{ "uniprot_canonical_ac": "O60825-1", "uniprot_ac": "O60825", "uniprot_id": "F262_HUMAN", "mass": { "chemical_mass": 58477.0, "monoisotopic_mass": 58477.0 }, "refseq": { "ac": "NP_001018063", "name": "6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase 2 isoform b", "summary": "The protein encoded by this gene is involved in both the synthesis and degradation of fructose-2,6-bisphosphate, a regulatory molecule that controls glycolysis in eukaryotes. The encoded protein has a 6-phosphofructo-2-kinase activity that catalyzes the synthesis of fructose-2,6-bisphosphate, and a fructose-2,6-biphosphatase activity that catalyzes the degradation of fructose-2,6-bisphosphate. This protein regulates fructose-2,6-bisphosphate levels in the heart, while a related enzyme encoded by a different gene regulates fructose-2,6-bisphosphate levels in the liver and muscle. This enzyme functions as a homodimer. Two transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001018063" }, "gene_names": [ { "name": "PFKFB2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O60825", "id": "O60825" }, { "name": "PFK-2/FBPase-2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001018063", "id": "NP_001018063" }, { "name": "PFKFB2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001018063", "id": "NP_001018063" } ], "protein_names": [ { "name": "6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O60825" }, { "name": "6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase 2 isoform b", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001018063", "id": "NP_001018063" }, { "name": "6PF-2-K/Fru-2,6-P2ase 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O60825" }, { "name": "6PF-2-K/Fru-2,6-P2ase heart-type isozyme", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O60825" }, { "name": "PFK/FBPase 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O60825" }, { "name": "PFKFB, cardiac; 6PF-2-K/Fru-2,6-P2ASE heart-type isozyme; fructose-2,6-bisphosphatase, cardiac isozyme; 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2; PFK/FBPase 2; 6PF-2-K/Fru-2,6-P2ase 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001018063", "id": "NP_001018063" } ], "function": [ { "annotation": "Knockdown circZNF131 Inhibits Cell Progression and Glycolysis in Gastric Cancer Through miR-186-5p/PFKFB2 Axis.", "evidence": [ { "database": "RefSeq", "id": "NP_001018063", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001018063" }, { "database": "PubMed", "id": "35059934", "url": "https://glygen.org/publication/PubMed/35059934" } ] }, { "annotation": "MiR-21-5p inhibits the growth of brain glioma cells through regulating the glycolysis mediated by PFKFB2. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001018063", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001018063" }, { "database": "PubMed", "id": "37864733", "url": "https://glygen.org/publication/PubMed/37864733" } ] }, { "annotation": "PFKFB2 is a favorable prognostic biomarker for colorectal cancer by suppressing metastasis and tumor glycolysis.", "evidence": [ { "database": "RefSeq", "id": "NP_001018063", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001018063" }, { "database": "PubMed", "id": "37311985", "url": "https://glygen.org/publication/PubMed/37311985" } ] }, { "annotation": "PFKFB2 regulates glycolysis and proliferation in pancreatic cancer cells.", "evidence": [ { "database": "RefSeq", "id": "NP_001018063", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001018063" }, { "database": "PubMed", "id": "32415418", "url": "https://glygen.org/publication/PubMed/32415418" } ] }, { "annotation": "Synthesis and degradation of fructose 2,6-bisphosphate.", "evidence": [ { "database": "UniProtKB", "id": "O60825", "url": "https://www.uniprot.org/uniprot/O60825#function" }, { "database": "PubMed", "id": "11069105", "url": "https://glygen.org/publication/PubMed/11069105" } ] }, { "annotation": "The protein encoded by this gene is involved in both the synthesis and degradation of fructose-2,6-bisphosphate, a regulatory molecule that controls glycolysis in eukaryotes. The encoded protein has a 6-phosphofructo-2-kinase activity that catalyzes the synthesis of fructose-2,6-bisphosphate, and a fructose-2,6-biphosphatase activity that catalyzes the degradation of fructose-2,6-bisphosphate. This protein regulates fructose-2,6-bisphosphate levels in the heart, while a related enzyme encoded by a different gene regulates fructose-2,6-bisphosphate levels in the liver and muscle. This enzyme functions as a homodimer. Two transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_001018063", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001018063" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs1253911170", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1253911170" }, { "id": "rs1253911170", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1253911170" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 12, "end_pos": 12, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NNN->NNS).", "chr_id": "1", "chr_pos": "207054752", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N12", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1381561045", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1381561045" }, { "id": "rs1381561045", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1381561045" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 16, "end_pos": 16, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (TKT->NKT).", "chr_id": "1", "chr_pos": "207054764", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T16", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O60825", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O60825" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 187, "end_pos": 187, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "M", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NVM->NVT).", "chr_id": "1", "chr_pos": "207065088", "ref_nt": "T", "alt_nt": "C", "minor_allelic_frequency": "", "site_lbl": "M187", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs749172793", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749172793" }, { "id": "rs749172793", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749172793" }, { "id": "rs749172793", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs749172793" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 222, "end_pos": 222, "sequence_org": "G", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NVG->NVS).", "chr_id": "1", "chr_pos": "207067530", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "G222", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1226884383", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1226884383" }, { "id": "rs1226884383", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1226884383#frequency_tab" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 390, "end_pos": 390, "sequence_org": "S", "sequence_mut": "C", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->C).", "chr_id": "1", "chr_pos": "207070356", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S390", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1233263364", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1233263364" }, { "id": "rs1233263364", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1233263364#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 453, "end_pos": 453, "sequence_org": "F", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NNF->NNS).", "chr_id": "1", "chr_pos": "207072211", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "F453", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs776811345", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776811345" }, { "id": "rs776811345", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776811345" }, { "id": "rs776811345", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs776811345#frequency_tab" }, { "id": "rs776811345", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs776811345" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 471, "end_pos": 471, "sequence_org": "S", "sequence_mut": "C", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->C).", "chr_id": "1", "chr_pos": "207072265", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S471", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs765728026", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765728026" }, { "id": "rs765728026", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765728026" }, { "id": "rs765728026", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs765728026" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 472, "end_pos": 472, "sequence_org": "S", "sequence_mut": "G", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->G).", "chr_id": "1", "chr_pos": "207072267", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S472", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs151137785", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs151137785" }, { "id": "rs151137785", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs151137785" }, { "id": "rs151137785", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs151137785#frequency_tab" }, { "id": "rs151137785", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs151137785" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 472, "end_pos": 472, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->N).", "chr_id": "1", "chr_pos": "207072268", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S472", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [ { "start_pos": 466, "end_pos": 466, "sequence_org": "S", "sequence_mut": "E", "comment": "Constitutively active mutant that cannot be phosphorylated and further activated by AMPK.", "evidence": [ { "database": "UniProtKB", "id": "O60825", "url": "https://www.uniprot.org/uniprot/O60825" }, { "database": "PubMed", "id": "11069105", "url": "https://glygen.org/publication/PubMed/11069105" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "82.68", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000123836", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000123836" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "73.34", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000123836", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000123836" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "70.69", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000123836", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000123836" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "49.96", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000123836", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000123836" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "78.69", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000123836", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000123836" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "93.23", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000123836", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000123836" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "47.76", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000123836", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000123836" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "71.84", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000123836", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000123836" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "93.43", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000123836", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000123836" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "47.6", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000123836", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000123836" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "73.08", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000123836", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000123836" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "74.76", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000123836", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000123836" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "76.71", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000123836", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000123836" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O60825", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60825" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O60825", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60825" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O60825", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60825" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O60825", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60825" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O60825", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60825" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O60825", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60825" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O60825", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60825" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O60825", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60825" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O60825", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60825" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O60825", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60825" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O60825", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60825" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O60825", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60825" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O60825", "url": "https://www.uniprot.org/uniprot/O60825" } ], "common_name": "Human" } ], "gene": [ { "name": "PFKFB2", "url": "https://www.uniprot.org/uniprot/O60825", "locus": { "chromosome": "1", "start_pos": 207081024, "end_pos": 207034366, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000123836", "url": "https://www.ensembl.org/id/ENSG00000123836" } ] } } ], "crossref": [ { "id": "ENSG00000123836", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000123836", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "O60825", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O60825", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "2.7.1.105", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.7.1.105&UniProtAcc=O60825", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "3.1.3.46", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=3.1.3.46&UniProtAcc=O60825", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "cd07067", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd07067", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL3421525", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL3421525", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "PFKFB2", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=PFKFB2", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "5208", "url": "https://www.ncbi.nlm.nih.gov/gene/5208", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "8873", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=8873", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O60825", "url": "https://www.ebi.ac.uk/intact/interactors/id:O60825*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001345", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001345", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003094", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003094", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013078", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013078", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013079", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013079", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR027417", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027417", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029033", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029033", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:5208", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:5208", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "171835", "url": "http://www.omim.org/entry/171835", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O60825", "url": "https://www.nextprot.org/entry/NX_O60825", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "O60825", "url": "https://oglcnac.org/atlas/detail/O60825", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "O60825", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O60825", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "IACMNGR", "url": "https://omabrowser.org/oma/group/IACMNGR/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2013830at2759", "url": "http://www.orthodb.org/?query=2013830at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10606", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10606", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10606:SF48", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10606:SF48", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "5HTK", "url": "https://www.rcsb.org/structure/5HTK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00300", "url": "http://pfam.xfam.org/family/PF00300", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF01591", "url": "http://pfam.xfam.org/family/PF01591", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O60825", "url": "https://pharos.nih.gov/targets/O60825", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O60825", "url": "http://purl.obolibrary.org/obo/PR_O60825", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-9634600", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634600", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001018063", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001018063", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "15653", "url": "https://www.rhea-db.org/rhea/15653", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "17289", "url": "https://www.rhea-db.org/rhea/17289", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "A0A087X278", "url": "https://www.uniprot.org/uniprot/A0A087X278", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A087X278-1", "url": "https://www.uniprot.org/uniprot/A0A087X278-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A087X2H4", "url": "https://www.uniprot.org/uniprot/A0A087X2H4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A087X2H4-1", "url": "https://www.uniprot.org/uniprot/A0A087X2H4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F6RAZ1", "url": "https://www.uniprot.org/uniprot/F6RAZ1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F6RAZ1-1", "url": "https://www.uniprot.org/uniprot/F6RAZ1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F6XNB3", "url": "https://www.uniprot.org/uniprot/F6XNB3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F6XNB3-1", "url": "https://www.uniprot.org/uniprot/F6XNB3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O60825", "url": "https://www.uniprot.org/uniprot/O60825", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O60825-1", "url": "https://www.uniprot.org/uniprot/O60825-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O60825-2", "url": "https://www.uniprot.org/uniprot/O60825-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSGASSSEQNNNSYETKTPNLRMSEKKCSWASYMTNSPTLIVMIGLPARGKTYVSKKLTRYLNWIGVPTKVFNLGVYRREAVKSYKSYDFFRHDNEEAMKIRKQCALVALEDVKAYLTEENGQIAVFDATNTTRERRDMILNFAEQNSFKVFFVESVCDDPDVIAANILEVKVSSPDYPERNRENVMEDFLKRIECYKVTYRPLDPDNYDKDLSFIKVINVGQRFLVNRVQDYIQSKIVYYLMNIHVQPRTIYLCRHGESEFNLLGKIGGDSGLSVRGKQFAQALRKFLEEQEITDLKVWTSQLKRTIQTAESLGVPYEQWKILNEIDAGVCEEMTYAEIEKRYPEEFALRDQEKYLYRYPGGESYQDLVQRLEPVIMELERQGNVLVISHQAVMRCLLAYFLDKGADELPYLRCPLHTIFKLTPVAYGCKVETIKLNVEAVNTHRDKPTNNFPKNQTPVRMRRNSFTPLSSSNTIRRPRNYSVGSRPLKPLSPLRAQDMQEGAD", "length": 505, "header": "sp|O60825-1|F262_HUMAN Isoform 1 of 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Homo sapiens OX=9606 GN=PFKFB2 PE=1 SV=2 CANONICAL=O60825-1" }, "isoforms": [ { "isoform_ac": "A0A087X278-1", "url": "", "sequence": { "sequence": "MSGASSSEQNNNSYETKTPNLRMSEKKCCWSAVTGSWLTATLNS", "length": 44, "header": "tr|A0A087X278-1|A0A087X278_HUMAN Computationally mapped isoform of 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2 OS=Homo sapiens OX=9606 GN=PFKFB2 PE=1 SV=1 CANONICAL=O60825-1" }, "locus": { "chromosome": "1", "start_pos": 207060892, "end_pos": 207054718, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000464777.5", "url": "https://www.ensembl.org/id/ENST00000464777.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000484769.1", "url": "https://www.ensembl.org/id/ENSP00000484769.1" } ] } }, { "isoform_ac": "A0A087X2H4-1", "url": "", "sequence": { "sequence": "MSGASSSEQNNNSYETKTPNLRMSEKKCSWASYMTNSPTLIVMIGLPAR", "length": 49, "header": "tr|A0A087X2H4-1|F262_HUMAN Computationally mapped isoform of 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Homo sapiens OX=9606 GN=PFKFB2 PE=1 SV=1 CANONICAL=O60825-1" }, "locus": { "chromosome": "1", "start_pos": 207062014, "end_pos": 207054718, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000618513.4", "url": "https://www.ensembl.org/id/ENST00000618513.4" }, { "database": "Ensembl Peptide", "id": "ENSP00000484988.1", "url": "https://www.ensembl.org/id/ENSP00000484988.1" } ] } }, { "isoform_ac": "F6RAZ1-1", "url": "", "sequence": { "sequence": "MSGASSSEQNNNSYETKTPNLRMSEKKCSWASYMTNSPTLIVMIGLPARGKTYVSKKLTRYLNWIGVPTKVFNLGVYRREAVKSYKSYDFFRHDNEEAMKIRKQCALVALEDVKAYLTEENGQIA", "length": 125, "header": "tr|F6RAZ1-1|F6RAZ1_HUMAN Computationally mapped isoform of 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2 OS=Homo sapiens OX=9606 GN=PFKFB2 PE=1 SV=1 CANONICAL=O60825-1" }, "locus": { "chromosome": "1", "start_pos": 207063209, "end_pos": 207054718, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000545806.5", "url": "https://www.ensembl.org/id/ENST00000545806.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000439420.2", "url": "https://www.ensembl.org/id/ENSP00000439420.2" } ] } }, { "isoform_ac": "F6XNB3-1", "url": "", "sequence": { "sequence": "MSGASSSEQNNNSYETKTPNLRMSEKKCSWASYMTNSPTLIVMIGLPARGKTYVSKKLTRYLNWIGVPTKGQETSPIWWGHHIILLLKDLGVFYSV", "length": 96, "header": "tr|F6XNB3-1|F6XNB3_HUMAN Computationally mapped isoform of 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 2 OS=Homo sapiens OX=9606 GN=PFKFB2 PE=1 SV=1 CANONICAL=O60825-1" }, "locus": { "chromosome": "1", "start_pos": 207062623, "end_pos": 207054718, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000411990.6", "url": "https://www.ensembl.org/id/ENST00000411990.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000408717.3", "url": "https://www.ensembl.org/id/ENSP00000408717.3" } ] } }, { "isoform_ac": "O60825-1", "url": "", "sequence": { "sequence": "MSGASSSEQNNNSYETKTPNLRMSEKKCSWASYMTNSPTLIVMIGLPARGKTYVSKKLTRYLNWIGVPTKVFNLGVYRREAVKSYKSYDFFRHDNEEAMKIRKQCALVALEDVKAYLTEENGQIAVFDATNTTRERRDMILNFAEQNSFKVFFVESVCDDPDVIAANILEVKVSSPDYPERNRENVMEDFLKRIECYKVTYRPLDPDNYDKDLSFIKVINVGQRFLVNRVQDYIQSKIVYYLMNIHVQPRTIYLCRHGESEFNLLGKIGGDSGLSVRGKQFAQALRKFLEEQEITDLKVWTSQLKRTIQTAESLGVPYEQWKILNEIDAGVCEEMTYAEIEKRYPEEFALRDQEKYLYRYPGGESYQDLVQRLEPVIMELERQGNVLVISHQAVMRCLLAYFLDKGADELPYLRCPLHTIFKLTPVAYGCKVETIKLNVEAVNTHRDKPTNNFPKNQTPVRMRRNSFTPLSSSNTIRRPRNYSVGSRPLKPLSPLRAQDMQEGAD", "length": 505, "header": "sp|O60825-1|F262_HUMAN Isoform 1 of 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Homo sapiens OX=9606 GN=PFKFB2 PE=1 SV=2 CANONICAL=O60825-1" }, "locus": { "chromosome": "1", "start_pos": 207072368, "end_pos": 207054718, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000367080.8", "url": "https://www.ensembl.org/id/ENST00000367080.8" }, { "database": "Ensembl Peptide", "id": "ENSP00000356047.3", "url": "https://www.ensembl.org/id/ENSP00000356047.3" } ] } }, { "isoform_ac": "O60825-2", "url": "", "sequence": { "sequence": "MSGASSSEQNNNSYETKTPNLRMSEKKCSWASYMTNSPTLIVMIGLPARGKTYVSKKLTRYLNWIGVPTKVFNLGVYRREAVKSYKSYDFFRHDNEEAMKIRKQCALVALEDVKAYLTEENGQIAVFDATNTTRERRDMILNFAEQNSFKVFFVESVCDDPDVIAANILEVKVSSPDYPERNRENVMEDFLKRIECYKVTYRPLDPDNYDKDLSFIKVINVGQRFLVNRVQDYIQSKIVYYLMNIHVQPRTIYLCRHGESEFNLLGKIGGDSGLSVRGKQFAQALRKFLEEQEITDLKVWTSQLKRTIQTAESLGVPYEQWKILNEIDAGVCEEMTYAEIEKRYPEEFALRDQEKYLYRYPGGESYQDLVQRLEPVIMELERQGNVLVISHQAVMRCLLAYFLDKGADELPYLRCPLHTIFKLTPVAYGCKVETIKLNVEAVNTHRDKPTAAETTLAVRRRPSAASLMLPC", "length": 471, "header": "sp|O60825-2|F262_HUMAN Isoform 2 of 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Homo sapiens OX=9606 GN=PFKFB2 PE=1 SV=2 CANONICAL=O60825-1" }, "locus": { "chromosome": "1", "start_pos": 207079016, "end_pos": 207054718, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000367079.3", "url": "https://www.ensembl.org/id/ENST00000367079.3" }, { "database": "Ensembl Peptide", "id": "ENSP00000356046.2", "url": "https://www.ensembl.org/id/ENSP00000356046.2" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 390, "start_aa": "Ser", "end_pos": 390, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser390", "evidence": [ { "id": "O60825", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O60825" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 471, "start_aa": "Ser", "end_pos": 471, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser471", "evidence": [ { "id": "O60825", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O60825" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 472, "start_aa": "Ser", "end_pos": 472, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser472", "evidence": [ { "id": "O60825", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O60825" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" }, { "id": "38253038", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/38253038" }, { "id": "O60825", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O60825" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 475, "start_aa": "Thr", "end_pos": 475, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr475", "evidence": [ { "id": "O60825", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O60825" }, { "id": "31373491", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31373491" } ] } ], "phosphorylation": [ { "start_pos": 29, "end_pos": 29, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by PKA", "evidence": [ { "database": "UniProtKB", "id": "O60825", "url": "https://www.uniprot.org/uniprot/O60825" }, { "database": "iPTMnet", "id": "O60825", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60825" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser29" }, { "start_pos": 32, "end_pos": 32, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O60825", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60825" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser32" }, { "start_pos": 466, "end_pos": 466, "kinase_uniprot_canonical_ac": "P17612-1", "kinase_gene_name": "PRKACA", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O60825", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60825" }, { "database": "PubMed", "id": "12853467", "url": "https://glygen.org/publication/PubMed/12853467" }, { "database": "PubMed", "id": "17924679", "url": "https://glygen.org/publication/PubMed/17924679" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "18767875", "url": "https://glygen.org/publication/PubMed/18767875" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser466" }, { "start_pos": 466, "end_pos": 466, "kinase_uniprot_canonical_ac": "P23443-1", "kinase_gene_name": "RPS6KB1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O60825", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60825" }, { "database": "PubMed", "id": "2846551", "url": "https://glygen.org/publication/PubMed/2846551" }, { "database": "PubMed", "id": "9211863", "url": "https://glygen.org/publication/PubMed/9211863" } ], "site_lbl": "Ser466" }, { "start_pos": 466, "end_pos": 466, "kinase_uniprot_canonical_ac": "P31749-1", "kinase_gene_name": "AKT1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O60825", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60825" }, { "database": "PubMed", "id": "12853467", "url": "https://glygen.org/publication/PubMed/12853467" }, { "database": "PubMed", "id": "17924679", "url": "https://glygen.org/publication/PubMed/17924679" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "18767875", "url": "https://glygen.org/publication/PubMed/18767875" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "10521487", "url": "https://glygen.org/publication/PubMed/10521487" } ], "site_lbl": "Ser466" }, { "start_pos": 466, "end_pos": 466, "kinase_uniprot_canonical_ac": "P51812-1", "kinase_gene_name": "RPS6KA3", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O60825", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60825" }, { "database": "PubMed", "id": "2846551", "url": "https://glygen.org/publication/PubMed/2846551" }, { "database": "PubMed", "id": "9211863", "url": "https://glygen.org/publication/PubMed/9211863" } ], "site_lbl": "Ser466" }, { "start_pos": 466, "end_pos": 466, "kinase_uniprot_canonical_ac": "P54646-1", "kinase_gene_name": "PRKAA2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O60825", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60825" }, { "database": "PubMed", "id": "12853467", "url": "https://glygen.org/publication/PubMed/12853467" }, { "database": "PubMed", "id": "17924679", "url": "https://glygen.org/publication/PubMed/17924679" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "18767875", "url": "https://glygen.org/publication/PubMed/18767875" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "11069105", "url": "https://glygen.org/publication/PubMed/11069105" } ], "site_lbl": "Ser466" }, { "start_pos": 466, "end_pos": 466, "kinase_uniprot_canonical_ac": "Q13131-1", "kinase_gene_name": "PRKAA1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O60825", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60825" }, { "database": "PubMed", "id": "12853467", "url": "https://glygen.org/publication/PubMed/12853467" }, { "database": "PubMed", "id": "17924679", "url": "https://glygen.org/publication/PubMed/17924679" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "18767875", "url": "https://glygen.org/publication/PubMed/18767875" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "11069105", "url": "https://glygen.org/publication/PubMed/11069105" } ], "site_lbl": "Ser466" }, { "start_pos": 466, "end_pos": 466, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by AMPK", "evidence": [ { "database": "UniProtKB", "id": "O60825", "url": "https://www.uniprot.org/uniprot/O60825" }, { "database": "phospho.ELM", "id": "O60825", "url": "http://phospho.elm.eu.org/byAccession/O60825.html" }, { "database": "iPTMnet", "id": "O60825", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60825" }, { "database": "PubMed", "id": "12853467", "url": "https://glygen.org/publication/PubMed/12853467" }, { "database": "PubMed", "id": "18220336", "url": "https://glygen.org/publication/PubMed/18220336" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20958264", "url": "https://glygen.org/publication/PubMed/20958264" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "36402789", "url": "https://glygen.org/publication/PubMed/36402789" }, { "database": "PubMed", "id": "11069105", "url": "https://glygen.org/publication/PubMed/11069105" } ], "site_lbl": "Ser466" }, { "start_pos": 468, "end_pos": 468, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "O60825", "url": "https://www.uniprot.org/uniprot/O60825" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "36402789", "url": "https://glygen.org/publication/PubMed/36402789" }, { "database": "iPTMnet", "id": "O60825", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60825" }, { "database": "PubMed", "id": "18767875", "url": "https://glygen.org/publication/PubMed/18767875" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "O60825", "url": "http://phospho.elm.eu.org/byAccession/O60825.html" }, { "database": "PubMed", "id": "18220336", "url": "https://glygen.org/publication/PubMed/18220336" } ], "site_lbl": "Thr468" }, { "start_pos": 471, "end_pos": 471, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O60825", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60825" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "phospho.ELM", "id": "O60825", "url": "http://phospho.elm.eu.org/byAccession/O60825.html" } ], "site_lbl": "Ser471" }, { "start_pos": 475, "end_pos": 475, "kinase_uniprot_canonical_ac": "P17252-1", "kinase_gene_name": "PRKCA", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O60825", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60825" }, { "database": "PubMed", "id": "1322130", "url": "https://glygen.org/publication/PubMed/1322130" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ], "site_lbl": "Thr475" }, { "start_pos": 475, "end_pos": 475, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "O60825", "url": "https://www.uniprot.org/uniprot/O60825" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "phospho.ELM", "id": "O60825", "url": "http://phospho.elm.eu.org/byAccession/O60825.html" }, { "database": "iPTMnet", "id": "O60825", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60825" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ], "site_lbl": "Thr475" }, { "start_pos": 483, "end_pos": 483, "kinase_uniprot_canonical_ac": "P31749-1", "kinase_gene_name": "AKT1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O60825", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60825" }, { "database": "PubMed", "id": "12853467", "url": "https://glygen.org/publication/PubMed/12853467" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23457334", "url": "https://glygen.org/publication/PubMed/23457334" } ], "site_lbl": "Ser483" }, { "start_pos": 483, "end_pos": 483, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by BRAF", "evidence": [ { "database": "UniProtKB", "id": "O60825", "url": "https://www.uniprot.org/uniprot/O60825" }, { "database": "iPTMnet", "id": "O60825", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60825" }, { "database": "PubMed", "id": "12853467", "url": "https://glygen.org/publication/PubMed/12853467" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "O60825", "url": "http://phospho.elm.eu.org/byAccession/O60825.html" }, { "database": "PubMed", "id": "20958264", "url": "https://glygen.org/publication/PubMed/20958264" }, { "database": "PubMed", "id": "23457334", "url": "https://glygen.org/publication/PubMed/23457334" }, { "database": "PubMed", "id": "29221144", "url": "https://glygen.org/publication/PubMed/29221144" }, { "database": "PubMed", "id": "30819197", "url": "https://glygen.org/publication/PubMed/30819197" }, { "database": "PubMed", "id": "36402789", "url": "https://glygen.org/publication/PubMed/36402789" } ], "site_lbl": "Ser483" }, { "start_pos": 486, "end_pos": 486, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O60825", "url": "https://www.uniprot.org/uniprot/O60825" }, { "database": "PubMed", "id": "36402789", "url": "https://glygen.org/publication/PubMed/36402789" }, { "database": "iPTMnet", "id": "O60825", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60825" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "phospho.ELM", "id": "O60825", "url": "http://phospho.elm.eu.org/byAccession/O60825.html" } ], "site_lbl": "Ser486" }, { "start_pos": 493, "end_pos": 493, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O60825", "url": "https://www.uniprot.org/uniprot/O60825" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "36402789", "url": "https://glygen.org/publication/PubMed/36402789" }, { "database": "iPTMnet", "id": "O60825", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60825" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "phospho.ELM", "id": "O60825", "url": "http://phospho.elm.eu.org/byAccession/O60825.html" } ], "site_lbl": "Ser493" } ], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Cloning, expression and chromosomal localization of a human testis 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase gene.", "journal": "Gene", "date": "1999", "authors": "Manzano A, Perez JX, Nadal M, Estivill X, Lange A, Bartrons R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634600", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634600" } ], "reference": [ { "type": "PubMed", "id": "10095107", "url": "https://glygen.org/publication/PubMed/10095107" } ] }, { "title": "Heart 6-phosphofructo-2-kinase activation by insulin results from Ser-466 and Ser-483 phosphorylation and requires 3-phosphoinositide-dependent kinase-1, but not protein kinase B.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Bertrand L, Alessi DR, Deprez J, Deak M, Viaene E, Rider MH, Hue L", "evidence": [ { "database": "iPTMnet", "id": "O60825", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60825" } ], "reference": [ { "type": "PubMed", "id": "10521487", "url": "https://glygen.org/publication/PubMed/10521487" } ] }, { "title": "Phosphorylation and activation of heart PFK-2 by AMPK has a role in the stimulation of glycolysis during ischaemia.", "journal": "Current biology : CB", "date": "2000", "authors": "Marsin AS, Bertrand L, Rider MH, Deprez J, Beauloye C, Vincent MF, Van den Berghe G, Carling D, Hue L", "evidence": [ { "database": "UniProtKB", "id": "O60825", "url": "https://www.uniprot.org/uniprot/O60825" }, { "database": "iPTMnet", "id": "O60825", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60825" } ], "reference": [ { "type": "PubMed", "id": "11069105", "url": "https://glygen.org/publication/PubMed/11069105" } ] }, { "title": "Isolation of novel heart-specific genes using the BodyMap database.", "journal": "Genomics", "date": "2001", "authors": "Soejima H, Kawamoto S, Akai J, Miyoshi O, Arai Y, Morohka T, Matsuo S, Niikawa N, Kimura A, Okubo K, Mukai T", "evidence": [ { "database": "UniProtKB", "id": "O60825", "url": "https://www.uniprot.org/uniprot/O60825" } ], "reference": [ { "type": "PubMed", "id": "11374908", "url": "https://glygen.org/publication/PubMed/11374908" } ] }, { "title": "14-3-3s regulate fructose-2,6-bisphosphate levels by binding to PKB-phosphorylated cardiac fructose-2,6-bisphosphate kinase/phosphatase.", "journal": "The EMBO journal", "date": "2003", "authors": "Pozuelo Rubio M, Peggie M, Wong BH, Morrice N, MacKintosh C", "evidence": [ { "database": "iPTMnet", "id": "O60825-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60825-1" } ], "reference": [ { "type": "PubMed", "id": "12853467", "url": "https://glygen.org/publication/PubMed/12853467" } ] }, { "title": "The two forms of bovine heart 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase result from alternative splicing.", "journal": "The Biochemical journal", "date": "1992", "authors": "Rider MH, Vandamme J, Lebeau E, Vertommen D, Vidal H, Rousseau GG, Vandekerckhove J, Hue L", "evidence": [ { "database": "iPTMnet", "id": "O60825-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60825-1" } ], "reference": [ { "type": "PubMed", "id": "1322130", "url": "https://glygen.org/publication/PubMed/1322130" } ] }, { "title": "The kinase activity of human brain 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase is regulated via inhibition by phosphoenolpyruvate.", "journal": "Archives of biochemistry and biophysics", "date": "2005", "authors": "Manes NP, El-Maghrabi MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634600", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634600" } ], "reference": [ { "type": "PubMed", "id": "15896703", "url": "https://glygen.org/publication/PubMed/15896703" } ] }, { "title": "Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.", "journal": "Journal of proteome research", "date": "2007", "authors": "Yu LR, Zhu Z, Chan KC, Issaq HJ, Dimitrov DS, Veenstra TD", "evidence": [ { "database": "iPTMnet", "id": "O60825-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60825-1" } ], "reference": [ { "type": "PubMed", "id": "17924679", "url": "https://glygen.org/publication/PubMed/17924679" } ] }, { "title": "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.", "journal": "Journal of proteome research", "date": "2008", "authors": "Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd", "evidence": [ { "database": "iPTMnet", "id": "O60825", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60825" } ], "reference": [ { "type": "PubMed", "id": "18220336", "url": "https://glygen.org/publication/PubMed/18220336" } ] }, { "title": "A quantitative atlas of mitotic phosphorylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "O60825", "url": "https://www.uniprot.org/uniprot/O60825" }, { "database": "iPTMnet", "id": "O60825-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60825-1" } ], "reference": [ { "type": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ] }, { "title": "Successive and selective release of phosphorylated peptides captured by hydroxy acid-modified metal oxide chromatography.", "journal": "Journal of proteome research", "date": "2008", "authors": "Kyono Y, Sugiyama N, Imami K, Tomita M, Ishihama Y", "evidence": [ { "database": "iPTMnet", "id": "O60825-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60825-1" } ], "reference": [ { "type": "PubMed", "id": "18767875", "url": "https://glygen.org/publication/PubMed/18767875" } ] }, { "title": "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.", "journal": "Analytical chemistry", "date": "2009", "authors": "Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S", "evidence": [ { "database": "iPTMnet", "id": "O60825-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60825-1" } ], "reference": [ { "type": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" } ] }, { "title": "Global effects of kinase inhibitors on signaling networks revealed by quantitative phosphoproteomics.", "journal": "Molecular & cellular proteomics : MCP", "date": "2009", "authors": "Pan C, Olsen JV, Daub H, Mann M", "evidence": [ { "database": "iPTMnet", "id": "O60825-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60825-1" } ], "reference": [ { "type": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "UniProtKB", "id": "O60825", "url": "https://www.uniprot.org/uniprot/O60825" }, { "database": "iPTMnet", "id": "O60825-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60825-1" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "Androgen stimulates glycolysis for de novo lipid synthesis by increasing the activities of hexokinase 2 and 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 in prostate cancer cells.", "journal": "The Biochemical journal", "date": "2011", "authors": "Moon JS, Jin WJ, Kwak JH, Kim HJ, Yun MJ, Kim JW, Park SW, Kim KS", "evidence": [ { "database": "iPTMnet", "id": "O60825", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60825" } ], "reference": [ { "type": "PubMed", "id": "20958264", "url": "https://glygen.org/publication/PubMed/20958264" } ] }, { "title": "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.", "journal": "Science signaling", "date": "2011", "authors": "Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B", "evidence": [ { "database": "iPTMnet", "id": "O60825", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60825" } ], "reference": [ { "type": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "O60825", "url": "https://www.uniprot.org/uniprot/O60825" }, { "database": "iPTMnet", "id": "O60825", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60825" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "Akt-dependent activation of the heart 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase (PFKFB2) isoenzyme by amino acids.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Novellasdemunt L, Tato I, Navarro-Sabate A, Ruiz-Meana M, Mendez-Lucas A, Perales JC, Garcia-Dorado D, Ventura F, Bartrons R, Rosa JL", "evidence": [ { "database": "iPTMnet", "id": "O60825", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60825" } ], "reference": [ { "type": "PubMed", "id": "23457334", "url": "https://glygen.org/publication/PubMed/23457334" } ] }, { "title": "Molecular cloning, sequence analysis, and expression of a human liver cDNA coding for fructose-6-P,2-kinase:fructose-2,6-bisphosphatase.", "journal": "Biochemical and biophysical research communications", "date": "1988", "authors": "Algaier J, Uyeda K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634600", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634600" } ], "reference": [ { "type": "PubMed", "id": "2837207", "url": "https://glygen.org/publication/PubMed/2837207" } ] }, { "title": "Phosphorylation of myocardial fructose-6-phosphate,2-kinase: fructose-2,6-bisphosphatase by cAMP-dependent protein kinase and protein kinase C. Activation by phosphorylation and amino acid sequences of the phosphorylation sites.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Kitamura K, Kangawa K, Matsuo H, Uyeda K", "evidence": [ { "database": "iPTMnet", "id": "O60825", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60825" } ], "reference": [ { "type": "PubMed", "id": "2846551", "url": "https://glygen.org/publication/PubMed/2846551" } ] }, { "title": "UCP2 overexpression enhanced glycolysis via activation of PFKFB2 during skin cell transformation.", "journal": "Oncotarget", "date": "2017", "authors": "Sreedhar A, Petruska P, Miriyala S, Panchatcharam M, Zhao Y", "evidence": [ { "database": "iPTMnet", "id": "O60825", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60825" } ], "reference": [ { "type": "PubMed", "id": "29221144", "url": "https://glygen.org/publication/PubMed/29221144" } ] }, { "title": "Hormonal regulation of hepatic gluconeogenesis and glycolysis.", "journal": "Annual review of biochemistry", "date": "1988", "authors": "Pilkis SJ, el-Maghrabi MR, Claus TH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634600", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634600" } ], "reference": [ { "type": "PubMed", "id": "3052289", "url": "https://glygen.org/publication/PubMed/3052289" } ] }, { "title": "Increased expression and phosphorylation of 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase isoforms in urinary exosomes in pre-eclampsia.", "journal": "Journal of translational medicine", "date": "2019", "authors": "Ellis R, Katerelos M, Choy SW, Cook N, Lee M, Paizis K, Pell G, Walker S, Power DA, Mount PF", "evidence": [ { "database": "iPTMnet", "id": "O60825", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60825" } ], "reference": [ { "type": "PubMed", "id": "30819197", "url": "https://glygen.org/publication/PubMed/30819197" } ] }, { "title": "Aspartate Residues Far from the Active Site Drive O-GlcNAc Transferase Substrate Selection.", "journal": "Journal of the American Chemical Society", "date": "2019", "authors": "Joiner CM, Levine ZG, Aonbangkhen C, Woo CM, Walker S", "evidence": [ { "database": "O-GlcNAc Database", "id": "O60825", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O60825" }, { "database": "O-GlcNAc Atlas", "id": "O60825", "url": "https://oglcnac.org/atlas/detail/O60825" } ], "reference": [ { "type": "PubMed", "id": "31373491", "url": "https://glygen.org/publication/PubMed/31373491" } ] }, { "title": "PFKFB2 regulates glycolysis and proliferation in pancreatic cancer cells.", "journal": "Molecular and cellular biochemistry", "date": "2020", "authors": "Ozcan SC, Sarioglu A, Altunok TH, Akkoc A, Guzel S, Guler S, Imbert-Fernandez Y, Muchut RJ, Iglesias AA, Gurpinar Y, Clem AL, Chesney JA, Yalcin A", "evidence": [ { "database": "RefSeq", "id": "NP_001018063", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001018063" } ], "reference": [ { "type": "PubMed", "id": "32415418", "url": "https://glygen.org/publication/PubMed/32415418" } ] }, { "title": "Knockdown circZNF131 Inhibits Cell Progression and Glycolysis in Gastric Cancer Through miR-186-5p/PFKFB2 Axis.", "journal": "Biochemical genetics", "date": "2022", "authors": "Shen X, Zhu X, Hu P, Ji T, Qin Y, Zhu J", "evidence": [ { "database": "RefSeq", "id": "NP_001018063", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001018063" } ], "reference": [ { "type": "PubMed", "id": "35059934", "url": "https://glygen.org/publication/PubMed/35059934" } ] }, { "title": "BRAF activation by metabolic stress promotes glycolysis sensitizing NRASQ61-mutated melanomas to targeted therapy.", "journal": "Nature communications", "date": "2022-11-19", "authors": "McGrail Kimberley, Granado-Mart\u00ednez Paula, Esteve-Puig Rosaura, Garc\u00eda-Ortega Sara, Ding Yuxin, S\u00e1nchez-Redondo Sara, Ferrer Berta, Hernandez-Losa Javier, Canals Francesc, Manzano Anna, Navarro-Sabat\u00e9 Aura, Bartrons Ram\u00f3n, Yanes Oscar, P\u00e9rez-Alea Mileidys, Mu\u00f1oz-Couselo Eva, Garcia-Patos Vicen\u00e7, Recio Juan A", "evidence": [ { "database": "UniProtKB", "id": "O60825", "url": "https://www.uniprot.org/uniprot/O60825" }, { "database": "iPTMnet", "id": "O60825", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60825" } ], "reference": [ { "type": "PubMed", "id": "36402789", "url": "https://glygen.org/publication/PubMed/36402789" } ] }, { "title": "PFKFB2 is a favorable prognostic biomarker for colorectal cancer by suppressing metastasis and tumor glycolysis.", "journal": "Journal of cancer research and clinical oncology", "date": "2023-09", "authors": "Liu Furong, Wei Xiaoli, Chen Zhanhong, Chen Yanxing, Hu Peishan, Jin Ying", "evidence": [ { "database": "RefSeq", "id": "NP_001018063", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001018063" } ], "reference": [ { "type": "PubMed", "id": "37311985", "url": "https://glygen.org/publication/PubMed/37311985" } ] }, { "title": "miR-21-5p inhibits the growth of brain glioma cells through regulating the glycolysis mediated by PFKFB2.", "journal": "Functional & integrative genomics", "date": "2023-10-21", "authors": "Zhang Lei, Liu Jianmin", "evidence": [ { "database": "RefSeq", "id": "NP_001018063", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001018063" } ], "reference": [ { "type": "PubMed", "id": "37864733", "url": "https://glygen.org/publication/PubMed/37864733" } ] }, { "title": "Studying the O-GlcNAcome of human placentas using banked tissue samples.", "journal": "Glycobiology", "date": "2024-01-22", "authors": "Luna Sarai, Malard Florian, Pereckas Michaela, Aoki Mayumi, Aoki Kazahiro, Olivier-Van Stichelen Stephanie", "evidence": [ { "database": "O-GlcNAc Database", "id": "O60825", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O60825" } ], "reference": [ { "type": "PubMed", "id": "38253038", "url": "https://glygen.org/publication/PubMed/38253038" } ] }, { "title": "6-Phosphofructo-2-kinase/fructose-2,6-bisphosphatase: a metabolic signaling enzyme.", "journal": "Annual review of biochemistry", "date": "1995", "authors": "Pilkis SJ, Claus TH, Kurland IJ, Lange AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634600", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634600" } ], "reference": [ { "type": "PubMed", "id": "7574501", "url": "https://glygen.org/publication/PubMed/7574501" } ] }, { "title": "Phosphorylation and activation of heart 6-phosphofructo-2-kinase by protein kinase B and other protein kinases of the insulin signaling cascades.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Deprez J, Vertommen D, Alessi DR, Hue L, Rider MH", "evidence": [ { "database": "iPTMnet", "id": "O60825", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60825" } ], "reference": [ { "type": "PubMed", "id": "9211863", "url": "https://glygen.org/publication/PubMed/9211863" } ] }, { "title": "Expression of human placental-type 6-phosphofructo-2-kinase/fructose 2,6-bisphosphatase in various cells and cell lines.", "journal": "Biochemical and biophysical research communications", "date": "1998", "authors": "Hirata T, Kato M, Okamura N, Fukasawa M, Sakakibara R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634600", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634600" } ], "reference": [ { "type": "PubMed", "id": "9464277", "url": "https://glygen.org/publication/PubMed/9464277" } ] }, { "title": "Sequence and structure of the human 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase heart isoform gene (PFKFB2).", "journal": "Eur. J. Biochem.", "date": "1998", "authors": "Heine-Su\u00f1er D, D\u00edaz-Guill\u00e9n M A, Lange A J, Rodr\u00edguez de C\u00f3rdoba S", "evidence": [ { "database": "UniProtKB", "id": "O60825", "url": "https://www.uniprot.org/uniprot/O60825" } ], "reference": [ { "type": "PubMed", "id": "9652401", "url": "https://glygen.org/publication/PubMed/9652401" } ] } ], "pathway": [ { "id": "hsa:5208", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:5208", "resource": "KEGG Pathway" }, { "id": "R-HSA-9634600", "name": "Regulation of glycolysis by fructose 2,6-bisphosphate metabolism", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634600", "resource": "Reactome", "description": "Regulation of glycolysis by fructose 2,6-bisphosphate metabolism" } ], "orthologs": [ { "uniprot_canonical_ac": "P32604-1", "protein_name": "Fructose-2,6-bisphosphatase", "gene_name": "FBP26", "tax_id": 559292, "organism": "Saccharomyces cerevisiae S288C", "sequence": { "sequence": "MGYSTISNDNDIKVCVIMVGLPARGKSFISQKIIRYLSWLSIKAKCFNVGNYRRDVSGNVPMDAEFFNFENTDNFKLRELAAQNAIKDIVNFFTKEDGSVAVFDATNSTRKRRKWLKDICEKNNIQPMFLESWSNDHELIINNAKDIGSTSPDYENSEPHVAEADFLERIRQYERFYEPLDPQKDKDMTFIKLVNIIEEVVINKIRTYLESRIVFYVMNIRPKPKYIWLSRHGESIYNVEKKIGGDSSLSERGFQYAKKLEQLVKESAGEINLTVWTSTLKRTQQTANYLPYKKLQWKALDELDAGVCDGMTYEEIEKEYPEDFKARDNDKYEYRYRGGESYRDVVIRLEPVIMELERQENVLIITHQAVLRCIYAYFMNVPQEESPWMSIPLHTLIKLEPRAYGTKVTKIKANIPAVSTYKEKGTSQVGELSQSSTKLHQLLNDSPLEDKF", "length": 452 }, "evidence": [ { "id": "O60825", "url": "https://omabrowser.org/oma/group/O60825/", "database": "OMA" } ], "common_name": "Yeast" }, { "uniprot_canonical_ac": "P70265-1", "protein_name": "6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2", "gene_name": "Pfkfb2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSENSTFSTEDSCNSSYKPHASNLRRAGKTCSWASYMTNSPTLIVMIGLPARGKTYVSKKLTRYLNWIGVPTKVFNLGVYRREAVKSYQSYDFFRHDNEEAMKIRKQCALVALEDVKAYFTEESGQIAVFDATNTTRERRDMILNFAKQNAFKVFFVESVCDDPDVIAANILEVKVSSPDYPERNRENVMEDFLKRIECYKVTYQPLDPDNYDKDLSFIKVMNVGQRFLVNRVQDYIQSKIVYYLMNIHVHPRTIYLCRHGESEFNLLGKIGGDSGLSVRGKQFAHALKKFLEEQEIQDLKVWTSQLKRTIQTAESLGVTYEQWKILNEIDAGVCEEMTYSEIEQRYPEEFALRDQEKYLYRYPGGESYQDLVQRLEPVIMELERQGNILVISHQAVMRCLLAYFLDKGADELPYLRCPLHIIFKLTPVAYGCKVETITLNVDAVDTHRDKPTHNFPKSQTPVRMRRNSFTPLSSSNTIRRPRNYSVGSRPLKPLSPLRALDMQEGADQPKTQVSIPVV", "length": 519 }, "evidence": [ { "id": "45923987", "url": "http://www.informatics.jax.org/homology/45923987", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9JJH5-1", "protein_name": "6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2", "gene_name": "Pfkfb2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MSENSTFSTEDSSSSSYKPHASNLRRAGKKCSWASYMTNSPTLIVMIGLPARGKTYVSKKLTRYLNWIGVPTKVFNLGVYRREAVKSYKSYDFFRHDNEEAMKIRKQCALVALEDVKAYFTEESGQIAVFDATNTTRERRDMILNFAKQNAFKVFFVESVCDDPDVIAANILEVKVSSPDYPERNRENVMEDFLKRIECYKVTYQPLDPDNYDKDLSFIKVMNVGQRFLVNRVQDYIQSKIVYYLMNIHVHPRTIYLCRHGESEFNLLGKIGGDSGLSLRGKQFAQALKKFLEEQEIQDLKVWTSQLKRTIQTAESLGVTYEQWKILNEIDAGVCEEMTYSEIEQRYPEEFALRDQEKYLYRYPGGESYQDLVQRLEPVIMELERQGNVLVISHQAVMRCLLAYFLDKGADELPYLRCPLHIIFKLTPVAYGCKVETITLNVEAVDTHRDKPTHNFPKSQTPVRMRRNSFTPLSSSNTIRRPRNYSVGSRPLKPLSPLRALDMQEGADQPKTQVQQGSAQATEHLQKALEFANGHREVENVLAKHRRPSMASLTLLS", "length": 557 }, "evidence": [ { "id": "45923987", "url": "http://www.informatics.jax.org/homology/45923987", "database": "MGI" }, { "id": "O60825", "url": "https://omabrowser.org/oma/group/O60825/", "database": "OMA" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "ATP binding", "id": "GO:0005524", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005524", "evidence": [ { "database": "UniProtKB", "id": "O60825", "url": "https://www.uniprot.org/uniprot/O60825" } ], "pmid": "" }, { "name": "6-phosphofructo-2-kinase activity", "id": "GO:0003873", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003873", "evidence": [ { "database": "UniProtKB", "id": "O60825", "url": "https://www.uniprot.org/uniprot/O60825" } ], "pmid": "" }, { "name": "fructose-2,6-bisphosphate 2-phosphatase activity", "id": "GO:0004331", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004331", "evidence": [ { "database": "UniProtKB", "id": "O60825", "url": "https://www.uniprot.org/uniprot/O60825" } ], "pmid": "" }, { "name": "protein kinase binding", "id": "GO:0019901", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019901", "evidence": [ { "database": "UniProtKB", "id": "O60825", "url": "https://www.uniprot.org/uniprot/O60825" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 7, "go_terms": [ { "name": "fructose metabolic process", "id": "GO:0006000", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006000", "evidence": [ { "database": "UniProtKB", "id": "O60825", "url": "https://www.uniprot.org/uniprot/O60825" } ], "pmid": "" }, { "name": "fructose 2,6-bisphosphate metabolic process", "id": "GO:0006003", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006003", "evidence": [ { "database": "UniProtKB", "id": "O60825", "url": "https://www.uniprot.org/uniprot/O60825" } ], "pmid": "" }, { "name": "positive regulation of insulin secretion", "id": "GO:0032024", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032024", "evidence": [ { "database": "UniProtKB", "id": "O60825", "url": "https://www.uniprot.org/uniprot/O60825" } ], "pmid": "" }, { "name": "response to glucose", "id": "GO:0009749", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009749", "evidence": [ { "database": "UniProtKB", "id": "O60825", "url": "https://www.uniprot.org/uniprot/O60825" } ], "pmid": "" }, { "name": "glycolytic process", "id": "GO:0006096", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006096", "evidence": [ { "database": "UniProtKB", "id": "O60825", "url": "https://www.uniprot.org/uniprot/O60825" } ], "pmid": "" }, { "name": "glucose catabolic process", "id": "GO:0006007", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006007", "evidence": [ { "database": "UniProtKB", "id": "O60825", "url": "https://www.uniprot.org/uniprot/O60825" } ], "pmid": "" }, { "name": "lactate metabolic process", "id": "GO:0006089", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006089", "evidence": [ { "database": "UniProtKB", "id": "O60825", "url": "https://www.uniprot.org/uniprot/O60825" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "O60825", "url": "https://www.uniprot.org/uniprot/O60825" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "O60825", "url": "https://www.uniprot.org/uniprot/O60825" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 11, "end_pos": 13, "annotation": "n_glycosylation_sequon" }, { "start_pos": 131, "end_pos": 133, "annotation": "n_glycosylation_sequon" }, { "start_pos": 456, "end_pos": 458, "annotation": "n_glycosylation_sequon" }, { "start_pos": 481, "end_pos": 483, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Phosphorylation by AMPK stimulates activity.", "evidence": [ { "database": "UniProtKB", "id": "O60825", "url": "https://www.uniprot.org/uniprot/O60825" }, { "database": "PubMed", "id": "11069105", "url": "https://glygen.org/publication/PubMed/11069105" } ] } ], "interactions": [], "reactions": [ { "id": "15653", "name": "", "equation": "ATP + beta-D-fructose 6-phosphate = ADP + beta-D-fructose 2,6-bisphosphate + H(+)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O35552-1", "P07953-1", "P25114-1", "Q9JJH5-1", "Q16877-1", "P16118-1", "O60825-1", "Q16875-1", "Q6DTY7-1", "P70266-1", "P70265-1", "P40433-1", "Q06137-1", "Q12471-1" ], "evidence": [ { "id": "15653", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/15653" } ] }, { "id": "17289", "name": "", "equation": "beta-D-fructose 2,6-bisphosphate + H2O = beta-D-fructose 6-phosphate + phosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O35552-1", "P07953-1", "P25114-1", "Q9JJH5-1", "A0A0G2K8S8-1", "Q16877-1", "P16118-1", "O60825-1", "Q16875-1", "Q9NQ88-1", "Q6DTY7-1", "P70266-1", "P70265-1", "Q8BZA9-1", "P32604-1", "Q06137-1" ], "evidence": [ { "id": "17289", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/17289" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "A0A0G2K8S8", "gene_name": "Tigar", "activity": [ { "ec_number": "3.1.3.46", "activity": "beta-D-fructose 2,6-bisphosphate + H2O = beta-D-fructose 6-phosphate + phosphate.", "evidence": [ { "id": "A0A0G2K8S8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K8S8" } ] }, { "ec_number": "3.1.3.46", "activity": "", "evidence": [ { "id": "A0A0G2K8S8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K8S8" } ] } ] }, { "uniprot_ac": "O35552", "gene_name": "Pfkfb3", "activity": [ { "ec_number": "2.7.1.105", "activity": "ATP + beta-D-fructose 6-phosphate = ADP + beta-D-fructose 2,6-bisphosphate + H(+).", "evidence": [ { "id": "O35552", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35552" } ] }, { "ec_number": "3.1.3.46", "activity": "beta-D-fructose 2,6-bisphosphate + H2O = beta-D-fructose 6-phosphate + phosphate.", "evidence": [ { "id": "O35552", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35552" } ] } ] }, { "uniprot_ac": "O60825", "gene_name": "PFKFB2", "activity": [ { "ec_number": "2.7.1.105", "activity": "ATP + beta-D-fructose 6-phosphate = ADP + beta-D-fructose 2,6-bisphosphate + H(+).", "evidence": [ { "id": "O60825", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60825" } ] }, { "ec_number": "3.1.3.46", "activity": "beta-D-fructose 2,6-bisphosphate + H2O = beta-D-fructose 6-phosphate + phosphate.", "evidence": [ { "id": "O60825", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60825" } ] } ] }, { "uniprot_ac": "P07953", "gene_name": "Pfkfb1", "activity": [ { "ec_number": "2.7.1.105", "activity": "ATP + beta-D-fructose 6-phosphate = ADP + beta-D-fructose 2,6-bisphosphate + H(+).", "evidence": [ { "id": "P07953", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07953" } ] }, { "ec_number": "3.1.3.46", "activity": "beta-D-fructose 2,6-bisphosphate + H2O = beta-D-fructose 6-phosphate + phosphate.", "evidence": [ { "id": "P07953", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07953" } ] } ] }, { "uniprot_ac": "P16118", "gene_name": "PFKFB1", "activity": [ { "ec_number": "2.7.1.105", "activity": "ATP + beta-D-fructose 6-phosphate = ADP + beta-D-fructose 2,6-bisphosphate + H(+).", "evidence": [ { "id": "P16118", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16118" } ] }, { "ec_number": "3.1.3.46", "activity": "beta-D-fructose 2,6-bisphosphate + H2O = beta-D-fructose 6-phosphate + phosphate.", "evidence": [ { "id": "P16118", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16118" } ] } ] }, { "uniprot_ac": "P25114", "gene_name": "Pfkfb4", "activity": [ { "ec_number": "2.7.1.105", "activity": "ATP + beta-D-fructose 6-phosphate = ADP + beta-D-fructose 2,6-bisphosphate + H(+).", "evidence": [ { "id": "P25114", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25114" } ] }, { "ec_number": "3.1.3.46", "activity": "beta-D-fructose 2,6-bisphosphate + H2O = beta-D-fructose 6-phosphate + phosphate.", "evidence": [ { "id": "P25114", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25114" } ] } ] }, { "uniprot_ac": "P32604", "gene_name": "FBP26", "activity": [ { "ec_number": "3.1.3.46", "activity": "beta-D-fructose 2,6-bisphosphate + H2O = beta-D-fructose 6-phosphate + phosphate.", "evidence": [ { "id": "P32604", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32604" } ] }, { "ec_number": "3.1.3.46", "activity": "", "evidence": [ { "id": "P32604", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32604" } ] } ] }, { "uniprot_ac": "P40433", "gene_name": "PFK26", "activity": [ { "ec_number": "2.7.1.105", "activity": "ATP + beta-D-fructose 6-phosphate = ADP + beta-D-fructose 2,6-bisphosphate + H(+).", "evidence": [ { "id": "P40433", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40433" } ] }, { "ec_number": "2.7.1.105", "activity": "", "evidence": [ { "id": "P40433", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P40433" } ] } ] }, { "uniprot_ac": "P70265", "gene_name": "Pfkfb2", "activity": [ { "ec_number": "2.7.1.105", "activity": "ATP + beta-D-fructose 6-phosphate = ADP + beta-D-fructose 2,6-bisphosphate + H(+).", "evidence": [ { "id": "P70265", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70265" } ] }, { "ec_number": "3.1.3.46", "activity": "beta-D-fructose 2,6-bisphosphate + H2O = beta-D-fructose 6-phosphate + phosphate.", "evidence": [ { "id": "P70265", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70265" } ] }, { "ec_number": "2.7.1.105", "activity": "", "evidence": [ { "id": "P70265", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70265" } ] }, { "ec_number": "3.1.3.46", "activity": "", "evidence": [ { "id": "P70265", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70265" } ] } ] }, { "uniprot_ac": "P70266", "gene_name": "Pfkfb1", "activity": [ { "ec_number": "2.7.1.105", "activity": "ATP + beta-D-fructose 6-phosphate = ADP + beta-D-fructose 2,6-bisphosphate + H(+).", "evidence": [ { "id": "P70266", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70266" } ] }, { "ec_number": "3.1.3.46", "activity": "beta-D-fructose 2,6-bisphosphate + H2O = beta-D-fructose 6-phosphate + phosphate.", "evidence": [ { "id": "P70266", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70266" } ] } ] }, { "uniprot_ac": "Q06137", "gene_name": "", "activity": [ { "ec_number": "2.7.1.105", "activity": "ATP + beta-D-fructose 6-phosphate = ADP + beta-D-fructose 2,6-bisphosphate + H(+).", "evidence": [ { "id": "Q06137", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q06137" } ] }, { "ec_number": "3.1.3.46", "activity": "beta-D-fructose 2,6-bisphosphate + H2O = beta-D-fructose 6-phosphate + phosphate.", "evidence": [ { "id": "Q06137", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q06137" } ] } ] }, { "uniprot_ac": "Q12471", "gene_name": "PFK27", "activity": [ { "ec_number": "2.7.1.105", "activity": "ATP + beta-D-fructose 6-phosphate = ADP + beta-D-fructose 2,6-bisphosphate + H(+).", "evidence": [ { "id": "Q12471", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12471" } ] }, { "ec_number": "2.7.1.105", "activity": "", "evidence": [ { "id": "Q12471", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12471" } ] } ] }, { "uniprot_ac": "Q16875", "gene_name": "PFKFB3", "activity": [ { "ec_number": "2.7.1.105", "activity": "ATP + beta-D-fructose 6-phosphate = ADP + beta-D-fructose 2,6-bisphosphate + H(+).", "evidence": [ { "id": "Q16875", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16875" } ] }, { "ec_number": "3.1.3.46", "activity": "beta-D-fructose 2,6-bisphosphate + H2O = beta-D-fructose 6-phosphate + phosphate.", "evidence": [ { "id": "Q16875", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16875" } ] } ] }, { "uniprot_ac": "Q16877", "gene_name": "PFKFB4", "activity": [ { "ec_number": "2.7.1.105", "activity": "ATP + beta-D-fructose 6-phosphate = ADP + beta-D-fructose 2,6-bisphosphate + H(+).", "evidence": [ { "id": "Q16877", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16877" } ] }, { "ec_number": "3.1.3.46", "activity": "beta-D-fructose 2,6-bisphosphate + H2O = beta-D-fructose 6-phosphate + phosphate.", "evidence": [ { "id": "Q16877", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q16877" } ] } ] }, { "uniprot_ac": "Q6DTY7", "gene_name": "Pfkfb4", "activity": [ { "ec_number": "2.7.1.105", "activity": "ATP + beta-D-fructose 6-phosphate = ADP + beta-D-fructose 2,6-bisphosphate + H(+).", "evidence": [ { "id": "Q6DTY7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6DTY7" } ] }, { "ec_number": "3.1.3.46", "activity": "beta-D-fructose 2,6-bisphosphate + H2O = beta-D-fructose 6-phosphate + phosphate.", "evidence": [ { "id": "Q6DTY7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6DTY7" } ] } ] }, { "uniprot_ac": "Q8BZA9", "gene_name": "Tigar", "activity": [ { "ec_number": "3.1.3.46", "activity": "beta-D-fructose 2,6-bisphosphate + H2O = beta-D-fructose 6-phosphate + phosphate.", "evidence": [ { "id": "Q8BZA9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BZA9" } ] }, { "ec_number": "3.1.3.46", "activity": "", "evidence": [ { "id": "Q8BZA9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BZA9" } ] } ] }, { "uniprot_ac": "Q9JJH5", "gene_name": "Pfkfb2", "activity": [ { "ec_number": "2.7.1.105", "activity": "ATP + beta-D-fructose 6-phosphate = ADP + beta-D-fructose 2,6-bisphosphate + H(+).", "evidence": [ { "id": "Q9JJH5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JJH5" } ] }, { "ec_number": "3.1.3.46", "activity": "beta-D-fructose 2,6-bisphosphate + H2O = beta-D-fructose 6-phosphate + phosphate.", "evidence": [ { "id": "Q9JJH5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JJH5" } ] }, { "ec_number": "2.7.1.105", "activity": "", "evidence": [ { "id": "Q9JJH5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JJH5" } ] }, { "ec_number": "3.1.3.46", "activity": "", "evidence": [ { "id": "Q9JJH5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JJH5" } ] } ] }, { "uniprot_ac": "Q9NQ88", "gene_name": "TIGAR", "activity": [ { "ec_number": "3.1.3.46", "activity": "beta-D-fructose 2,6-bisphosphate + H2O = beta-D-fructose 6-phosphate + phosphate.", "evidence": [ { "id": "Q9NQ88", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NQ88" } ] }, { "ec_number": "3.1.3.46", "activity": "", "evidence": [ { "id": "Q9NQ88", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NQ88" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 390, 471, 472, 475 ], "snv_sites": [ 12, 16, 187, 222, 390, 453, 471, 472 ], "glycation_sites": [], "phosphorylation_sites": [ 29, 32, 466, 468, 471, 475, 483, 486, 493 ], "sequon_annotation_sites": [ { "start_pos": 11, "end_pos": 13 }, { "start_pos": 131, "end_pos": 133 }, { "start_pos": 456, "end_pos": 458 }, { "start_pos": 481, "end_pos": 483 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 4 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 4 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 17 }, { "field": "total_sites", "count": 9 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 9 }, { "field": "total_sites", "count": 8 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 7 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 34 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }