { "database": "O-GlcNAc Database", "id": "O60884", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O60884" } ], "reference": [ { "type": "PubMed", "id": "37217939", "url": "https://glygen.org/publication/PubMed/37217939" } ] }, { "title": "DNAJA2 deficiency activates cGAS-STING pathway via the induction of aberrant mitosis and chromosome instability.", "journal": "Nature communications", "date": "2023-08-28", "authors": "Huang Yaping, Lu Changzheng, Wang Hanzhi, Gu Liya, Fu Yang-Xin, Li Guo-Min", "evidence": [ { "database": "RefSeq", "id": "NP_005871", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005871" } ], "reference": [ { "type": "PubMed", "id": "37640708", "url": "https://glygen.org/publication/PubMed/37640708" } ] }, { "title": "The self-association equilibrium of DNAJA2 regulates its interaction with unfolded substrate proteins and with Hsc70.", "journal": "Nature communications", "date": "2023-09-05", "authors": "Velasco-Carneros Lorea, Cu\u00e9llar Jorge, Dublang Leire, Santiago C\u00e9sar, Mar\u00e9chal Jean-Didier, Mart\u00edn-Benito Jaime, Maestro Mois\u00e9s, Fern\u00e1ndez-Higuero Jos\u00e9 \u00c1ngel, Orozco Natalia, Moro Fernando, Valpuesta Jos\u00e9 Mar\u00eda, Muga Arturo", "evidence": [ { "database": "RefSeq", "id": "NP_005871", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005871" } ], "reference": [ { "type": "PubMed", "id": "37670029", "url": "https://glygen.org/publication/PubMed/37670029" } ] }, { "title": "Binding of progestagens to receptor proteins in MCF-7 cells.", "journal": "Journal of steroid biochemistry", "date": "1983", "authors": "Bergink EW, van Meel F, Turpijn EW, van der Vies J", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371497" } ], "reference": [ { "type": "PubMed", "id": "6645495", "url": "https://glygen.org/publication/PubMed/6645495" } ] }, { "title": "Relative binding affinities of testosterone, 19-nortestosterone and their 5 alpha-reduced derivatives to the androgen receptor and to other androgen-binding proteins: a suggested role of 5 alpha-reductive steroid metabolism in the dissociation of `myotropic` and `androgenic` activities of 19-nortestosterone.", "journal": "Journal of steroid biochemistry", "date": "1982", "authors": "Toth M, Zakar T", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371497" } ], "reference": [ { "type": "PubMed", "id": "6891012", "url": "https://glygen.org/publication/PubMed/6891012" } ] }, { "title": "Impaired renal 11 beta-oxidation of 9 alpha-fluorocortisol: an explanation for its mineralocorticoid potency.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "1994", "authors": "Oelkers W, Buchen S, Diederich S, Krain J, Muhme S, Schoneshofer M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371497" } ], "reference": [ { "type": "PubMed", "id": "8157723", "url": "https://glygen.org/publication/PubMed/8157723" } ] }, { "title": "Pharmacological and functional characterization of human mineralocorticoid and glucocorticoid receptor ligands.", "journal": "European journal of pharmacology", "date": "1993", "authors": "Rupprecht R, Reul JM, van Steensel B, Spengler D, Soder M, Berning B, Holsboer F, Damm K", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371497" } ], "reference": [ { "type": "PubMed", "id": "8282004", "url": "https://glygen.org/publication/PubMed/8282004" } ] }, { "title": "The preclinical development of bicalutamide: pharmacodynamics and mechanism of action.", "journal": "Urology", "date": "1996", "authors": "Furr BJ, Tucker H", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371497" } ], "reference": [ { "type": "PubMed", "id": "8560673", "url": "https://glygen.org/publication/PubMed/8560673" } ] }, { "title": "Human CPR (cell cycle progression restoration) genes impart a Far-phenotype on yeast cells.", "journal": "Genetics", "date": "1997", "authors": "Edwards MC, Liegeois N, Horecka J, DePinho RA, Sprague GF Jr, Tyers M, Elledge SJ", "evidence": [ { "database": "UniProtKB", "id": "O60884", "url": "https://www.uniprot.org/uniprot/O60884" } ], "reference": [ { "type": "PubMed", "id": "9383053", "url": "https://glygen.org/publication/PubMed/9383053" } ] }, { "title": "5-Aryl-1,2-dihydrochromeno[3,4-f]quinolines: a novel class of nonsteroidal human progesterone receptor agonists.", "journal": "Journal of medicinal chemistry", "date": "1998", "authors": "Zhi L, Tegley CM, Kallel EA, Marschke KB, Mais DE, Gottardis MM, Jones TK", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371497" } ], "reference": [ { "type": "PubMed", "id": "9464360", "url": "https://glygen.org/publication/PubMed/9464360" } ] }, { "title": "5-Aryl-1,2-dihydro-5H-chromeno[3,4-f]quinolines as potent, orally active, nonsteroidal progesterone receptor agonists: the effect of D-ring substituents.", "journal": "Journal of medicinal chemistry", "date": "1998", "authors": "Edwards JP, West SJ, Marschke KB, Mais DE, Gottardis MM, Jones TK", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371497" } ], "reference": [ { "type": "PubMed", "id": "9464361", "url": "https://glygen.org/publication/PubMed/9464361" } ] }, { "title": "Preparation, resolution, and biological evaluation of 5-aryl-1, 2-dihydro-5H-chromeno[3,4-f]quinolines: potent, orally active, nonsteroidal progesterone receptor agonists.", "journal": "Journal of medicinal chemistry", "date": "1998", "authors": "Edwards JP, Zhi L, Pooley CL, Tegley CM, West SJ, Wang MW, Gottardis MM, Pathirana C, Schrader WT, Jones TK", "evidence": [ { "database": "Reactome", "id": "R-HSA-3371497", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371497" } ], "reference": [ { "type": "PubMed", "id": "9667968", "url": "https://glygen.org/publication/PubMed/9667968" } ] } ], "pathway": [ { "id": "hsa:10294", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:10294", "resource": "KEGG Pathway" }, { "id": "R-HSA-3371497", "name": "HSP90 chaperone cycle for steroid hormone receptors (SHR) in the presence of ligand", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3371497", "resource": "Reactome", "description": "HSP90 chaperone cycle for steroid hormone receptors (SHR) in the presence of ligand" } ], "orthologs": [ { "uniprot_canonical_ac": "O35824-1", "protein_name": "DnaJ homolog subfamily A member 2", "gene_name": "Dnaja2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MANVADTKLYDILGVPPGASENELKKAYRKLAKEYHPDKNPNAGDKFKEISFAYEVLSNPEKRELYDRYGEQGLREGSGGGGGMDDIFSHIFGGGLFGFMGNQSRSRNGRRRGEDMMHPLKVSLEDLYNGKTTKLQLSKNVLCSACSGQGGKSGAVQKCSACRGRGVRIMIRQLAPGMVQQMQSVCSDCNGEGEVINEKDRCKKCEGKKVIKEVKILEVHVDKGMKHGQRITFTGEADQAPGVEPGDIVLFVQEKEHEVFQRDGNDLHMTYKIGLVEALCGFQFTFKHLDARQIVVKYPPGKVIEPGCVRVVRGEGMPQYRNPFEKGDLYIKFDVQFPENNWINPDKLSELEDLLPSRPEVPNVIGETEEVELQEFDSTRGSGGGQRREAYNDSSDEESSSHHGPGVQCAHQ", "length": 412 }, "evidence": [ { "id": "45923630", "url": "http://www.informatics.jax.org/homology/45923630", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P25491-1", "protein_name": "Mitochondrial protein import protein MAS5", "gene_name": "YDJ1", "tax_id": 559292, "organism": "Saccharomyces cerevisiae S288C", "sequence": { "sequence": "MVKETKFYDILGVPVTATDVEIKKAYRKCALKYHPDKNPSEEAAEKFKEASAAYEILSDPEKRDIYDQFGEDGLSGAGGAGGFPGGGFGFGDDIFSQFFGAGGAQRPRGPQRGKDIKHEISASLEELYKGRTAKLALNKQILCKECEGRGGKKGAVKKCTSCNGQGIKFVTRQMGPMIQRFQTECDVCHGTGDIIDPKDRCKSCNGKKVENERKILEVHVEPGMKDGQRIVFKGEADQAPDVIPGDVVFIVSERPHKSFKRDGDDLVYEAEIDLLTAIAGGEFALEHVSGDWLKVGIVPGEVIAPGMRKVIEGKGMPIPKYGGYGNLIIKFTIKFPENHFTSEENLKKLEEILPPRIVPAIPKKATVDECVLADFDPAKYNRTRASRGGANYDSDEEEQGGEGVQCASQ", "length": 409 }, "evidence": [ { "id": "O60884", "url": "https://omabrowser.org/oma/group/O60884/", "database": "OMA" } ], "common_name": "Yeast" }, { "uniprot_canonical_ac": "Q9QYJ0-1", "protein_name": "DnaJ homolog subfamily A member 2", "gene_name": "Dnaja2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MANVADTKLYDILGVPPGASENELKKAYRKLAKEYHPDKNPNAGDKFKEISFAYEVLSNPEKRELYDRYGEQGLREGSGGGGGMDDIFSHIFGGGLFGFMGNQSRSRNGRRRGEDMMHPLKVSLEDLYNGKTTKLQLSKNVLCSACSGQGGKSGAVQKCSACRGRGVRIMIRQLAPGMVQQMQSVCSDCNGEGEVINEKDRCKKCEGKKVIKEVKILEVHVDKGMKHGQRITFTGEADQAPGVEPGDIVLLLQEKEHEVFQRDGNDLHMTYKIGLVEALCGFQFTFKHLDARQIVVKYPPGKVIEPGCVRVVRGEGMPQYRNPFEKGDLYIKFDVQFPENNWINPDKLSELEDLLPSRPEVPNVIGETEEVELQEFDSTRGSGGGQRREAYNDSSDEESSSHHGPGVQCAHQ", "length": 412 }, "evidence": [ { "id": "45923630", "url": "http://www.informatics.jax.org/homology/45923630", "database": "MGI" }, { "id": "O60884", "url": "https://omabrowser.org/oma/group/O60884/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "O60884", "url": "https://www.uniprot.org/uniprot/O60884" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "O60884", "url": "https://www.uniprot.org/uniprot/O60884" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "O60884", "url": "https://www.uniprot.org/uniprot/O60884" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "O60884", "url": "https://www.uniprot.org/uniprot/O60884" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 6, "go_terms": [ { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "O60884", "url": "https://www.uniprot.org/uniprot/O60884" } ], "pmid": "" }, { "name": "unfolded protein binding", "id": "GO:0051082", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051082", "evidence": [ { "database": "UniProtKB", "id": "O60884", "url": "https://www.uniprot.org/uniprot/O60884" } ], "pmid": "" }, { "name": "Hsp70 protein binding", "id": "GO:0030544", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030544", "evidence": [ { "database": "UniProtKB", "id": "O60884", "url": "https://www.uniprot.org/uniprot/O60884" } ], "pmid": "" }, { "name": "ATP binding", "id": "GO:0005524", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005524", "evidence": [ { "database": "UniProtKB", "id": "O60884", "url": "https://www.uniprot.org/uniprot/O60884" } ], "pmid": "" }, { "name": "protein-folding chaperone binding", "id": "GO:0051087", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051087", "evidence": [ { "database": "UniProtKB", "id": "O60884", "url": "https://www.uniprot.org/uniprot/O60884" } ], "pmid": "" }, { "name": "ATPase activator activity", "id": "GO:0001671", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001671", "evidence": [ { "database": "UniProtKB", "id": "O60884", "url": "https://www.uniprot.org/uniprot/O60884" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "protein folding", "id": "GO:0006457", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006457", "evidence": [ { "database": "UniProtKB", "id": "O60884", "url": "https://www.uniprot.org/uniprot/O60884" } ], "pmid": "" }, { "name": "positive regulation of cell population proliferation", "id": "GO:0008284", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008284", "evidence": [ { "database": "UniProtKB", "id": "O60884", "url": "https://www.uniprot.org/uniprot/O60884" } ], "pmid": "" }, { "name": "response to heat", "id": "GO:0009408", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009408", "evidence": [ { "database": "UniProtKB", "id": "O60884", "url": "https://www.uniprot.org/uniprot/O60884" } ], "pmid": "" }, { "name": "protein refolding", "id": "GO:0042026", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042026", "evidence": [ { "database": "UniProtKB", "id": "O60884", "url": "https://www.uniprot.org/uniprot/O60884" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 102, "end_pos": 104, "annotation": "n_glycosylation_sequon" }, { "start_pos": 392, "end_pos": 394, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [ 78, 123, 144, 147, 368, 382, 391, 394, 395 ], "sequon_annotation_sites": [ { "start_pos": 102, "end_pos": 104 }, { "start_pos": 392, "end_pos": 394 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 9 }, { "field": "total_sites", "count": 9 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 83 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }