{ "uniprot_canonical_ac": "O60678-1", "uniprot_ac": "O60678", "uniprot_id": "ANM3_HUMAN", "mass": { "chemical_mass": 59903.0, "monoisotopic_mass": 59903.0 }, "refseq": { "ac": "NP_005779", "name": "protein arginine N-methyltransferase 3 isoform 1", "summary": "This gene belongs to the protein arginine methyltransferase (PRMT) family. The encoded enzyme catalyzes the methylation of guanidino nitrogens of arginyl residues of proteins. The enzyme acts on 40S ribosomal protein S2 (rpS2), which is its major in-vivo substrate, and is involved in the proper maturation of the 80S ribosome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005779" }, "gene_names": [ { "name": "PRMT3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O60678", "id": "O60678" }, { "name": "HRMT1L3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005779", "id": "NP_005779" }, { "name": "HRMT1L3", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O60678", "id": "O60678" }, { "name": "PRMT3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005779", "id": "NP_005779" } ], "protein_names": [ { "name": "Protein arginine N-methyltransferase 3", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O60678" }, { "name": "2.1.1.319", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O60678" }, { "name": "Heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O60678" }, { "name": "protein arginine N-methyltransferase 3 isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005779", "id": "NP_005779" }, { "name": "protein arginine N-methyltransferase 3; heterogeneous nuclear ribonucleoprotein methyltransferase-like protein 3; HMT1 hnRNP methyltransferase-like 3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005779", "id": "NP_005779" } ], "function": [ { "annotation": "DAL-1/4.1B protein significantly inhibits PRMT3 methylation of cellular substrates, which may affect mechanism through which DAL-1/4.1B affects tumor cell growth.", "evidence": [ { "database": "RefSeq", "id": "NP_005779", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005779" }, { "database": "PubMed", "id": "15334060", "url": "https://glygen.org/publication/PubMed/15334060" } ] }, { "annotation": "Decreased nitric oxide content mediated by asymmetrical dimethylarginine and protein l-arginine methyltransferase 3 in macrophages induces trophoblast apoptosis: a potential cause of recurrent miscarriage.", "evidence": [ { "database": "RefSeq", "id": "NP_005779", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005779" }, { "database": "PubMed", "id": "34647126", "url": "https://glygen.org/publication/PubMed/34647126" } ] }, { "annotation": "PRMT3 is a ribosomal protein methyltransferase that affects the cellular level of ribosomal subunits.", "evidence": [ { "database": "RefSeq", "id": "NP_005779", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005779" }, { "database": "PubMed", "id": "15175657", "url": "https://glygen.org/publication/PubMed/15175657" } ] }, { "annotation": "PRMT3 regulates the progression of invasive micropapillary carcinoma of the breast.", "evidence": [ { "database": "RefSeq", "id": "NP_005779", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005779" }, { "database": "PubMed", "id": "36637351", "url": "https://glygen.org/publication/PubMed/36637351" } ] }, { "annotation": "PRMT3-Mediated Arginine Methylation of METTL14 Promotes Malignant Progression and Treatment Resistance in Endometrial Carcinoma.", "evidence": [ { "database": "RefSeq", "id": "NP_005779", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005779" }, { "database": "PubMed", "id": "37973560", "url": "https://glygen.org/publication/PubMed/37973560" } ] }, { "annotation": "PRMT3-mediated arginine methylation of IGF2BP1 promotes oxaliplatin resistance in liver cancer. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_005779", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005779" }, { "database": "PubMed", "id": "37024475", "url": "https://glygen.org/publication/PubMed/37024475" } ] }, { "annotation": "Protein arginine methyltransferase 3: A crucial regulator in metabolic reprogramming and gene expression in cancers. Review article", "evidence": [ { "database": "RefSeq", "id": "NP_005779", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005779" }, { "database": "PubMed", "id": "36400311", "url": "https://glygen.org/publication/PubMed/36400311" } ] }, { "annotation": "Protein-arginine N-methyltransferase that catalyzes both the monomethylation and asymmetric dimethylation of the guanidino nitrogens of arginine residues in target proteins, and therefore falls into the group of type I methyltransferases (Probable). May regulate retinoic acid synthesis and signaling by inhibiting ALDH1A1 retinal dehydrogenase activity (PubMed:33495566).", "evidence": [ { "database": "UniProtKB", "id": "O60678", "url": "https://www.uniprot.org/uniprot/O60678#function" }, { "database": "PubMed", "id": "33495566", "url": "https://glygen.org/publication/PubMed/33495566" } ] }, { "annotation": "This gene belongs to the protein arginine methyltransferase (PRMT) family. The encoded enzyme catalyzes the methylation of guanidino nitrogens of arginyl residues of proteins. The enzyme acts on 40S ribosomal protein S2 (rpS2), which is its major in-vivo substrate, and is involved in the proper maturation of the 80S ribosome. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013].", "evidence": [ { "database": "RefSeq", "id": "NP_005779", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005779" } ] } ], "disease": [], "snv": [], "mutagenesis": [ { "start_pos": 338, "end_pos": 338, "sequence_org": "E", "sequence_mut": "Q", "comment": "No effect on ALDH1A1 activity regulation.", "evidence": [ { "database": "UniProtKB", "id": "O60678", "url": "https://www.uniprot.org/uniprot/O60678" }, { "database": "PubMed", "id": "33495566", "url": "https://glygen.org/publication/PubMed/33495566" } ] }, { "start_pos": 464, "end_pos": 464, "sequence_org": "H", "sequence_mut": "A", "comment": "Loss of interaction with ALDH1A1.", "evidence": [ { "database": "UniProtKB", "id": "O60678", "url": "https://www.uniprot.org/uniprot/O60678" }, { "database": "PubMed", "id": "33495566", "url": "https://glygen.org/publication/PubMed/33495566" } ] }, { "start_pos": 465, "end_pos": 465, "sequence_org": "N", "sequence_mut": "A", "comment": "Loss of interaction with ALDH1A1.", "evidence": [ { "database": "UniProtKB", "id": "O60678", "url": "https://www.uniprot.org/uniprot/O60678" }, { "database": "PubMed", "id": "33495566", "url": "https://glygen.org/publication/PubMed/33495566" } ] }, { "start_pos": 466, "end_pos": 466, "sequence_org": "R", "sequence_mut": "A", "comment": "Loss of interaction with ALDH1A1.", "evidence": [ { "database": "UniProtKB", "id": "O60678", "url": "https://www.uniprot.org/uniprot/O60678" }, { "database": "PubMed", "id": "33495566", "url": "https://glygen.org/publication/PubMed/33495566" } ] }, { "start_pos": 468, "end_pos": 468, "sequence_org": "V", "sequence_mut": "A", "comment": "Loss of interaction with ALDH1A1.", "evidence": [ { "database": "UniProtKB", "id": "O60678", "url": "https://www.uniprot.org/uniprot/O60678" }, { "database": "PubMed", "id": "33495566", "url": "https://glygen.org/publication/PubMed/33495566" } ] }, { "start_pos": 87, "end_pos": 87, "sequence_org": "Y", "sequence_mut": "C", "comment": "Markedly reduced affinity for RPS2.", "evidence": [ { "database": "UniProtKB", "id": "O60678", "url": "https://www.uniprot.org/uniprot/O60678" }, { "database": "PubMed", "id": "21059412", "url": "https://glygen.org/publication/PubMed/21059412" } ] }, { "start_pos": 87, "end_pos": 87, "sequence_org": "Y", "sequence_mut": "E", "comment": "Markedly reduced affinity for RPS2.", "evidence": [ { "database": "UniProtKB", "id": "O60678", "url": "https://www.uniprot.org/uniprot/O60678" }, { "database": "PubMed", "id": "21059412", "url": "https://glygen.org/publication/PubMed/21059412" } ] }, { "start_pos": 87, "end_pos": 87, "sequence_org": "Y", "sequence_mut": "F", "comment": "No effect on interaction with RPS2.", "evidence": [ { "database": "UniProtKB", "id": "O60678", "url": "https://www.uniprot.org/uniprot/O60678" }, { "database": "PubMed", "id": "21059412", "url": "https://glygen.org/publication/PubMed/21059412" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "68.2", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000185238", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185238" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "75.69", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000185238", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185238" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "68.5", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000185238", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185238" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "49.96", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000185238", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185238" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "82.36", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000185238", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185238" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "82.95", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000185238", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185238" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "56.65", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000185238", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185238" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "79.08", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000185238", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185238" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "84.24", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000185238", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185238" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "47.6", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000185238", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185238" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "75.81", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000185238", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185238" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "76.61", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000185238", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185238" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "80.07", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000185238", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185238" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O60678", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60678" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O60678", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60678" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O60678", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60678" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O60678", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60678" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O60678", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60678" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O60678", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60678" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O60678", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60678" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O60678", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60678" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O60678", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60678" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O60678", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60678" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O60678", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60678" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O60678", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60678" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O60678", "url": "https://www.uniprot.org/uniprot/O60678" } ], "common_name": "Human" } ], "gene": [ { "name": "PRMT3", "url": "https://www.uniprot.org/uniprot/O60678", "locus": { "chromosome": "11", "start_pos": 20509338, "end_pos": 20387558, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000185238", "url": "https://www.ensembl.org/id/ENSG00000185238" } ] } } ], "crossref": [ { "id": "ENSG00000185238", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185238", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "2.1.1.319", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.1.1.319&UniProtAcc=O60678", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "cd02440", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd02440", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL5891", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL5891", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "PRMT3", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=PRMT3", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "10196", "url": "https://www.ncbi.nlm.nih.gov/gene/10196", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "30163", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=30163", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O60678", "url": "https://www.ebi.ac.uk/intact/interactors/id:O60678*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR013087", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013087", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR025799", "url": "https://www.ebi.ac.uk/interpro/entry/IPR025799", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029063", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029063", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036236", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036236", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR049009", "url": "https://www.ebi.ac.uk/interpro/entry/IPR049009", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:10196", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:10196", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "603190", "url": "http://www.omim.org/entry/603190", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O60678", "url": "https://www.nextprot.org/entry/NX_O60678", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "O60678", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O60678", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "DGWAVWF", "url": "https://omabrowser.org/oma/group/DGWAVWF/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "197898at2759", "url": "http://www.orthodb.org/?query=197898at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11006", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11006", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11006:SF114", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11006:SF114", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "2FYT", "url": "https://www.rcsb.org/structure/2FYT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3SMQ", "url": "https://www.rcsb.org/structure/3SMQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4HSG", "url": "https://www.rcsb.org/structure/4HSG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4QQN", "url": "https://www.rcsb.org/structure/4QQN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4RYL", "url": "https://www.rcsb.org/structure/4RYL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8G2F", "url": "https://www.rcsb.org/structure/8G2F", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8G2G", "url": "https://www.rcsb.org/structure/8G2G", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF06325", "url": "http://pfam.xfam.org/family/PF06325", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF21137", "url": "http://pfam.xfam.org/family/PF21137", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF21336", "url": "http://pfam.xfam.org/family/PF21336", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O60678", "url": "https://pharos.nih.gov/targets/O60678", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O60678", "url": "http://purl.obolibrary.org/obo/PR_O60678", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8876725", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876725", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_005779", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005779", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "48096", "url": "https://www.rhea-db.org/rhea/48096", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "48100", "url": "https://www.rhea-db.org/rhea/48100", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "E9PLF6", "url": "https://www.uniprot.org/uniprot/E9PLF6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PLF6-1", "url": "https://www.uniprot.org/uniprot/E9PLF6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PRB4", "url": "https://www.uniprot.org/uniprot/E9PRB4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PRB4-1", "url": "https://www.uniprot.org/uniprot/E9PRB4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O60678", "url": "https://www.uniprot.org/uniprot/O60678", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O60678-1", "url": "https://www.uniprot.org/uniprot/O60678-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O60678-2", "url": "https://www.uniprot.org/uniprot/O60678-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MCSLASGATGGRGAVENEEDLPELSDSGDEAAWEDEDDADLPHGKQQTPCLFCNRLFTSAEETFSHCKSEHQFNIDSMVHKHGLEFYGYIKLINFIRLKNPTVEYMNSIYNPVPWEKEEYLKPVLEDDLLLQFDVEDLYEPVSVPFSYPNGLSENTSVVEKLKHMEARALSAEAALARAREDLQKMKQFAQDFVMHTDVRTCSSSTSVIADLQEDEDGVYFSSYGHYGIHEEMLKDKIRTESYRDFIYQNPHIFKDKVVLDVGCGTGILSMFAAKAGAKKVLGVDQSEILYQAMDIIRLNKLEDTITLIKGKIEEVHLPVEKVDVIISEWMGYFLLFESMLDSVLYAKNKYLAKGGSVYPDICTISLVAVSDVNKHADRIAFWDDVYGFKMSCMKKAVIPEAVVEVLDPKTLISEPCGIKHIDCHTTSISDLEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNRVVFSTGPQSTKTHWKQTVFLLEKPFSVKAGEALKGKVTVHKNKKDPRSLTVTLTLNNSTQTYGLQ", "length": 531, "header": "sp|O60678-1|ANM3_HUMAN Isoform 1 of Protein arginine N-methyltransferase 3 OS=Homo sapiens OX=9606 GN=PRMT3 PE=1 SV=4 CANONICAL=O60678-1" }, "isoforms": [ { "isoform_ac": "E9PLF6-1", "url": "", "sequence": { "sequence": "MCSLASGATGYSHLLKKHFHTVSLSISLILTAWFINMDLNFMDTLS", "length": 46, "header": "tr|E9PLF6-1|E9PLF6_HUMAN Computationally mapped isoform of Protein arginine methyltransferase 3 OS=Homo sapiens OX=9606 GN=PRMT3 PE=4 SV=1 CANONICAL=O60678-1" }, "locus": { "chromosome": "11", "start_pos": 20392237, "end_pos": 20387747, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000525188.5", "url": "https://www.ensembl.org/id/ENST00000525188.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000435151.1", "url": "https://www.ensembl.org/id/ENSP00000435151.1" } ] } }, { "isoform_ac": "E9PRB4-1", "url": "", "sequence": { "sequence": "MCSLASGATGGYPGPSAPGSSSPRPRRCGAGGRPSGTRARAGWGARRDHEGGAE", "length": 54, "header": "tr|E9PRB4-1|ANM3_HUMAN Computationally mapped isoform of Protein arginine N-methyltransferase 3 OS=Homo sapiens OX=9606 GN=PRMT3 PE=1 SV=1 CANONICAL=O60678-1" }, "locus": { "chromosome": "11", "start_pos": 20387908, "end_pos": 20387747, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000526583.1", "url": "https://www.ensembl.org/id/ENST00000526583.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000434260.1", "url": "https://www.ensembl.org/id/ENSP00000434260.1" } ] } }, { "isoform_ac": "O60678-1", "url": "", "sequence": { "sequence": "MCSLASGATGGRGAVENEEDLPELSDSGDEAAWEDEDDADLPHGKQQTPCLFCNRLFTSAEETFSHCKSEHQFNIDSMVHKHGLEFYGYIKLINFIRLKNPTVEYMNSIYNPVPWEKEEYLKPVLEDDLLLQFDVEDLYEPVSVPFSYPNGLSENTSVVEKLKHMEARALSAEAALARAREDLQKMKQFAQDFVMHTDVRTCSSSTSVIADLQEDEDGVYFSSYGHYGIHEEMLKDKIRTESYRDFIYQNPHIFKDKVVLDVGCGTGILSMFAAKAGAKKVLGVDQSEILYQAMDIIRLNKLEDTITLIKGKIEEVHLPVEKVDVIISEWMGYFLLFESMLDSVLYAKNKYLAKGGSVYPDICTISLVAVSDVNKHADRIAFWDDVYGFKMSCMKKAVIPEAVVEVLDPKTLISEPCGIKHIDCHTTSISDLEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNRVVFSTGPQSTKTHWKQTVFLLEKPFSVKAGEALKGKVTVHKNKKDPRSLTVTLTLNNSTQTYGLQ", "length": 531, "header": "sp|O60678-1|ANM3_HUMAN Isoform 1 of Protein arginine N-methyltransferase 3 OS=Homo sapiens OX=9606 GN=PRMT3 PE=1 SV=4 CANONICAL=O60678-1" }, "locus": { "chromosome": "11", "start_pos": 20508410, "end_pos": 20387747, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000331079.11", "url": "https://www.ensembl.org/id/ENST00000331079.11" }, { "database": "Ensembl Peptide", "id": "ENSP00000331879.6", "url": "https://www.ensembl.org/id/ENSP00000331879.6" } ] } }, { "isoform_ac": "O60678-2", "url": "", "sequence": { "sequence": "MCSLASGATGYSHLLKKHFHTVSLSISLILTAWFINMNPTVEYMNSIYNPVPWEKEEYLKPVLEDDLLLQFDVEDLYEPVSVPFSYPNGLSENTSVVEKLKHMEARALSAEAALARAREDLQKMKQFAQDFVMHTDVRTCSSSTSVIADLQEDEDGVYFSSYGHYGIHEEMLKDKIRTESYRDFIYQNPHIFKDKVVLDVGCGTGILSMFAAKAGAKKVLGVDQSEILYQAMDIIRLNKLEDTITLIKGKIEEVHLPVEKVDVIISEWMGYFLLFESMLDSVLYAKNKYLAKGGSVYPDICTISLVAVSDVNKHADRIAFWDDVYGFKMSCMKKAVIPEAVVEVLDPKTLISEPCGIKHIDCHTTSISDLEFSSDFTLKITRTSMCTAIAGYFDIYFEKNCHNRVVFSTGPQSTKTHWKQTVFLLEKPFSVKAGEALKGKVTVHKNKKDPRSLTVTLTLNNSTQTYGLQ", "length": 469, "header": "sp|O60678-2|ANM3_HUMAN Isoform 2 of Protein arginine N-methyltransferase 3 OS=Homo sapiens OX=9606 GN=PRMT3 PE=1 SV=4 CANONICAL=O60678-1" }, "locus": { "chromosome": "11", "start_pos": 20508410, "end_pos": 20387747, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000437750.2", "url": "https://www.ensembl.org/id/ENST00000437750.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000397766.2", "url": "https://www.ensembl.org/id/ENSP00000397766.2" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "O60678", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O60678" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" } ] } ], "phosphorylation": [ { "start_pos": 171, "end_pos": 171, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O60678", "url": "https://www.uniprot.org/uniprot/O60678" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O60678", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60678" } ], "site_lbl": "Ser171" }, { "start_pos": 25, "end_pos": 25, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O60678", "url": "https://www.uniprot.org/uniprot/O60678" }, { "database": "PubMed", "id": "21059412", "url": "https://glygen.org/publication/PubMed/21059412" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "iPTMnet", "id": "O60678", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60678" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "PubMed", "id": "19415658", "url": "https://glygen.org/publication/PubMed/19415658" }, { "database": "phospho.ELM", "id": "O60678", "url": "http://phospho.elm.eu.org/byAccession/O60678.html" } ], "site_lbl": "Ser25" }, { "start_pos": 27, "end_pos": 27, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O60678", "url": "https://www.uniprot.org/uniprot/O60678" }, { "database": "PubMed", "id": "21059412", "url": "https://glygen.org/publication/PubMed/21059412" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "iPTMnet", "id": "O60678", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60678" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" }, { "database": "PubMed", "id": "19415658", "url": "https://glygen.org/publication/PubMed/19415658" }, { "database": "phospho.ELM", "id": "O60678", "url": "http://phospho.elm.eu.org/byAccession/O60678.html" } ], "site_lbl": "Ser27" }, { "start_pos": 87, "end_pos": 87, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O60678", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60678" }, { "database": "PubMed", "id": "21059412", "url": "https://glygen.org/publication/PubMed/21059412" } ], "site_lbl": "Tyr87" } ], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Methylation of histone H3 by coactivator-associated arginine methyltransferase 1.", "journal": "Biochemistry", "date": "2001", "authors": "Schurter BT, Koh SS, Chen D, Bunick GJ, Harp JM, Hanson BL, Henschen-Edman A, Mackay DR, Stallcup MR, Aswad DW", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "11341840", "url": "https://glygen.org/publication/PubMed/11341840" } ] }, { "title": "Methylation of histone H4 at arginine 3 occurs in vivo and is mediated by the nuclear receptor coactivator PRMT1.", "journal": "Current biology : CB", "date": "2001", "authors": "Strahl BD, Briggs SD, Brame CJ, Caldwell JA, Koh SS, Ma H, Cook RG, Shabanowitz J, Hunt DF, Stallcup MR, Allis CD", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "11448779", "url": "https://glygen.org/publication/PubMed/11448779" } ] }, { "title": "Hormone-dependent, CARM1-directed, arginine-specific methylation of histone H3 on a steroid-regulated promoter.", "journal": "Current biology : CB", "date": "2001", "authors": "Ma H, Baumann CT, Li H, Strahl BD, Rice R, Jelinek MA, Aswad DW, Allis CD, Hager GL, Stallcup MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "11747826", "url": "https://glygen.org/publication/PubMed/11747826" } ] }, { "title": "Methylation at arginine 17 of histone H3 is linked to gene activation.", "journal": "EMBO reports", "date": "2002", "authors": "Bauer UM, Daujat S, Nielsen SJ, Nightingale K, Kouzarides T", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "11751582", "url": "https://glygen.org/publication/PubMed/11751582" } ] }, { "title": "A novel WD repeat protein component of the methylosome binds Sm proteins.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Friesen WJ, Wyce A, Paushkin S, Abel L, Rappsilber J, Mann M, Dreyfuss G", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "11756452", "url": "https://glygen.org/publication/PubMed/11756452" } ] }, { "title": "PRMT3 is a ribosomal protein methyltransferase that affects the cellular levels of ribosomal subunits.", "journal": "The EMBO journal", "date": "2004", "authors": "Bachand F, Silver PA", "evidence": [ { "database": "RefSeq", "id": "NP_005779", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005779" } ], "reference": [ { "type": "PubMed", "id": "15175657", "url": "https://glygen.org/publication/PubMed/15175657" } ] }, { "title": "DAL-1/4.1B tumor suppressor interacts with protein arginine N-methyltransferase 3 (PRMT3) and inhibits its ability to methylate substrates in vitro and in vivo.", "journal": "Oncogene", "date": "2004", "authors": "Singh V, Miranda TB, Jiang W, Frankel A, Roemer ME, Robb VA, Gutmann DH, Herschman HR, Clarke S, Newsham IF", "evidence": [ { "database": "UniProtKB", "id": "O60678", "url": "https://www.uniprot.org/uniprot/O60678" }, { "database": "RefSeq", "id": "NP_005779", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005779" } ], "reference": [ { "type": "PubMed", "id": "15334060", "url": "https://glygen.org/publication/PubMed/15334060" } ] }, { "title": "Human SWI/SNF-associated PRMT5 methylates histone H3 arginine 8 and negatively regulates expression of ST7 and NM23 tumor suppressor genes.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Pal S, Vishwanath SN, Erdjument-Bromage H, Tempst P, Sif S", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "15485929", "url": "https://glygen.org/publication/PubMed/15485929" } ] }, { "title": "Identification and characterization of a novel human histone H3 lysine 36-specific methyltransferase.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Sun XJ, Wei J, Wu XY, Hu M, Wang L, Wang HH, Zhang QH, Chen SJ, Huang QH, Chen Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876725", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876725" } ], "reference": [ { "type": "PubMed", "id": "16118227", "url": "https://glygen.org/publication/PubMed/16118227" } ] }, { "title": "Histone arginine methylation regulates pluripotency in the early mouse embryo.", "journal": "Nature", "date": "2007", "authors": "Torres-Padilla ME, Parfitt DE, Kouzarides T, Zernicka-Goetz M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "17215844", "url": "https://glygen.org/publication/PubMed/17215844" } ] }, { "title": "Methylation of histone H3R2 by PRMT6 and H3K4 by an MLL complex are mutually exclusive.", "journal": "Nature", "date": "2007", "authors": "Guccione E, Bassi C, Casadio F, Martinato F, Cesaroni M, Schuchlautz H, Luscher B, Amati B", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "17898714", "url": "https://glygen.org/publication/PubMed/17898714" } ] }, { "title": "PRMT6-mediated methylation of R2 in histone H3 antagonizes H3 K4 trimethylation.", "journal": "Genes & development", "date": "2007", "authors": "Hyllus D, Stein C, Schnabel K, Schiltz E, Imhof A, Dou Y, Hsieh J, Bauer UM", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "18079182", "url": "https://glygen.org/publication/PubMed/18079182" } ] }, { "title": "The histone-binding protein COPR5 is required for nuclear functions of the protein arginine methyltransferase PRMT5.", "journal": "EMBO reports", "date": "2008", "authors": "Lacroix M, El Messaoudi S, Rodier G, Le Cam A, Sardet C, Fabbrizio E", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "18404153", "url": "https://glygen.org/publication/PubMed/18404153" } ] }, { "title": "Motif-specific sampling of phosphoproteomes.", "journal": "Journal of proteome research", "date": "2008", "authors": "Ruse CI, McClatchy DB, Lu B, Cociorva D, Motoyama A, Park SK, Yates JR 3rd", "evidence": [ { "database": "iPTMnet", "id": "O60678-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60678-1" } ], "reference": [ { "type": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" } ] }, { "title": "A quantitative atlas of mitotic phosphorylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP", "evidence": [ { "database": "iPTMnet", "id": "O60678-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60678-1" } ], "reference": [ { "type": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ] }, { "title": "PRMT5-mediated methylation of histone H4R3 recruits DNMT3A, coupling histone and DNA methylation in gene silencing.", "journal": "Nature structural & molecular biology", "date": "2009", "authors": "Zhao Q, Rank G, Tan YT, Li H, Moritz RL, Simpson RJ, Cerruti L, Curtis DJ, Patel DJ, Allis CD, Cunningham JM, Jane SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "19234465", "url": "https://glygen.org/publication/PubMed/19234465" } ] }, { "title": "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.", "journal": "Analytical chemistry", "date": "2009", "authors": "Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S", "evidence": [ { "database": "iPTMnet", "id": "O60678-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60678-1" } ], "reference": [ { "type": "PubMed", "id": "19413330", "url": "https://glygen.org/publication/PubMed/19413330" } ] }, { "title": "Phosphoproteomic analysis of distinct tumor cell lines in response to nocodazole treatment.", "journal": "Proteomics", "date": "2009", "authors": "Nagano K, Shinkawa T, Mutoh H, Kondoh O, Morimoto S, Inomata N, Ashihara M, Ishii N, Aoki Y, Haramura M", "evidence": [ { "database": "iPTMnet", "id": "O60678-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60678-1" } ], "reference": [ { "type": "PubMed", "id": "19415658", "url": "https://glygen.org/publication/PubMed/19415658" } ] }, { "title": "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.", "journal": "Science signaling", "date": "2009", "authors": "Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK", "evidence": [ { "database": "UniProtKB", "id": "O60678", "url": "https://www.uniprot.org/uniprot/O60678" }, { "database": "iPTMnet", "id": "O60678", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60678" } ], "reference": [ { "type": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "UniProtKB", "id": "O60678", "url": "https://www.uniprot.org/uniprot/O60678" }, { "database": "iPTMnet", "id": "O60678-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60678-1" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "Nuclear cyclin D1/CDK4 kinase regulates CUL4 expression and triggers neoplastic growth via activation of the PRMT5 methyltransferase.", "journal": "Cancer cell", "date": "2010", "authors": "Aggarwal P, Vaites LP, Kim JK, Mellert H, Gurung B, Nakagawa H, Herlyn M, Hua X, Rustgi AK, McMahon SB, Diehl JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "20951943", "url": "https://glygen.org/publication/PubMed/20951943" } ] }, { "title": "Tyrosine 87 is vital for the activity of human protein arginine methyltransferase 3 (PRMT3).", "journal": "Biochimica et biophysica acta", "date": "2011", "authors": "Handrkova H, Petrak J, Halada P, Pospisilova D, Cmejla R", "evidence": [ { "database": "UniProtKB", "id": "O60678", "url": "https://www.uniprot.org/uniprot/O60678" }, { "database": "iPTMnet", "id": "O60678", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60678" } ], "reference": [ { "type": "PubMed", "id": "21059412", "url": "https://glygen.org/publication/PubMed/21059412" } ] }, { "title": "JAK2V617F-mediated phosphorylation of PRMT5 downregulates its methyltransferase activity and promotes myeloproliferation.", "journal": "Cancer cell", "date": "2011", "authors": "Liu F, Zhao X, Perna F, Wang L, Koppikar P, Abdel-Wahab O, Harr MW, Levine RL, Xu H, Tefferi A, Deblasio A, Hatlen M, Menendez S, Nimer SD", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "21316606", "url": "https://glygen.org/publication/PubMed/21316606" } ] }, { "title": "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.", "journal": "Science signaling", "date": "2011", "authors": "Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B", "evidence": [ { "database": "UniProtKB", "id": "O60678", "url": "https://www.uniprot.org/uniprot/O60678" }, { "database": "iPTMnet", "id": "O60678", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60678" } ], "reference": [ { "type": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" } ] }, { "title": "Methylation of H2AR29 is a novel repressive PRMT6 target.", "journal": "Epigenetics & chromatin", "date": "2011", "authors": "Waldmann T, Izzo A, Kamieniarz K, Richter F, Vogler C, Sarg B, Lindner H, Young NL, Mittler G, Garcia BA, Schneider R", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "21774791", "url": "https://glygen.org/publication/PubMed/21774791" } ] }, { "title": "Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-alpha-acetylation features.", "journal": "Molecular & cellular proteomics : MCP", "date": "2012", "authors": "Bienvenut WV, Sumpton D, Martinez A, Lilla S, Espagne C, Meinnel T, Giglione C", "evidence": [ { "database": "UniProtKB", "id": "O60678", "url": "https://www.uniprot.org/uniprot/O60678" } ], "reference": [ { "type": "PubMed", "id": "22223895", "url": "https://glygen.org/publication/PubMed/22223895" } ] }, { "title": "Symmetric dimethylation of H3R2 is a newly identified histone mark that supports euchromatin maintenance.", "journal": "Nature structural & molecular biology", "date": "2012", "authors": "Migliori V, Muller J, Phalke S, Low D, Bezzi M, Mok WC, Sahu SK, Gunaratne J, Capasso P, Bassi C, Cecatiello V, De Marco A, Blackstock W, Kuznetsov V, Amati B, Mapelli M, Guccione E", "evidence": [ { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "22231400", "url": "https://glygen.org/publication/PubMed/22231400" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "O60678", "url": "https://www.uniprot.org/uniprot/O60678" }, { "database": "iPTMnet", "id": "O60678", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60678" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "Proteome wide purification and identification of O-GlcNAc-modified proteins using click chemistry and mass spectrometry.", "journal": "Journal of proteome research", "date": "2013", "authors": "Hahne H, Sobotzki N, Nyberg T, Helm D, Borodkin VS, van Aalten DM, Agnew B, Kuster B", "evidence": [ { "database": "O-GlcNAc Database", "id": "O60678", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O60678" } ], "reference": [ { "type": "PubMed", "id": "23301498", "url": "https://glygen.org/publication/PubMed/23301498" } ] }, { "title": "A newly uncovered group of distantly related lysine methyltransferases preferentially interact with molecular chaperones to regulate their activity.", "journal": "PLoS genetics", "date": "2013", "authors": "Cloutier P, Lavallee-Adam M, Faubert D, Blanchette M, Coulombe B", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876725", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876725" } ], "reference": [ { "type": "PubMed", "id": "23349634", "url": "https://glygen.org/publication/PubMed/23349634" } ] }, { "title": "Selenium-based S-adenosylmethionine analog reveals the mammalian seven-beta-strand methyltransferase METTL10 to be an EF1A1 lysine methyltransferase.", "journal": "PloS one", "date": "2014", "authors": "Shimazu T, Barjau J, Sohtome Y, Sodeoka M, Shinkai Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876725", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876725" } ], "reference": [ { "type": "PubMed", "id": "25144183", "url": "https://glygen.org/publication/PubMed/25144183" } ] }, { "title": "Identification and characterization of a novel evolutionarily conserved lysine-specific methyltransferase targeting eukaryotic translation elongation factor 2 (eEF2).", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Davydova E, Ho AY, Malecki J, Moen A, Enserink JM, Jakobsson ME, Loenarz C, Falnes PO", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876725", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876725" } ], "reference": [ { "type": "PubMed", "id": "25231979", "url": "https://glygen.org/publication/PubMed/25231979" } ] }, { "title": "Human METTL20 is a mitochondrial lysine methyltransferase that targets the beta subunit of electron transfer flavoprotein (ETFbeta) and modulates its activity.", "journal": "The Journal of biological chemistry", "date": "2015", "authors": "Malecki J, Ho AY, Moen A, Dahl HA, Falnes PO", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876725", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876725" } ], "reference": [ { "type": "PubMed", "id": "25416781", "url": "https://glygen.org/publication/PubMed/25416781" } ] }, { "title": "Novel N-terminal and Lysine Methyltransferases That Target Translation Elongation Factor 1A in Yeast and Human.", "journal": "Molecular & cellular proteomics : MCP", "date": "2016", "authors": "Hamey JJ, Winter DL, Yagoub D, Overall CM, Hart-Smith G, Wilkins MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8876725", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876725" } ], "reference": [ { "type": "PubMed", "id": "26545399", "url": "https://glygen.org/publication/PubMed/26545399" } ] }, { "title": "The 40S ribosomal protein uS5 (RPS2) assembles into an extraribosomal complex with human ZNF277 that competes with the PRMT3-uS5 interaction.", "journal": "J. Biol. Chem.", "date": "2019", "authors": "Dionne KL, Bergeron D, Landry-Voyer AM, Bachand F", "evidence": [ { "database": "UniProtKB", "id": "O60678", "url": "https://www.uniprot.org/uniprot/O60678" } ], "reference": [ { "type": "PubMed", "id": "30530495", "url": "https://glygen.org/publication/PubMed/30530495" } ] }, { "title": "PRMT3 interacts with ALDH1A1 and regulates gene-expression by inhibiting retinoic acid signaling.", "journal": "Communications biology", "date": "2021", "authors": "Verma M, Khan MIK, Kadumuri RV, Chakrapani B, Awasthi S, Mahesh A, Govindaraju G, Chavali PL, Rajavelu A, Chavali S, Dhayalan A", "evidence": [ { "database": "UniProtKB", "id": "O60678", "url": "https://www.uniprot.org/uniprot/O60678" } ], "reference": [ { "type": "PubMed", "id": "33495566", "url": "https://glygen.org/publication/PubMed/33495566" } ] }, { "title": "Decreased nitric oxide content mediated by asymmetrical dimethylarginine and protein l-arginine methyltransferase 3 in macrophages induces trophoblast apoptosis: a potential cause of recurrent miscarriage.", "journal": "Human reproduction (Oxford, England)", "date": "2021", "authors": "Hao F, Tang LC, Sun JX, Li WX, Zhao Y, Xu XH, Jin LP", "evidence": [ { "database": "RefSeq", "id": "NP_005779", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005779" } ], "reference": [ { "type": "PubMed", "id": "34647126", "url": "https://glygen.org/publication/PubMed/34647126" } ] }, { "title": "Protein arginine methyltransferase 3: A crucial regulator in metabolic reprogramming and gene expression in cancers.", "journal": "Cancer letters", "date": "2022-11-16", "authors": "Hsu Shih-Han, Hung Wen-Chun", "evidence": [ { "database": "RefSeq", "id": "NP_005779", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005779" } ], "reference": [ { "type": "PubMed", "id": "36400311", "url": "https://glygen.org/publication/PubMed/36400311" } ] }, { "title": "PRMT3 regulates the progression of invasive micropapillary carcinoma of the breast.", "journal": "Cancer science", "date": "2023-01-13", "authors": "Zhi Renyong, Wu Kailiang, Zhang Jingyue, Liu Hanjiao, Niu Chen, Li Shuai, Fu Li", "evidence": [ { "database": "RefSeq", "id": "NP_005779", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005779" } ], "reference": [ { "type": "PubMed", "id": "36637351", "url": "https://glygen.org/publication/PubMed/36637351" } ] }, { "title": "PRMT3-mediated arginine methylation of IGF2BP1 promotes oxaliplatin resistance in liver cancer.", "journal": "Nature communications", "date": "2023-04-06", "authors": "Shi Yunxing, Niu Yi, Yuan Yichuan, Li Kai, Zhong Chengrui, Qiu Zhiyu, Li Keren, Lin Zhu, Yang Zhiwen, Zuo Dinglan, Qiu Jiliang, He Wei, Wang Chenwei, Liao Yadi, Wang Guocan, Yuan Yunfei, Li Binkui", "evidence": [ { "database": "RefSeq", "id": "NP_005779", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005779" } ], "reference": [ { "type": "PubMed", "id": "37024475", "url": "https://glygen.org/publication/PubMed/37024475" } ] }, { "title": "Extracellular arginine availability modulates eIF2\u03b1 O-GlcNAcylation and heme oxygenase 1 translation for cellular homeostasis.", "journal": "Journal of biomedical science", "date": "2023-05-22", "authors": "Hung Yu-Wen, Ouyang Ching, Ping Xiaoli, Qi Yue, Wang Yi-Chang, Kung Hsing-Jien, Ann David K", "evidence": [ { "database": "O-GlcNAc Database", "id": "O60678", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O60678" } ], "reference": [ { "type": "PubMed", "id": "37217939", "url": "https://glygen.org/publication/PubMed/37217939" } ] }, { "title": "PRMT3-Mediated Arginine Methylation of METTL14 Promotes Malignant Progression and Treatment Resistance in Endometrial Carcinoma.", "journal": "Advanced science (Weinheim, Baden-Wurttemberg, Germany)", "date": "2023-12", "authors": "Wang Yiru, Wang Can, Guan Xue, Ma Ying, Zhang Shijie, Li Fei, Yin Yue, Sun Zhenxing, Chen Xiuwei, Yin Hang", "evidence": [ { "database": "RefSeq", "id": "NP_005779", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005779" } ], "reference": [ { "type": "PubMed", "id": "37973560", "url": "https://glygen.org/publication/PubMed/37973560" } ] }, { "title": "PRMT 3, a type I protein arginine N-methyltransferase that differs from PRMT1 in its oligomerization, subcellular localization, substrate specificity, and regulation.", "journal": "J. Biol. Chem.", "date": "1998", "authors": "Tang J, Gary JD, Clarke S, Herschman HR", "evidence": [ { "database": "UniProtKB", "id": "O60678", "url": "https://www.uniprot.org/uniprot/O60678" }, { "database": "Reactome", "id": "R-HSA-3214858", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858" } ], "reference": [ { "type": "PubMed", "id": "9642256", "url": "https://glygen.org/publication/PubMed/9642256" } ] } ], "pathway": [ { "id": "hsa:10196", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:10196", "resource": "KEGG Pathway" }, { "id": "R-HSA-3214858", "name": "RMTs methylate histone arginines", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214858", "resource": "Reactome", "description": "RMTs methylate histone arginines" }, { "id": "R-HSA-8876725", "name": "Protein methylation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8876725", "resource": "Reactome", "description": "Protein methylation" } ], "orthologs": [ { "uniprot_canonical_ac": "O70467-1", "protein_name": "Protein arginine N-methyltransferase 3", "gene_name": "Prmt3", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MCSLAAGNGQGAELGPEPLELSDSGDDAGWEDEDADAEPAQGRQHTPCLFCDRLFRSAEETFSHCKLEHQFNIDGMVHKHGLEFYGYIKLINFIRLKNPTVEYMNSIYNPVPWDKDEYLKPVLEDDLLLQFDVEDLYEPVSAPFTYPNGLSENTSAVEKLKLMEARALSAEAALARAREDLQKMKQFAQDFVMNVDVRTCSSTTTIADLQEDEDGVYFSSYGHYGIHEEMLKDKVRTESYRDFIYQNPHIFKDKVVLDVGCGTGILSMFAAKAGAKKVIAVDQSEILYQAMDIIRLNKLEDTIVLIKGKIEEVSLPVEKVDVIISEWMGYFLLFESMLDSVLYAKSKYLAKGGSVYPDICTISLVAVSDVSKHADRIAFWDDVYGFNMSCMKKAVIPEAVVEVVDHKTLISDPCDIKHIDCHTTSISDLEFSSDFTLRTTKTAMCTAVAGYFDIYFEKNCHNRVVFSTGPQSTKTHWKQTIFLLEKPFPVKAGEALKGKITVHKNKKDPRSLIVTLTLNSSTQTYSLQ", "length": 528 }, "evidence": [ { "id": "45919064", "url": "http://www.informatics.jax.org/homology/45919064", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q922H1-1", "protein_name": "Protein arginine N-methyltransferase 3", "gene_name": "Prmt3", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MCSLAAGNGRGAELGPEPLELSDSGDDAGWEDEDADTEPAHGRQHTPCLFCDRLFASAEETFSHCKLEHQFNIDSMVHKHGLEFYGYIKLINFIRLKNPTVEYMNSIYNPVPWEKDEYLKPVLEDDLLLQFDVEDLYEPVSTPFSYPNGLSESASVVEKLKHMEARALSAEAALARAREDLQKMKQFAQDFVMNVDVRTCSSTTTIADLQEDEDGVYFSSYGHYGIHEEMLKDKVRTESYRDFIYQNPHIFKDKVVLDVGCGTGILSMFAAKVGAKKVIAVDQSEILYQAMDIIRLNKLEDTIVLIKGKIEEVSLPVEKVDVIISEWMGYFLLFESMLDSVLYAKSKYLAKGGSVYPDICTISLVAVSDVSKHADRIAFWDDVYGFNMSCMKKAVIPEAVVEVVDHKTLISDPCDIKHIDCHTTSISDLEFSSDFTLRTTKTAMCTAVAGYFDIYFEKNCHNRVVFSTGPQSTKTHWKQTVFLLEKPFPVKAGEALKGKITVHKNKKDPRSLIVTLTLNSSTQTYSLQ", "length": 528 }, "evidence": [ { "id": "45919064", "url": "http://www.informatics.jax.org/homology/45919064", "database": "MGI" }, { "id": "O60678", "url": "https://omabrowser.org/oma/group/O60678/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9VFB3-1", "protein_name": "2.1.1.321", "gene_name": "Art3", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MKDTEVNDNTTEEEPVKEAPEVPANSSSDEDEYDDIDDDDEPMDEGDELTTCLFCTETSANISVAIDHLDARHKVNLSQLQRKFEMDQYSFIKLINYIRAKKISAEQLLSAEHPLWQDEKYLQPGEYEPWLCYDYEVLKTDGAPTQPSVLELQQRIAEQSQLLQQANEDMERMRNDYKALLQKVHADGEPKGSDQSVPRNNVCLDNEYFKSYAHFGIHHEMLSDKVRTSTYRASLLQNEAVVRGKTVLDVGCGTGILSIFASKAGAARVVGIDNSDIVYTAMDIIRKNKVENVELIKGRLEDTDLPETKYDIIISEWMGYFLLYESMLDSIIYARENHLNPNGIILPSRCTLSLLGYGDDTLYADEVEFWSNVYEVDMSDLRKQSIEEPLMQVVDAEFMLTEPEQIANFDIMTVDMNYPNFTHQFSLKVTKPGRLSAFVGYFETLFELPSPVMFSTSPSATPTHWKQTVFFIENPQVVKEGDVICGKITSRRHKEDVRGLSVDIEVFGKKHKYNVV", "length": 516 }, "evidence": [ { "id": "O60678", "url": "https://omabrowser.org/oma/group/O60678/", "database": "OMA" } ], "common_name": "Fruit fly" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "O60678", "url": "https://www.uniprot.org/uniprot/O60678" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "O60678", "url": "https://www.uniprot.org/uniprot/O60678" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "O60678", "url": "https://www.uniprot.org/uniprot/O60678" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "O60678", "url": "https://www.uniprot.org/uniprot/O60678" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 6, "go_terms": [ { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "O60678", "url": "https://www.uniprot.org/uniprot/O60678" } ], "pmid": "" }, { "name": "methyltransferase activity", "id": "GO:0008168", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008168", "evidence": [ { "database": "UniProtKB", "id": "O60678", "url": "https://www.uniprot.org/uniprot/O60678" } ], "pmid": "" }, { "name": "protein-arginine N-methyltransferase activity", "id": "GO:0016274", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016274", "evidence": [ { "database": "UniProtKB", "id": "O60678", "url": "https://www.uniprot.org/uniprot/O60678" } ], "pmid": "" }, { "name": "protein-arginine omega-N asymmetric methyltransferase activity", "id": "GO:0035242", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035242", "evidence": [ { "database": "UniProtKB", "id": "O60678", "url": "https://www.uniprot.org/uniprot/O60678" } ], "pmid": "" }, { "name": "ribosome binding", "id": "GO:0043022", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043022", "evidence": [ { "database": "UniProtKB", "id": "O60678", "url": "https://www.uniprot.org/uniprot/O60678" } ], "pmid": "" }, { "name": "protein-arginine omega-N monomethyltransferase activity", "id": "GO:0035241", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035241", "evidence": [ { "database": "UniProtKB", "id": "O60678", "url": "https://www.uniprot.org/uniprot/O60678" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "negative regulation of protein ubiquitination", "id": "GO:0031397", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031397", "evidence": [ { "database": "UniProtKB", "id": "O60678", "url": "https://www.uniprot.org/uniprot/O60678" } ], "pmid": "" }, { "name": "negative regulation of retinoic acid biosynthetic process", "id": "GO:1900053", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1900053", "evidence": [ { "database": "UniProtKB", "id": "O60678", "url": "https://www.uniprot.org/uniprot/O60678" } ], "pmid": "" }, { "name": "methylation", "id": "GO:0032259", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032259", "evidence": [ { "database": "UniProtKB", "id": "O60678", "url": "https://www.uniprot.org/uniprot/O60678" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 155, "end_pos": 157, "annotation": "n_glycosylation_sequon" }, { "start_pos": 522, "end_pos": 524, "annotation": "n_glycosylation_sequon" }, { "start_pos": 523, "end_pos": 525, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "48096", "name": "", "equation": "L-arginyl-[protein] + 2 S-adenosyl-L-methionine = 2 H(+) + N(omega),N(omega)-dimethyl-L-arginyl-[protein] + 2 S-adenosyl-L-homocysteine", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q4AE70-1", "Q63009-1", "O70467-1", "Q5RJL2-1", "Q9NR22-1", "P55345-1", "Q99873-1", "Q96LA8-1", "Q86X55-3", "O60678-1", "Q86XA0-1", "Q6PAK3-1", "Q6NZB1-1", "Q9JIF0-1", "Q9R144-1", "Q9WVG6-1", "Q922H1-1", "A2AA28-1", "Q54EF2-1", "Q54HI0-1", "Q9VH48-1" ], "evidence": [ { "id": "48096", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/48096" } ] }, { "id": "48100", "name": "", "equation": "L-arginyl-[protein] + S-adenosyl-L-methionine = H(+) + N(omega)-methyl-L-arginyl-[protein] + S-adenosyl-L-homocysteine", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q5U4E8-1", "O70467-1", "Q63009-1", "Q9NVM4-1", "Q9NR22-1", "O60678-1", "Q99873-1", "Q922X9-1", "Q922H1-1", "Q6PAK3-1", "Q9JIF0-1" ], "evidence": [ { "id": "48100", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/48100" } ] }, { "id": "R-HSA-8879123", "name": "PRMT3 transfers 3xCH3 from 3xAdoMet to RPS2", "equation": "", "summary": "Protein arginine methyltransferase 3 (PRMT3) is a cytosolic enzyme that catalyzes the formation of omega-mono- or asymmetric dimethylarginine (Tang et al. 1998). It has a unique substrate binding N-terminal C2H2 Zn finger domain and a catalytic C-terminal domain that is homologous to other PRMTs (Zhang et al. 2000). PRMT3 associates with ribosomes in the cytosol, which contain its main in vivo substrate, the small ribosomal subunit Ribosomal protein S2 (RPS2). PRMT3 methylates arginines in the RG-rich N-terminal tail of RPS2 forming asymmetric dimethylarginines (Swiercz et al. 2005). Prmt3\u2013null mice show developmental delay during embryogenesis and have embryos that are markedly smaller than wt , though size at birth is normal suggesting that PRMT3 loss can be compensated for in most cell types but may not be in under conditions that demand extremely fast protein synthesis (Swiercz et al. 2007).", "cellular_location": "cytosol", "input_participant_list": [ "R-HSA-72347" ], "output_participant_list": [ "R-HSA-8879138" ], "enzyme_list": [ "O60678-1" ], "evidence": [ { "id": "R-HSA-8879123", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8879123" } ] } ], "reaction_participants": [ { "participant_id": "R-HSA-72347", "participant_name": "RPS2 [cytosol]", "crossref": [ { "id": "P15880", "database": "UniProt", "url": "" }, { "id": "6ZOK", "database": "PDB", "url": "" }, { "id": "4V6X", "database": "PDB", "url": "" }, { "id": "6QZP", "database": "PDB", "url": "" }, { "id": "ENSG00000140988", "database": "Ensembl", "url": "" }, { "id": "ENST00000343262", "database": "Ensembl", "url": "" }, { "id": "ENSP00000341885", "database": "Ensembl", "url": "" }, { "id": "7QP7", "database": "PDB", "url": "" }, { "id": "6ZOJ", "database": "PDB", "url": "" }, { "id": "6OM7", "database": "PDB", "url": "" }, { "id": "8GLP", "database": "PDB", "url": "" }, { "id": "6OM0", "database": "PDB", "url": "" }, { "id": "6ZN5", "database": "PDB", "url": "" }, { "id": "7QP6", "database": "PDB", "url": "" }, { "id": "4UG0", "database": "PDB", "url": "" }, { "id": "5VYC", "database": "PDB", "url": "" }, { "id": "7R4X", "database": "PDB", "url": "" }, { "id": "6Y0G", "database": "PDB", "url": "" }, { "id": "6ZP4", "database": "PDB", "url": "" }, { "id": "5LKS", "database": "PDB", "url": "" }, { "id": "5FLX", "database": "PDB", "url": "" }, { "id": "5T2C", "database": "PDB", "url": "" }, { "id": "5OA3", "database": "PDB", "url": "" }, { "id": "6XA1", "database": "PDB", "url": "" }, { "id": "5AJ0", "database": "PDB", "url": "" }, { "id": "7QVP", "database": "PDB", "url": "" }, { "id": "6ZON", "database": "PDB", "url": "" }, { "id": "5A2Q", "database": "PDB", "url": "" }, { "id": "6YBD", "database": "PDB", "url": "" }, { "id": "6ZVH", "database": "PDB", "url": "" }, { "id": "6G4S", "database": "PDB", "url": "" }, { "id": "7WTV", "database": "PDB", "url": "" }, { "id": "6ZV6", "database": "PDB", "url": "" }, { "id": "6Y57", "database": "PDB", "url": "" }, { "id": "6G18", "database": "PDB", "url": "" }, { "id": "7TQL", "database": "PDB", "url": "" }, { "id": "6ZUO", "database": "PDB", "url": "" }, { "id": "6Y2L", "database": "PDB", "url": "" }, { "id": "6ZXD", "database": "PDB", "url": "" }, { "id": "7WTX", "database": "PDB", "url": "" }, { "id": "6Z6L", "database": "PDB", "url": "" }, { "id": "6G53", "database": "PDB", "url": "" }, { "id": "6YBW", "database": "PDB", "url": "" }, { "id": "NP_002943.2", "database": "RefSeq", "url": "" }, { "id": "6ZVJ", "database": "PDB", "url": "" }, { "id": "7WTW", "database": "PDB", "url": "" }, { "id": "6G51", "database": "PDB", "url": "" }, { "id": "ENSG00000140988-RPS2", "database": "HPA", "url": "" }, { "id": "6ZXF", "database": "PDB", "url": "" }, { "id": "6IP5", "database": "PDB", "url": "" }, { "id": "7WU0", "database": "PDB", "url": "" }, { "id": "6Z6N", "database": "PDB", "url": "" }, { "id": "6ZMT", "database": "PDB", "url": "" }, { "id": "7JQC", "database": "PDB", "url": "" }, { "id": "6OLI", "database": "PDB", "url": "" }, { "id": "8G61", "database": "PDB", "url": "" }, { "id": "6OLZ", "database": "PDB", "url": "" }, { "id": "6ZMW", "database": "PDB", "url": "" }, { "id": "7K5I", "database": "PDB", "url": "" }, { "id": "8G6J", "database": "PDB", "url": "" }, { "id": "ENSG00000140988", "database": "OpenTargets", "url": "" }, { "id": "6ZME", "database": "PDB", "url": "" }, { "id": "P15880", "database": "PRO", "url": "" }, { "id": "6ZMI", "database": "PDB", "url": "" }, { "id": "8G5Y", "database": "PDB", "url": "" }, { "id": "8G5Z", "database": "PDB", "url": "" }, { "id": "7A09", "database": "PDB", "url": "" }, { "id": "6OLF", "database": "PDB", "url": "" }, { "id": "6ZMO", "database": "PDB", "url": "" }, { "id": "7JQB", "database": "PDB", "url": "" }, { "id": "8G60", "database": "PDB", "url": "" }, { "id": "P15880", "database": "GeneCards", "url": "" }, { "id": "6OLG", "database": "PDB", "url": "" }, { "id": "6ZLW", "database": "PDB", "url": "" }, { "id": "7XNX", "database": "PDB", "url": "" }, { "id": "6ZXG", "database": "PDB", "url": "" }, { "id": "7XNY", "database": "PDB", "url": "" }, { "id": "6IP6", "database": "PDB", "url": "" }, { "id": "6IP8", "database": "PDB", "url": "" }, { "id": "6ZM7", "database": "PDB", "url": "" }, { "id": "6ZXH", "database": "PDB", "url": "" }, { "id": "6OLE", "database": "PDB", "url": "" }, { "id": "P15880", "database": "Pharos - Targets", "url": "" }, { "id": "6G5H", "database": "PDB", "url": "" }, { "id": "7WTZ", "database": "PDB", "url": "" }, { "id": "6ZXE", "database": "PDB", "url": "" }, { "id": "6Z6M", "database": "PDB", "url": "" }, { "id": "6G5I", "database": "PDB", "url": "" } ] }, { "participant_id": "R-HSA-8879138", "participant_name": "Me2aR-RPS2 [cytosol]", "crossref": [ { "id": "7WTV", "database": "PDB", "url": "" }, { "id": "6ZMI", "database": "PDB", "url": "" }, { "id": "5VYC", "database": "PDB", "url": "" }, { "id": "6ZM7", "database": "PDB", "url": "" }, { "id": "ENSG00000140988-RPS2", "database": "HPA", "url": "" }, { "id": "7QP7", "database": "PDB", "url": "" }, { "id": "P15880", "database": "GeneCards", "url": "" }, { "id": "7WTX", "database": "PDB", "url": "" }, { "id": "6G5I", "database": "PDB", "url": "" }, { "id": "6XA1", "database": "PDB", "url": "" }, { "id": "8G61", "database": "PDB", "url": "" }, { "id": "6QZP", "database": "PDB", "url": "" }, { "id": "8G6J", "database": "PDB", "url": "" }, { "id": "5A2Q", "database": "PDB", "url": "" }, { "id": "6ZXG", "database": "PDB", "url": "" }, { "id": "6OM0", "database": "PDB", "url": "" }, { "id": "NP_002943.2", "database": "RefSeq", "url": "" }, { "id": "6G5H", "database": "PDB", "url": "" }, { "id": "7TQL", "database": "PDB", "url": "" }, { "id": "6OLF", "database": "PDB", "url": "" }, { "id": "5LKS", "database": "PDB", "url": "" }, { "id": "6Z6N", "database": "PDB", "url": "" }, { "id": "6ZOK", "database": "PDB", "url": "" }, { "id": "6ZMW", "database": "PDB", "url": "" }, { "id": "7QVP", "database": "PDB", "url": "" }, { "id": "6ZLW", "database": "PDB", "url": "" }, { "id": "6OM7", "database": "PDB", "url": "" }, { "id": "6G53", "database": "PDB", "url": "" }, { "id": "6OLE", "database": "PDB", "url": "" }, { "id": "6Y57", "database": "PDB", "url": "" }, { "id": "8G5Z", "database": "PDB", "url": "" }, { "id": "6Y0G", "database": "PDB", "url": "" }, { "id": "6IP5", "database": "PDB", "url": "" }, { "id": "6ZXE", "database": "PDB", "url": "" }, { "id": "6ZVH", "database": "PDB", "url": "" }, { "id": "6ZME", "database": "PDB", "url": "" }, { "id": "7QP6", "database": "PDB", "url": "" }, { "id": "6IP6", "database": "PDB", "url": "" }, { "id": "7WTW", "database": "PDB", "url": "" }, { "id": "ENST00000343262", "database": "Ensembl", "url": "" }, { "id": "7JQC", "database": "PDB", "url": "" }, { "id": "5T2C", "database": "PDB", "url": "" }, { "id": "7JQB", "database": "PDB", "url": "" }, { "id": "6Y2L", "database": "PDB", "url": "" }, { "id": "P15880", "database": "UniProt", "url": "" }, { "id": "6OLI", "database": "PDB", "url": "" }, { "id": "5OA3", "database": "PDB", "url": "" }, { "id": "8G60", "database": "PDB", "url": "" }, { "id": "ENSP00000341885", "database": "Ensembl", "url": "" }, { "id": "6ZXD", "database": "PDB", "url": "" }, { "id": "6IP8", "database": "PDB", "url": "" }, { "id": "6G4S", "database": "PDB", "url": "" }, { "id": "P15880", "database": "PRO", "url": "" }, { "id": "4UG0", "database": "PDB", "url": "" }, { "id": "6G51", "database": "PDB", "url": "" }, { "id": "P15880", "database": "Pharos - Targets", "url": "" }, { "id": "6ZON", "database": "PDB", "url": "" }, { "id": "7K5I", "database": "PDB", "url": "" }, { "id": "8GLP", "database": "PDB", "url": "" }, { "id": "7XNX", "database": "PDB", "url": "" }, { "id": "6YBW", "database": "PDB", "url": "" }, { "id": "4V6X", "database": "PDB", "url": "" }, { "id": "7WU0", "database": "PDB", "url": "" }, { "id": "6ZP4", "database": "PDB", "url": "" }, { "id": "7A09", "database": "PDB", "url": "" }, { "id": "6G18", "database": "PDB", "url": "" }, { "id": "6Z6M", "database": "PDB", "url": "" }, { "id": "6ZV6", "database": "PDB", "url": "" }, { "id": "8G5Y", "database": "PDB", "url": "" }, { "id": "7R4X", "database": "PDB", "url": "" }, { "id": "6ZXH", "database": "PDB", "url": "" }, { "id": "6ZXF", "database": "PDB", "url": "" }, { "id": "6ZOJ", "database": "PDB", "url": "" }, { "id": "6OLZ", "database": "PDB", "url": "" }, { "id": "5AJ0", "database": "PDB", "url": "" }, { "id": "6OLG", "database": "PDB", "url": "" }, { "id": "6Z6L", "database": "PDB", "url": "" }, { "id": "ENSG00000140988", "database": "Ensembl", "url": "" }, { "id": "6ZMT", "database": "PDB", "url": "" }, { "id": "5FLX", "database": "PDB", "url": "" }, { "id": "6ZMO", "database": "PDB", "url": "" }, { "id": "6ZUO", "database": "PDB", "url": "" }, { "id": "7WTZ", "database": "PDB", "url": "" }, { "id": "6YBD", "database": "PDB", "url": "" }, { "id": "ENSG00000140988", "database": "OpenTargets", "url": "" }, { "id": "6ZN5", "database": "PDB", "url": "" }, { "id": "7XNY", "database": "PDB", "url": "" }, { "id": "6ZVJ", "database": "PDB", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "A2AA28", "gene_name": "Mettl23", "activity": [ { "ec_number": "2.1.1.319", "activity": "L-arginyl-[protein] + 2 S-adenosyl-L-methionine = 2 H(+) + N(omega),N(omega)-dimethyl-L-arginyl-[protein] + 2 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "A2AA28", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2AA28" } ] }, { "ec_number": "2.1.1.319", "activity": "", "evidence": [ { "id": "A2AA28", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A2AA28" } ] } ] }, { "uniprot_ac": "O60678", "gene_name": "PRMT3", "activity": [ { "ec_number": "2.1.1.319", "activity": "L-arginyl-[protein] + 2 S-adenosyl-L-methionine = 2 H(+) + N(omega),N(omega)-dimethyl-L-arginyl-[protein] + 2 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "O60678", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60678" } ] }, { "ec_number": "2.1.1.319", "activity": "", "evidence": [ { "id": "O60678", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60678" } ] } ] }, { "uniprot_ac": "O70467", "gene_name": "Prmt3", "activity": [ { "ec_number": "2.1.1.319", "activity": "L-arginyl-[protein] + 2 S-adenosyl-L-methionine = 2 H(+) + N(omega),N(omega)-dimethyl-L-arginyl-[protein] + 2 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "O70467", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70467" } ] }, { "ec_number": "2.1.1.319", "activity": "", "evidence": [ { "id": "O70467", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70467" } ] } ] }, { "uniprot_ac": "P55345", "gene_name": "PRMT2", "activity": [ { "ec_number": "2.1.1.319", "activity": "L-arginyl-[protein] + 2 S-adenosyl-L-methionine = 2 H(+) + N(omega),N(omega)-dimethyl-L-arginyl-[protein] + 2 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "P55345", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P55345" } ] }, { "ec_number": "2.1.1.319", "activity": "", "evidence": [ { "id": "P55345", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P55345" } ] } ] }, { "uniprot_ac": "Q4AE70", "gene_name": "Carm1", "activity": [ { "ec_number": "2.1.1.319", "activity": "L-arginyl-[protein] + 2 S-adenosyl-L-methionine = 2 H(+) + N(omega),N(omega)-dimethyl-L-arginyl-[protein] + 2 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q4AE70", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4AE70" } ] }, { "ec_number": "2.1.1.319", "activity": "", "evidence": [ { "id": "Q4AE70", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4AE70" } ] } ] }, { "uniprot_ac": "Q54EF2", "gene_name": "prmt1", "activity": [ { "ec_number": "2.1.1.319", "activity": "L-arginyl-[protein] + 2 S-adenosyl-L-methionine = 2 H(+) + N(omega),N(omega)-dimethyl-L-arginyl-[protein] + 2 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q54EF2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54EF2" } ] }, { "ec_number": "2.1.1.319", "activity": "", "evidence": [ { "id": "Q54EF2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54EF2" } ] } ] }, { "uniprot_ac": "Q54HI0", "gene_name": "prmt2", "activity": [ { "ec_number": "2.1.1.319", "activity": "L-arginyl-[protein] + 2 S-adenosyl-L-methionine = 2 H(+) + N(omega),N(omega)-dimethyl-L-arginyl-[protein] + 2 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q54HI0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54HI0" } ] }, { "ec_number": "2.1.1.319", "activity": "", "evidence": [ { "id": "Q54HI0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54HI0" } ] } ] }, { "uniprot_ac": "Q5RJL2", "gene_name": "Mettl23", "activity": [ { "ec_number": "2.1.1.319", "activity": "L-arginyl-[protein] + 2 S-adenosyl-L-methionine = 2 H(+) + N(omega),N(omega)-dimethyl-L-arginyl-[protein] + 2 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q5RJL2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5RJL2" } ] }, { "ec_number": "2.1.1.319", "activity": "", "evidence": [ { "id": "Q5RJL2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5RJL2" } ] } ] }, { "uniprot_ac": "Q5U4E8", "gene_name": "Prmt7", "activity": [ { "ec_number": "2.1.1.321", "activity": "L-arginyl-[protein] + S-adenosyl-L-methionine = H(+) + N(omega)-methyl-L-arginyl-[protein] + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q5U4E8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5U4E8" } ] }, { "ec_number": "2.1.1.321", "activity": "", "evidence": [ { "id": "Q5U4E8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5U4E8" } ] } ] }, { "uniprot_ac": "Q63009", "gene_name": "Prmt1", "activity": [ { "ec_number": "2.1.1.319", "activity": "L-arginyl-[protein] + 2 S-adenosyl-L-methionine = 2 H(+) + N(omega),N(omega)-dimethyl-L-arginyl-[protein] + 2 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q63009", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63009" } ] }, { "ec_number": "2.1.1.319", "activity": "", "evidence": [ { "id": "Q63009", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63009" } ] } ] }, { "uniprot_ac": "Q6NZB1", "gene_name": "Prmt6", "activity": [ { "ec_number": "2.1.1.319", "activity": "L-arginyl-[protein] + 2 S-adenosyl-L-methionine = 2 H(+) + N(omega),N(omega)-dimethyl-L-arginyl-[protein] + 2 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q6NZB1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6NZB1" } ] }, { "ec_number": "2.1.1.319", "activity": "", "evidence": [ { "id": "Q6NZB1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6NZB1" } ] } ] }, { "uniprot_ac": "Q6PAK3", "gene_name": "Prmt8", "activity": [ { "ec_number": "2.1.1.319", "activity": "L-arginyl-[protein] + 2 S-adenosyl-L-methionine = 2 H(+) + N(omega),N(omega)-dimethyl-L-arginyl-[protein] + 2 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q6PAK3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6PAK3" } ] }, { "ec_number": "2.1.1.319", "activity": "", "evidence": [ { "id": "Q6PAK3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6PAK3" } ] } ] }, { "uniprot_ac": "Q86X55", "gene_name": "CARM1", "activity": [ { "ec_number": "2.1.1.319", "activity": "L-arginyl-[protein] + 2 S-adenosyl-L-methionine = 2 H(+) + N(omega),N(omega)-dimethyl-L-arginyl-[protein] + 2 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q86X55", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86X55" } ] }, { "ec_number": "2.1.1.319", "activity": "", "evidence": [ { "id": "Q86X55", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86X55" } ] } ] }, { "uniprot_ac": "Q86XA0", "gene_name": "METTL23", "activity": [ { "ec_number": "2.1.1.319", "activity": "L-arginyl-[protein] + 2 S-adenosyl-L-methionine = 2 H(+) + N(omega),N(omega)-dimethyl-L-arginyl-[protein] + 2 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q86XA0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86XA0" } ] }, { "ec_number": "2.1.1.319", "activity": "", "evidence": [ { "id": "Q86XA0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86XA0" } ] } ] }, { "uniprot_ac": "Q922H1", "gene_name": "Prmt3", "activity": [ { "ec_number": "2.1.1.319", "activity": "L-arginyl-[protein] + 2 S-adenosyl-L-methionine = 2 H(+) + N(omega),N(omega)-dimethyl-L-arginyl-[protein] + 2 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q922H1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q922H1" } ] }, { "ec_number": "2.1.1.319", "activity": "", "evidence": [ { "id": "Q922H1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q922H1" } ] } ] }, { "uniprot_ac": "Q922X9", "gene_name": "Prmt7", "activity": [ { "ec_number": "2.1.1.321", "activity": "L-arginyl-[protein] + S-adenosyl-L-methionine = H(+) + N(omega)-methyl-L-arginyl-[protein] + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q922X9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q922X9" } ] }, { "ec_number": "2.1.1.321", "activity": "", "evidence": [ { "id": "Q922X9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q922X9" } ] } ] }, { "uniprot_ac": "Q96LA8", "gene_name": "PRMT6", "activity": [ { "ec_number": "2.1.1.319", "activity": "L-arginyl-[protein] + 2 S-adenosyl-L-methionine = 2 H(+) + N(omega),N(omega)-dimethyl-L-arginyl-[protein] + 2 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q96LA8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96LA8" } ] }, { "ec_number": "2.1.1.319", "activity": "", "evidence": [ { "id": "Q96LA8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96LA8" } ] } ] }, { "uniprot_ac": "Q99873", "gene_name": "PRMT1", "activity": [ { "ec_number": "2.1.1.319", "activity": "L-arginyl-[protein] + 2 S-adenosyl-L-methionine = 2 H(+) + N(omega),N(omega)-dimethyl-L-arginyl-[protein] + 2 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q99873", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99873" } ] }, { "ec_number": "2.1.1.319", "activity": "", "evidence": [ { "id": "Q99873", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99873" } ] } ] }, { "uniprot_ac": "Q9JIF0", "gene_name": "Prmt1", "activity": [ { "ec_number": "2.1.1.319", "activity": "L-arginyl-[protein] + 2 S-adenosyl-L-methionine = 2 H(+) + N(omega),N(omega)-dimethyl-L-arginyl-[protein] + 2 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q9JIF0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JIF0" } ] }, { "ec_number": "2.1.1.319", "activity": "", "evidence": [ { "id": "Q9JIF0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JIF0" } ] } ] }, { "uniprot_ac": "Q9NR22", "gene_name": "PRMT8", "activity": [ { "ec_number": "2.1.1.319", "activity": "L-arginyl-[protein] + 2 S-adenosyl-L-methionine = 2 H(+) + N(omega),N(omega)-dimethyl-L-arginyl-[protein] + 2 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q9NR22", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NR22" } ] }, { "ec_number": "2.1.1.319", "activity": "", "evidence": [ { "id": "Q9NR22", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NR22" } ] } ] }, { "uniprot_ac": "Q9NVM4", "gene_name": "PRMT7", "activity": [ { "ec_number": "2.1.1.321", "activity": "L-arginyl-[protein] + S-adenosyl-L-methionine = H(+) + N(omega)-methyl-L-arginyl-[protein] + S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q9NVM4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NVM4" } ] }, { "ec_number": "2.1.1.321", "activity": "", "evidence": [ { "id": "Q9NVM4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NVM4" } ] } ] }, { "uniprot_ac": "Q9R144", "gene_name": "Prmt2", "activity": [ { "ec_number": "2.1.1.319", "activity": "L-arginyl-[protein] + 2 S-adenosyl-L-methionine = 2 H(+) + N(omega),N(omega)-dimethyl-L-arginyl-[protein] + 2 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q9R144", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R144" } ] }, { "ec_number": "2.1.1.319", "activity": "", "evidence": [ { "id": "Q9R144", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9R144" } ] } ] }, { "uniprot_ac": "Q9VH48", "gene_name": "Art4", "activity": [ { "ec_number": "2.1.1.319", "activity": "L-arginyl-[protein] + 2 S-adenosyl-L-methionine = 2 H(+) + N(omega),N(omega)-dimethyl-L-arginyl-[protein] + 2 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q9VH48", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VH48" } ] }, { "ec_number": "2.1.1.319", "activity": "", "evidence": [ { "id": "Q9VH48", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VH48" } ] } ] }, { "uniprot_ac": "Q9WVG6", "gene_name": "Carm1", "activity": [ { "ec_number": "2.1.1.319", "activity": "L-arginyl-[protein] + 2 S-adenosyl-L-methionine = 2 H(+) + N(omega),N(omega)-dimethyl-L-arginyl-[protein] + 2 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q9WVG6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WVG6" } ] }, { "ec_number": "2.1.1.319", "activity": "", "evidence": [ { "id": "Q9WVG6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WVG6" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [ 25, 27, 87, 171 ], "sequon_annotation_sites": [ { "start_pos": 155, "end_pos": 157 }, { "start_pos": 522, "end_pos": 524 }, { "start_pos": 523, "end_pos": 525 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 43 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }