{ "uniprot_canonical_ac": "O60673-1", "uniprot_ac": "O60673", "uniprot_id": "REV3L_HUMAN", "mass": { "chemical_mass": 352776.0, "monoisotopic_mass": 352776.0 }, "refseq": { "ac": "NP_001273360", "name": "DNA polymerase zeta catalytic subunit isoform b", "summary": "The protein encoded by this gene represents the catalytic subunit of DNA polymerase zeta, which functions in translesion DNA synthesis. The encoded protein can be found in mitochondria, where it protects DNA from damage. Defects in this gene are a cause of Mobius syndrome. [provided by RefSeq, Jan 2017].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273360" }, "gene_names": [ { "name": "REV3L", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O60673", "id": "O60673" }, { "name": "POLZ; REV3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273360", "id": "NP_001273360" }, { "name": "POLZ", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O60673", "id": "O60673" }, { "name": "REV3L", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273360", "id": "NP_001273360" }, { "name": "REV3", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O60673", "id": "O60673" } ], "protein_names": [ { "name": "DNA polymerase zeta catalytic subunit", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O60673" }, { "name": "2.7.7.7", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O60673" }, { "name": "DNA polymerase zeta catalytic subunit isoform b", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273360", "id": "NP_001273360" }, { "name": "Protein reversionless 3-like", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O60673" }, { "name": "REV3-like", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O60673" }, { "name": "Rev-3, yeast, homolog-like (polymerase, DNA, zeta); DNA polymerase zeta catalytic subunit; REV3-like, polymerase (DNA directed), zeta, catalytic subunit", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273360", "id": "NP_001273360" }, { "name": "hREV3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O60673" } ], "function": [ { "annotation": "Catalytic subunit of the DNA polymerase zeta complex, an error-prone polymerase specialized in translesion DNA synthesis (TLS). Lacks an intrinsic 3'-5' exonuclease activity and thus has no proofreading function.", "evidence": [ { "database": "UniProtKB", "id": "O60673", "url": "https://www.uniprot.org/uniprot/O60673#function" }, { "database": "PubMed", "id": "24449906", "url": "https://glygen.org/publication/PubMed/24449906" } ] }, { "annotation": "DNA polymerase zeta contributes to heterochromatin replication to prevent genome instability.", "evidence": [ { "database": "RefSeq", "id": "NP_001273360", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273360" }, { "database": "PubMed", "id": "34533226", "url": "https://glygen.org/publication/PubMed/34533226" } ] }, { "annotation": "Disruption of DNA polymerase zeta engages an innate immune response.", "evidence": [ { "database": "RefSeq", "id": "NP_001273360", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273360" }, { "database": "PubMed", "id": "33626348", "url": "https://glygen.org/publication/PubMed/33626348" } ] }, { "annotation": "REV1-Polzeta maintains the viability of homologous recombination-deficient cancer cells through mutagenic repair of PRIMPOL-dependent ssDNA gaps.", "evidence": [ { "database": "RefSeq", "id": "NP_001273360", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273360" }, { "database": "PubMed", "id": "34508659", "url": "https://glygen.org/publication/PubMed/34508659" } ] }, { "annotation": "REV3L single nucleotide variants lead to increased susceptibility towards non-small cell lung cancer in the population of Jammu and Kashmir.", "evidence": [ { "database": "RefSeq", "id": "NP_001273360", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273360" }, { "database": "PubMed", "id": "34655923", "url": "https://glygen.org/publication/PubMed/34655923" } ] }, { "annotation": "The Protexin complex counters resection on stalled forks to promote homologous recombination and crosslink repair.", "evidence": [ { "database": "RefSeq", "id": "NP_001273360", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273360" }, { "database": "PubMed", "id": "34597596", "url": "https://glygen.org/publication/PubMed/34597596" } ] }, { "annotation": "The protein encoded by this gene represents the catalytic subunit of DNA polymerase zeta, which functions in translesion DNA synthesis. The encoded protein can be found in mitochondria, where it protects DNA from damage. Defects in this gene are a cause of Mobius syndrome. [provided by RefSeq, Jan 2017].", "evidence": [ { "database": "RefSeq", "id": "NP_001273360", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273360" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs1368445956", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1368445956" }, { "id": "rs1368445956", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1368445956#frequency_tab" }, { "id": "rs1368445956", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1368445956" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 2237, "end_pos": 2237, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SNT->NNT); o-glyco-site-loss (S->N).", "chr_id": "6", "chr_pos": "111365308", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S2237", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1347000020", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1347000020" }, { "id": "rs1347000020", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1347000020" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 1043, "end_pos": 1043, "sequence_org": "K", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (KKS->NKS).", "chr_id": "6", "chr_pos": "111375226", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "K1043", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O60673", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O60673" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1217, "end_pos": 1217, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "K", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NEK->NET).", "chr_id": "6", "chr_pos": "111374705", "ref_nt": "T", "alt_nt": "G", "minor_allelic_frequency": "", "site_lbl": "K1217", "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1281095591", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1281095591" }, { "id": "rs1281095591", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1281095591#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 1303, "end_pos": 1303, "sequence_org": "K", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (KKS->NKS).", "chr_id": "6", "chr_pos": "111374446", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "K1303", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs747489745", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747489745" }, { "id": "rs747489745", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747489745" }, { "id": "rs747489745", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs747489745#frequency_tab" }, { "id": "rs747489745", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs747489745" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1360, "end_pos": 1360, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DLS->NLS).", "chr_id": "6", "chr_pos": "111374277", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D1360", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1420779234", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1420779234" }, { "id": "rs1420779234", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1420779234#frequency_tab" }, { "id": "rs1420779234", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1420779234" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1387, "end_pos": 1387, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NAN->NAS).", "chr_id": "6", "chr_pos": "111374195", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N1387", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1169909611", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1169909611" }, { "id": "rs1169909611", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1169909611" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1389, "end_pos": 1389, "sequence_org": "I", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NNI->NNT).", "chr_id": "6", "chr_pos": "111374189", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "I1389", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O60673", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O60673" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 1437, "end_pos": 1437, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "K", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (KHS->NHS).", "chr_id": "6", "chr_pos": "111374044", "ref_nt": "C", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "K1437", "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs146767273", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs146767273" }, { "id": "rs146767273", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs146767273" }, { "id": "rs146767273", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs146767273" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1448, "end_pos": 1448, "sequence_org": "A", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NTA->NTT).", "chr_id": "6", "chr_pos": "111374013", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A1448", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs775832892", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775832892" }, { "id": "rs775832892", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775832892" }, { "id": "rs775832892", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs775832892" }, { "id": "rs775832892", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs775832892" } ], "glycoeffect": [ "n-glyco-sequon-loss", "n-glyco-sequon-gain" ], "start_pos": 1560, "end_pos": 1560, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NKN->NKS).", "chr_id": "6", "chr_pos": "111373676", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N1560", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs149987536", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149987536" }, { "id": "rs149987536", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149987536" }, { "id": "rs149987536", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs149987536#frequency_tab" }, { "id": "rs149987536", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs149987536" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1618, "end_pos": 1618, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DDS->NDS).", "chr_id": "6", "chr_pos": "111373503", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D1618", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1414577012", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1414577012" }, { "id": "rs1414577012", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1414577012#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 1730, "end_pos": 1730, "sequence_org": "K", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (KST->NST).", "chr_id": "6", "chr_pos": "111373165", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "K1730", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O60673", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O60673" } ], "glycoeffect": [], "start_pos": 1832, "end_pos": 1832, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "V", "sequence_mut": "M", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "6", "chr_pos": "111372861", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "V1832", "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] }, { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] }, { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1034585243", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1034585243" }, { "id": "rs1034585243", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1034585243#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1847, "end_pos": 1847, "sequence_org": "M", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NDM->NDT).", "chr_id": "6", "chr_pos": "111372815", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "M1847", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O60673", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O60673" } ], "glycoeffect": [], "start_pos": 1873, "end_pos": 1873, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "R", "sequence_mut": "Q", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "6", "chr_pos": "111372737", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "R1873", "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] }, { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] }, { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs762925824", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762925824" }, { "id": "rs762925824", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs762925824" }, { "id": "rs762925824", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs762925824" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1898, "end_pos": 1898, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DLS->NLS).", "chr_id": "6", "chr_pos": "111372663", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D1898", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs538880073", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs538880073" }, { "id": "rs538880073", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs538880073" }, { "id": "rs538880073", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs538880073" }, { "id": "rs538880073", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs538880073" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 189, "end_pos": 189, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SNT->NNT).", "chr_id": "6", "chr_pos": "111392972", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "S189", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O60673", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O60673" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1943, "end_pos": 1943, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "D", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (DFS->NFS).", "chr_id": "6", "chr_pos": "111367961", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "D1943", "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs375616016", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs375616016" }, { "id": "rs375616016", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs375616016" }, { "id": "rs375616016", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs375616016" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 1981, "end_pos": 1981, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SNS->NNS).", "chr_id": "6", "chr_pos": "111367846", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S1981", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1427170535", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1427170535" }, { "id": "rs1427170535", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1427170535#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1984, "end_pos": 1984, "sequence_org": "P", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NSP->NSS).", "chr_id": "6", "chr_pos": "111367838", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P1984", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1042216546", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1042216546" }, { "id": "rs1042216546", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1042216546#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 2054, "end_pos": 2054, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DVS->NVS).", "chr_id": "6", "chr_pos": "111367628", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D2054", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs768537155", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768537155" }, { "id": "rs768537155", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768537155" }, { "id": "rs768537155", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768537155" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 2237, "end_pos": 2237, "sequence_org": "S", "sequence_mut": "G", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->G).", "chr_id": "6", "chr_pos": "111365309", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S2237", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs746987974", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746987974" }, { "id": "rs746987974", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746987974" }, { "id": "rs746987974", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746987974" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 2239, "end_pos": 2239, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (TDT->NDT).", "chr_id": "6", "chr_pos": "111365302", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T2239", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O60673", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O60673" }, { "id": "rs1304019272", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1304019272" }, { "id": "rs1304019272", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1304019272#frequency_tab" }, { "id": "rs1304019272", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1304019272" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 2260, "end_pos": 2260, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "P", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NTP->NTT).", "chr_id": "6", "chr_pos": "111363954", "ref_nt": "G", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "P2260", "disease": [ { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] }, { "evidence": [ { "id": "O60673", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O60673" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 2328, "end_pos": 2328, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "I", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (ISS->NSS).", "chr_id": "6", "chr_pos": "111358911", "ref_nt": "A", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "I2328", "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs747401833", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747401833" }, { "id": "rs747401833", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747401833" }, { "id": "rs747401833", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs747401833" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 2351, "end_pos": 2351, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DKT->NKT).", "chr_id": "6", "chr_pos": "111358843", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D2351", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O60673", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O60673" } ], "glycoeffect": [], "start_pos": 2375, "end_pos": 2375, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "E", "sequence_mut": "K", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "6", "chr_pos": "111357075", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "E2375", "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] }, { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] }, { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1295966283", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1295966283" }, { "id": "rs1295966283", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1295966283#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 2607, "end_pos": 2607, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SNS->NNS).", "chr_id": "6", "chr_pos": "111333228", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S2607", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs907940388", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs907940388" }, { "id": "rs907940388", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs907940388#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 2901, "end_pos": 2901, "sequence_org": "K", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (KAS->NAS).", "chr_id": "6", "chr_pos": "111311161", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "K2901", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1433457228", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1433457228" }, { "id": "rs1433457228", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1433457228#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 2997, "end_pos": 2997, "sequence_org": "I", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (IFS->NFS).", "chr_id": "6", "chr_pos": "111309905", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "I2997", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs367810387", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs367810387" }, { "id": "rs367810387", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs367810387" }, { "id": "rs367810387", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs367810387#frequency_tab" }, { "id": "rs367810387", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs367810387" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 3105, "end_pos": 3105, "sequence_org": "P", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NCP->NCS).", "chr_id": "6", "chr_pos": "111300096", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P3105", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O60673", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O60673" }, { "id": "rs770651745", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770651745" }, { "id": "rs770651745", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770651745" }, { "id": "rs770651745", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770651745" }, { "id": "rs770651745", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs770651745" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 326, "end_pos": 326, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "D", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (DGS->NGS).", "chr_id": "6", "chr_pos": "111387885", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "D326", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] }, { "evidence": [ { "id": "rs1431964881", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1431964881" }, { "id": "rs1431964881", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1431964881" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 368, "end_pos": 368, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).", "chr_id": "6", "chr_pos": "111381439", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T368", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs768444821", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768444821" }, { "id": "rs768444821", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs768444821" }, { "id": "rs768444821", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs768444821" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 386, "end_pos": 386, "sequence_org": "M", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NLM->NLT).", "chr_id": "6", "chr_pos": "111381384", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "M386", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs867499237", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs867499237" }, { "id": "rs867499237", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs867499237" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 456, "end_pos": 456, "sequence_org": "P", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NEP->NES).", "chr_id": "6", "chr_pos": "111380070", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P456", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs867499237", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs867499237" }, { "id": "rs867499237", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs867499237" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 456, "end_pos": 456, "sequence_org": "P", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NEP->NET).", "chr_id": "6", "chr_pos": "111380070", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P456", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O60673", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O60673" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 484, "end_pos": 484, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "K", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (KRS->NRS).", "chr_id": "6", "chr_pos": "111379984", "ref_nt": "C", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "K484", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] }, { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1229190886", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1229190886" }, { "id": "rs1229190886", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1229190886" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 499, "end_pos": 499, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DDS->NDS).", "chr_id": "6", "chr_pos": "111377803", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D499", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O60673", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O60673" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 500, "end_pos": 500, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "D", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (DSS->NSS).", "chr_id": "6", "chr_pos": "111377800", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "D500", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1477191164", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1477191164" }, { "id": "rs1477191164", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1477191164#frequency_tab" }, { "id": "rs1477191164", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1477191164" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 511, "end_pos": 511, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DNS->NNS).", "chr_id": "6", "chr_pos": "111377767", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D511", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs199576619", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs199576619" }, { "id": "rs199576619", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs199576619" }, { "id": "rs199576619", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs199576619#frequency_tab" }, { "id": "rs199576619", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs199576619" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 518, "end_pos": 518, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SLS->NLS).", "chr_id": "6", "chr_pos": "111377745", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S518", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs370332269", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs370332269" }, { "id": "rs370332269", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs370332269" }, { "id": "rs370332269", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs370332269#frequency_tab" }, { "id": "rs370332269", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs370332269" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 552, "end_pos": 552, "sequence_org": "K", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (KLS->NLS).", "chr_id": "6", "chr_pos": "111376699", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "K552", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1490970587", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1490970587" }, { "id": "rs1490970587", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1490970587" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 700, "end_pos": 700, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NEN->NET).", "chr_id": "6", "chr_pos": "111376256", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N700", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs765610451", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765610451" }, { "id": "rs765610451", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs765610451" }, { "id": "rs765610451", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs765610451" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 788, "end_pos": 788, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SLS->NLS).", "chr_id": "6", "chr_pos": "111375992", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S788", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1280884870", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1280884870" }, { "id": "rs1280884870", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1280884870" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 827, "end_pos": 827, "sequence_org": "P", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NKP->NKS).", "chr_id": "6", "chr_pos": "111375876", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P827", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O60673", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O60673" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 827, "end_pos": 827, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "P", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NKP->NKT).", "chr_id": "6", "chr_pos": "111375876", "ref_nt": "G", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "P827", "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1582751163", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1582751163" }, { "id": "rs1582751163", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1582751163" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 878, "end_pos": 878, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (TKT->NKT).", "chr_id": "6", "chr_pos": "111375722", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T878", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs752047386", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752047386" }, { "id": "rs752047386", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752047386" }, { "id": "rs752047386", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs752047386" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 956, "end_pos": 956, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DGT->NGT).", "chr_id": "6", "chr_pos": "111375489", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D956", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [ { "start_pos": 2614, "end_pos": 2614, "sequence_org": "D", "sequence_mut": "N", "comment": "Loss of DNA polymerase catalytic activity; when associated with N-2783.", "evidence": [ { "database": "UniProtKB", "id": "O60673", "url": "https://www.uniprot.org/uniprot/O60673" }, { "database": "PubMed", "id": "24449906", "url": "https://glygen.org/publication/PubMed/24449906" } ] }, { "start_pos": 2783, "end_pos": 2783, "sequence_org": "D", "sequence_mut": "N", "comment": "Loss of DNA polymerase catalytic activity; when associated with N-2614.", "evidence": [ { "database": "UniProtKB", "id": "O60673", "url": "https://www.uniprot.org/uniprot/O60673" }, { "database": "PubMed", "id": "24449906", "url": "https://glygen.org/publication/PubMed/24449906" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "74.09", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000009413", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000009413" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "83.63", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000009413", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000009413" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "83.88", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000009413", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000009413" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "93.3", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000009413", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000009413" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "91.03", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000009413", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000009413" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "84.21", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000009413", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000009413" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "68.6", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000009413", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000009413" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "91.66", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000009413", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000009413" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "86.89", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000009413", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000009413" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "75.09", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000009413", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000009413" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "89.6", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000009413", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000009413" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "87.04", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000009413", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000009413" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "87.96", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000009413", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000009413" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O60673", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60673" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O60673", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60673" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O60673", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60673" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O60673", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60673" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O60673", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60673" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O60673", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60673" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O60673", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60673" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O60673", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60673" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O60673", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60673" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O60673", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60673" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O60673", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60673" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O60673", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60673" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O60673", "url": "https://www.uniprot.org/uniprot/O60673" } ], "common_name": "Human" } ], "gene": [ { "name": "REV3L", "url": "https://www.uniprot.org/uniprot/O60673", "locus": { "chromosome": "6", "start_pos": 111299028, "end_pos": 111483715, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000009413", "url": "https://www.ensembl.org/id/ENSG00000009413" } ] } } ], "crossref": [ { "id": "ENSG00000009413", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000009413", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "O60673", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O60673", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd05534", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd05534", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd05778", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd05778", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd22287", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd22287", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "REV3L", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=REV3L", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "5980", "url": "https://www.ncbi.nlm.nih.gov/gene/5980", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "9968", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=9968", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O60673", "url": "https://www.ebi.ac.uk/intact/interactors/id:O60673*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR006133", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006133", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006134", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006134", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006172", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006172", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR012337", "url": "https://www.ebi.ac.uk/interpro/entry/IPR012337", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017964", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017964", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR023211", "url": "https://www.ebi.ac.uk/interpro/entry/IPR023211", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR025687", "url": "https://www.ebi.ac.uk/interpro/entry/IPR025687", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR030559", "url": "https://www.ebi.ac.uk/interpro/entry/IPR030559", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR032757", "url": "https://www.ebi.ac.uk/interpro/entry/IPR032757", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036397", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036397", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR042087", "url": "https://www.ebi.ac.uk/interpro/entry/IPR042087", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043502", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043502", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "602776", "url": "http://www.omim.org/entry/602776", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O60673", "url": "https://www.nextprot.org/entry/NX_O60673", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "O60673", "url": "https://oglcnac.org/atlas/detail/O60673", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "O60673", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O60673", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "DPTSWIR", "url": "https://omabrowser.org/oma/group/DPTSWIR/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "211439at2759", "url": "http://www.orthodb.org/?query=211439at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR45812", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45812", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR45812:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45812:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "3ABD", "url": "https://www.rcsb.org/structure/3ABD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3ABE", "url": "https://www.rcsb.org/structure/3ABE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3VU7", "url": "https://www.rcsb.org/structure/3VU7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4EXT", "url": "https://www.rcsb.org/structure/4EXT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4GK0", "url": "https://www.rcsb.org/structure/4GK0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4GK5", "url": "https://www.rcsb.org/structure/4GK5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5O8K", "url": "https://www.rcsb.org/structure/5O8K", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6BC8", "url": "https://www.rcsb.org/structure/6BC8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6BCD", "url": "https://www.rcsb.org/structure/6BCD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6BI7", "url": "https://www.rcsb.org/structure/6BI7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6EKM", "url": "https://www.rcsb.org/structure/6EKM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6KEA", "url": "https://www.rcsb.org/structure/6KEA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6WS0", "url": "https://www.rcsb.org/structure/6WS0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6WS5", "url": "https://www.rcsb.org/structure/6WS5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00136", "url": "http://pfam.xfam.org/family/PF00136", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF03104", "url": "http://pfam.xfam.org/family/PF03104", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF14260", "url": "http://pfam.xfam.org/family/PF14260", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF15735", "url": "http://pfam.xfam.org/family/PF15735", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O60673", "url": "https://pharos.nih.gov/targets/O60673", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O60673", "url": "http://purl.obolibrary.org/obo/PR_O60673", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-110312", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-110312", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5655862", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5655862", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5656121", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5656121", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5656169", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5656169", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001273360", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273360", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "22508", "url": "https://www.rhea-db.org/rhea/22508", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "F2Z3A1", "url": "https://www.uniprot.org/uniprot/F2Z3A1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F2Z3A1-1", "url": "https://www.uniprot.org/uniprot/F2Z3A1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0Y5T4", "url": "https://www.uniprot.org/uniprot/H0Y5T4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0Y5T4-1", "url": "https://www.uniprot.org/uniprot/H0Y5T4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O60673", "url": "https://www.uniprot.org/uniprot/O60673", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O60673-1", "url": "https://www.uniprot.org/uniprot/O60673-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O60673-2", "url": "https://www.uniprot.org/uniprot/O60673-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MFSVRIVTADYYMASPLQGLDTCQSPLTQAPVKKVPVVRVFGATPAGQKTCLHLHGIFPYLYVPYDGYGQQPESYLSQMAFSIDRALNVALGNPSSTAQHVFKVSLVSGMPFYGYHEKERHFMKIYLYNPTMVKRICELLQSGAIMNKFYQPHEAHIPYLLQLFIDYNLYGMNLINLAAVKFRKARRKSNTLHATGSCKNHLSGNSLADTLFRWEQDEIPSSLILEGVEPQSTCELEVDAVAADILNRLDIEAQIGGNPGLQAIWEDEKQRRRNRNETSQMSQPESQDHRFVPATESEKKFQKRLQEILKQNDFSVTLSGSVDYSDGSQEFSAELTLHSEVLSPEMLQCTPANMVEVHKDKESSKGHTRHKVEEALINEEAILNLMENSQTFQPLTQRLSESPVFMDSSPDEALVHLLAGLESDGYRGERNRMPSPCRSFGNNKYPQNSDDEENEPQIEKEEMELSLVMSQRWDSNIEEHCAKKRSLCRNTHRSSTEDDDSSSGEEMEWSDNSLLLASLSIPQLDGTADENSDNPLNNENSRTHSSVIATSKLSVKPSIFHKDAATLEPSSSAKITFQCKHTSALSSHVLNKEDLIEDLSQTNKNTEKGLDNSVTSFTNESTYSMKYPGSLSSTVHSENSHKENSKKEILPVSSCESSIFDYEEDIPSVTRQVPSRKYTNIRKIEKDSPFIHMHRHPNENTLGKNSFNFSDLNHSKNKVSSEGNEKGNSTALSSLFPSSFTENCELLSCSGENRTMVHSLNSTADESGLNKLKIRYEEFQEHKTEKPSLSQQAAHYMFFPSVVLSNCLTRPQKLSPVTYKLQPGNKPSRLKLNKRKLAGHQETSTKSSETGSTKDNFIQNNPCNSNPEKDNALASDLTKTTRGAFENKTPTDGFIDCHFGDGTLETEQSFGLYGNKYTLRAKRKVNYETEDSESSFVTHNSKISLPHPMEIGESLDGTLKSRKRRKMSKKLPPVIIKYIIINRFRGRKNMLVKLGKIDSKEKQVILTEEKMELYKKLAPLKDFWPKVPDSPATKYPIYPLTPKKSHRRKSKHKSAKKKTGKQQRTNNENIKRTLSFRKKRSHAILSPPSPSYNAETEDCDLNYSDVMSKLGFLSERSTSPINSSPPRCWSPTDPRAEEIMAAAEKEAMLFKGPNVYKKTVNSRIGKTSRARAQIKKSKAKLANPSIVTKKRNKRNQTNKLVDDGKKKPRAKQKTNEKGTSRKHTTLKDEKIKSQSGAEVKFVLKHQNVSEFASSSGGSQLLFKQKDMPLMGSAVDHPLSASLPTGINAQQKLSGCFSSFLESKKSVDLQTFPSSRDDLHPSVVCNSIGPGVSKINVQRPHNQSAMFTLKESTLIQKNIFDLSNHLSQVAQNTQISSGMSSKIEDNANNIQRNYLSSIGKLSEYRNSLESKLDQAYTPNFLHCKDSQQQIVCIAEQSKHSETCSPGNTASEESQMPNNCFVTSLRSPIKQIAWEQKQRGFILDMSNFKPERVKPRSLSEAISQTKALSQCKNRNVSTPSAFGEGQSGLAVLKELLQKRQQKAQNANTTQDPLSNKHQPNKNISGSLEHNKANKRTRSVTSPRKPRTPRSTKQKEKIPKLLKVDSLNLQNSSQLDNSVSDDSPIFFSDPGFESCYSLEDSLSPEHNYNFDINTIGQTGFCSFYSGSQFVPADQNLPQKFLSDAVQDLFPGQAIEKNEFLSHDNQKCDEDKHHTTDSASWIRSGTLSPEIFEKSTIDSNENRRHNQWKNSFHPLTTRSNSIMDSFCVQQAEDCLSEKSRLNRSSVSKEVFLSLPQPNNSDWIQGHTRKEMGQSLDSANTSFTAILSSPDGELVDVACEDLELYVSRNNDMLTPTPDSSPRSTSSPSQSKNGSFTPRTANILKPLMSPPSREEIMATLLDHDLSETIYQEPFCSNPSDVPEKPREIGGRLLMVETRLANDLAEFEGDFSLEGLRLWKTAFSAMTQNPRPGSPLRSGQGVVNKGSSNSPKMVEDKKIVIMPCKCAPSRQLVQVWLQAKEEYERSKKLPKTKPTGVVKSAENFSSSVNPDDKPVVPPKMDVSPCILPTTAHTKEDVDNSQIALQAPTTGCSQTASESQMLPPVASASDPEKDEDDDDNYYISYSSPDSPVIPPWQQPISPDSKALNGDDRPSSPVEELPSLAFENFLKPIKDGIQKSPCSEPQEPLVISPINTRARTGKCESLCFHSTPIIQRKLLERLPEAPGLSPLSTEPKTQKLSNKKGSNTDTLRRVLLTQAKNQFAAVNTPQKETSQIDGPSLNNTYGFKVSIQNLQEAKALHEIQNLTLISVELHARTRRDLEPDPEFDPICALFYCISSDTPLPDTEKTELTGVIVIDKDKTVFSQDIRYQTPLLIRSGITGLEVTYAADEKALFHEIANIIKRYDPDILLGYEIQMHSWGYLLQRAAALSIDLCRMISRVPDDKIENRFAAERDEYGSYTMSEINIVGRITLNLWRIMRNEVALTNYTFENVSFHVLHQRFPLFTFRVLSDWFDNKTDLYRWKMVDHYVSRVRGNLQMLEQLDLIGKTSEMARLFGIQFLHVLTRGSQYRVESMMLRIAKPMNYIPVTPSVQQRSQMRAPQCVPLIMEPESRFYSNSVLVLDFQSLYPSIVIAYNYCFSTCLGHVENLGKYDEFKFGCTSLRVPPDLLYQVRHDITVSPNGVAFVKPSVRKGVLPRMLEEILKTRFMVKQSMKAYKQDRALSRMLDARQLGLKLIANVTFGYTSANFSGRMPCIEVGDSIVHKARETLERAIKLVNDTKKWGARVVYGDTDSMFVLLKGATKEQSFKIGQEIAEAVTATNPKPVKLKFEKVYLPCVLQTKKRYVGYMYETLDQKDPVFDAKGIETVRRDSCPAVSKILERSLKLLFETRDISLIKQYVQRQCMKLLEGKASIQDFIFAKEYRGSFSYKPGACVPALELTRKMLTYDRRSEPQVGERVPYVIIYGTPGVPLIQLVRRPVEVLQDPTLRLNATYYITKQILPPLARIFSLIGIDVFSWYHELPRIHKATSSSRSEPEGRKGTISQYFTTLHCPVCDDLTQHGICSKCRSQPQHVAVILNQEIRELERQQEQLVKICKNCTGCFDRHIPCVSLNCPVLFKLSRVNRELSKAPYLRQLLDQF", "length": 3130, "header": "sp|O60673-1|REV3L_HUMAN Isoform 1 of DNA polymerase zeta catalytic subunit OS=Homo sapiens OX=9606 GN=REV3L PE=1 SV=2 CANONICAL=O60673-1" }, "isoforms": [ { "isoform_ac": "F2Z3A1-1", "url": "", "sequence": { "sequence": "MFSVRIVTADYYMASPLQGLDTCQSPLTQAPVKKVPVVRVFGATPAE", "length": 47, "header": "tr|F2Z3A1-1|REV3L_HUMAN Computationally mapped isoform of DNA polymerase zeta catalytic subunit OS=Homo sapiens OX=9606 GN=REV3L PE=1 SV=1 CANONICAL=O60673-1" }, "locus": { "chromosome": "6", "start_pos": 111482888, "end_pos": 111472139, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000434009.5", "url": "https://www.ensembl.org/id/ENST00000434009.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000391605.1", "url": "https://www.ensembl.org/id/ENSP00000391605.1" } ] } }, { "isoform_ac": "H0Y5T4-1", "url": "", "sequence": { "sequence": "RPSSPVEELPSLAFENFLKPIKDGIQKSPCSEPQEPLVISPINTRARTGKCESLCFHSTPIIQRKLLERLPEAPGLSPLSTEPKTQKLSNKKGSNTDTLRRVLLTQAKNQFAAVNTPQKETSQIDGPSLNNTYGFKVSIQNLQEAKALHEISDIRLHYLLDLELQDSKSPMLLMRRHFFMKLQI", "length": 184, "header": "tr|H0Y5T4-1|REV3L_HUMAN Computationally mapped isoform of DNA polymerase zeta catalytic subunit OS=Homo sapiens OX=9606 GN=REV3L PE=1 SV=1 CANONICAL=O60673-1" }, "locus": { "chromosome": "6", "start_pos": 111367358, "end_pos": 111357024, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000413831.1", "url": "https://www.ensembl.org/id/ENST00000413831.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000400600.1", "url": "https://www.ensembl.org/id/ENSP00000400600.1" } ] } }, { "isoform_ac": "O60673-1", "url": "", "sequence": { "sequence": "MFSVRIVTADYYMASPLQGLDTCQSPLTQAPVKKVPVVRVFGATPAGQKTCLHLHGIFPYLYVPYDGYGQQPESYLSQMAFSIDRALNVALGNPSSTAQHVFKVSLVSGMPFYGYHEKERHFMKIYLYNPTMVKRICELLQSGAIMNKFYQPHEAHIPYLLQLFIDYNLYGMNLINLAAVKFRKARRKSNTLHATGSCKNHLSGNSLADTLFRWEQDEIPSSLILEGVEPQSTCELEVDAVAADILNRLDIEAQIGGNPGLQAIWEDEKQRRRNRNETSQMSQPESQDHRFVPATESEKKFQKRLQEILKQNDFSVTLSGSVDYSDGSQEFSAELTLHSEVLSPEMLQCTPANMVEVHKDKESSKGHTRHKVEEALINEEAILNLMENSQTFQPLTQRLSESPVFMDSSPDEALVHLLAGLESDGYRGERNRMPSPCRSFGNNKYPQNSDDEENEPQIEKEEMELSLVMSQRWDSNIEEHCAKKRSLCRNTHRSSTEDDDSSSGEEMEWSDNSLLLASLSIPQLDGTADENSDNPLNNENSRTHSSVIATSKLSVKPSIFHKDAATLEPSSSAKITFQCKHTSALSSHVLNKEDLIEDLSQTNKNTEKGLDNSVTSFTNESTYSMKYPGSLSSTVHSENSHKENSKKEILPVSSCESSIFDYEEDIPSVTRQVPSRKYTNIRKIEKDSPFIHMHRHPNENTLGKNSFNFSDLNHSKNKVSSEGNEKGNSTALSSLFPSSFTENCELLSCSGENRTMVHSLNSTADESGLNKLKIRYEEFQEHKTEKPSLSQQAAHYMFFPSVVLSNCLTRPQKLSPVTYKLQPGNKPSRLKLNKRKLAGHQETSTKSSETGSTKDNFIQNNPCNSNPEKDNALASDLTKTTRGAFENKTPTDGFIDCHFGDGTLETEQSFGLYGNKYTLRAKRKVNYETEDSESSFVTHNSKISLPHPMEIGESLDGTLKSRKRRKMSKKLPPVIIKYIIINRFRGRKNMLVKLGKIDSKEKQVILTEEKMELYKKLAPLKDFWPKVPDSPATKYPIYPLTPKKSHRRKSKHKSAKKKTGKQQRTNNENIKRTLSFRKKRSHAILSPPSPSYNAETEDCDLNYSDVMSKLGFLSERSTSPINSSPPRCWSPTDPRAEEIMAAAEKEAMLFKGPNVYKKTVNSRIGKTSRARAQIKKSKAKLANPSIVTKKRNKRNQTNKLVDDGKKKPRAKQKTNEKGTSRKHTTLKDEKIKSQSGAEVKFVLKHQNVSEFASSSGGSQLLFKQKDMPLMGSAVDHPLSASLPTGINAQQKLSGCFSSFLESKKSVDLQTFPSSRDDLHPSVVCNSIGPGVSKINVQRPHNQSAMFTLKESTLIQKNIFDLSNHLSQVAQNTQISSGMSSKIEDNANNIQRNYLSSIGKLSEYRNSLESKLDQAYTPNFLHCKDSQQQIVCIAEQSKHSETCSPGNTASEESQMPNNCFVTSLRSPIKQIAWEQKQRGFILDMSNFKPERVKPRSLSEAISQTKALSQCKNRNVSTPSAFGEGQSGLAVLKELLQKRQQKAQNANTTQDPLSNKHQPNKNISGSLEHNKANKRTRSVTSPRKPRTPRSTKQKEKIPKLLKVDSLNLQNSSQLDNSVSDDSPIFFSDPGFESCYSLEDSLSPEHNYNFDINTIGQTGFCSFYSGSQFVPADQNLPQKFLSDAVQDLFPGQAIEKNEFLSHDNQKCDEDKHHTTDSASWIRSGTLSPEIFEKSTIDSNENRRHNQWKNSFHPLTTRSNSIMDSFCVQQAEDCLSEKSRLNRSSVSKEVFLSLPQPNNSDWIQGHTRKEMGQSLDSANTSFTAILSSPDGELVDVACEDLELYVSRNNDMLTPTPDSSPRSTSSPSQSKNGSFTPRTANILKPLMSPPSREEIMATLLDHDLSETIYQEPFCSNPSDVPEKPREIGGRLLMVETRLANDLAEFEGDFSLEGLRLWKTAFSAMTQNPRPGSPLRSGQGVVNKGSSNSPKMVEDKKIVIMPCKCAPSRQLVQVWLQAKEEYERSKKLPKTKPTGVVKSAENFSSSVNPDDKPVVPPKMDVSPCILPTTAHTKEDVDNSQIALQAPTTGCSQTASESQMLPPVASASDPEKDEDDDDNYYISYSSPDSPVIPPWQQPISPDSKALNGDDRPSSPVEELPSLAFENFLKPIKDGIQKSPCSEPQEPLVISPINTRARTGKCESLCFHSTPIIQRKLLERLPEAPGLSPLSTEPKTQKLSNKKGSNTDTLRRVLLTQAKNQFAAVNTPQKETSQIDGPSLNNTYGFKVSIQNLQEAKALHEIQNLTLISVELHARTRRDLEPDPEFDPICALFYCISSDTPLPDTEKTELTGVIVIDKDKTVFSQDIRYQTPLLIRSGITGLEVTYAADEKALFHEIANIIKRYDPDILLGYEIQMHSWGYLLQRAAALSIDLCRMISRVPDDKIENRFAAERDEYGSYTMSEINIVGRITLNLWRIMRNEVALTNYTFENVSFHVLHQRFPLFTFRVLSDWFDNKTDLYRWKMVDHYVSRVRGNLQMLEQLDLIGKTSEMARLFGIQFLHVLTRGSQYRVESMMLRIAKPMNYIPVTPSVQQRSQMRAPQCVPLIMEPESRFYSNSVLVLDFQSLYPSIVIAYNYCFSTCLGHVENLGKYDEFKFGCTSLRVPPDLLYQVRHDITVSPNGVAFVKPSVRKGVLPRMLEEILKTRFMVKQSMKAYKQDRALSRMLDARQLGLKLIANVTFGYTSANFSGRMPCIEVGDSIVHKARETLERAIKLVNDTKKWGARVVYGDTDSMFVLLKGATKEQSFKIGQEIAEAVTATNPKPVKLKFEKVYLPCVLQTKKRYVGYMYETLDQKDPVFDAKGIETVRRDSCPAVSKILERSLKLLFETRDISLIKQYVQRQCMKLLEGKASIQDFIFAKEYRGSFSYKPGACVPALELTRKMLTYDRRSEPQVGERVPYVIIYGTPGVPLIQLVRRPVEVLQDPTLRLNATYYITKQILPPLARIFSLIGIDVFSWYHELPRIHKATSSSRSEPEGRKGTISQYFTTLHCPVCDDLTQHGICSKCRSQPQHVAVILNQEIRELERQQEQLVKICKNCTGCFDRHIPCVSLNCPVLFKLSRVNRELSKAPYLRQLLDQF", "length": 3130, "header": "sp|O60673-1|REV3L_HUMAN Isoform 1 of DNA polymerase zeta catalytic subunit OS=Homo sapiens OX=9606 GN=REV3L PE=1 SV=2 CANONICAL=O60673-1" }, "locus": { "chromosome": "6", "start_pos": 111482888, "end_pos": 111300019, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000358835.7", "url": "https://www.ensembl.org/id/ENST00000358835.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000351697.3", "url": "https://www.ensembl.org/id/ENSP00000351697.3" } ] } }, { "isoform_ac": "O60673-2", "url": "", "sequence": { "sequence": "MAFSIDRALNVALGNPSSTAQHVFKVSLVSGMPFYGYHEKERHFMKIYLYNPTMVKRICELLQSGAIMNKFYQPHEAHIPYLLQLFIDYNLYGMNLINLAAVKFRKARRKSNTLHATGSCKNHLSGNSLADTLFRWEQDEIPSSLILEGVEPQSTCELEVDAVAADILNRLDIEAQIGGNPGLQAIWEDEKQRRRNRNETSQMSQPESQDHRFVPATESEKKFQKRLQEILKQNDFSVTLSGSVDYSDGSQEFSAELTLHSEVLSPEMLQCTPANMVEVHKDKESSKGHTRHKVEEALINEEAILNLMENSQTFQPLTQRLSESPVFMDSSPDEALVHLLAGLESDGYRGERNRMPSPCRSFGNNKYPQNSDDEENEPQIEKEEMELSLVMSQRWDSNIEEHCAKKRSLCRNTHRSSTEDDDSSSGEEMEWSDNSLLLASLSIPQLDGTADENSDNPLNNENSRTHSSVIATSKLSVKPSIFHKDAATLEPSSSAKITFQCKHTSALSSHVLNKEDLIEDLSQTNKNTEKGLDNSVTSFTNESTYSMKYPGSLSSTVHSENSHKENSKKEILPVSSCESSIFDYEEDIPSVTRQVPSRKYTNIRKIEKDSPFIHMHRHPNENTLGKNSFNFSDLNHSKNKVSSEGNEKGNSTALSSLFPSSFTENCELLSCSGENRTMVHSLNSTADESGLNKLKIRYEEFQEHKTEKPSLSQQAAHYMFFPSVVLSNCLTRPQKLSPVTYKLQPGNKPSRLKLNKRKLAGHQETSTKSSETGSTKDNFIQNNPCNSNPEKDNALASDLTKTTRGAFENKTPTDGFIDCHFGDGTLETEQSFGLYGNKYTLRAKRKVNYETEDSESSFVTHNSKISLPHPMEIGESLDGTLKSRKRRKMSKKLPPVIIKYIIINRFRGRKNMLVKLGKIDSKEKQVILTEEKMELYKKLAPLKDFWPKVPDSPATKYPIYPLTPKKSHRRKSKHKSAKKKTGKQQRTNNENIKRTLSFRKKRSHAILSPPSPSYNAETEDCDLNYSDVMSKLGFLSERSTSPINSSPPRCWSPTDPRAEEIMAAAEKEAMLFKGPNVYKKTVNSRIGKTSRARAQIKKSKAKLANPSIVTKKRNKRNQTNKLVDDGKKKPRAKQKTNEKGTSRKHTTLKDEKIKSQSGAEVKFVLKHQNVSEFASSSGGSQLLFKQKDMPLMGSAVDHPLSASLPTGINAQQKLSGCFSSFLESKKSVDLQTFPSSRDDLHPSVVCNSIGPGVSKINVQRPHNQSAMFTLKESTLIQKNIFDLSNHLSQVAQNTQISSGMSSKIEDNANNIQRNYLSSIGKLSEYRNSLESKLDQAYTPNFLHCKDSQQQIVCIAEQSKHSETCSPGNTASEESQMPNNCFVTSLRSPIKQIAWEQKQRGFILDMSNFKPERVKPRSLSEAISQTKALSQCKNRNVSTPSAFGEGQSGLAVLKELLQKRQQKAQNANTTQDPLSNKHQPNKNISGSLEHNKANKRTRSVTSPRKPRTPRSTKQKEKIPKLLKVDSLNLQNSSQLDNSVSDDSPIFFSDPGFESCYSLEDSLSPEHNYNFDINTIGQTGFCSFYSGSQFVPADQNLPQKFLSDAVQDLFPGQAIEKNEFLSHDNQKCDEDKHHTTDSASWIRSGTLSPEIFEKSTIDSNENRRHNQWKNSFHPLTTRSNSIMDSFCVQQAEDCLSEKSRLNRSSVSKEVFLSLPQPNNSDWIQGHTRKEMGQSLDSANTSFTAILSSPDGELVDVACEDLELYVSRNNDMLTPTPDSSPRSTSSPSQSKNGSFTPRTANILKPLMSPPSREEIMATLLDHDLSETIYQEPFCSNPSDVPEKPREIGGRLLMVETRLANDLAEFEGDFSLEGLRLWKTAFSAMTQNPRPGSPLRSGQGVVNKGSSNSPKMVEDKKIVIMPCKCAPSRQLVQVWLQAKEEYERSKKLPKTKPTGVVKSAENFSSSVNPDDKPVVPPKMDVSPCILPTTAHTKEDVDNSQIALQAPTTGCSQTASESQMLPPVASASDPEKDEDDDDNYYISYSSPDSPVIPPWQQPISPDSKALNGDDRPSSPVEELPSLAFENFLKPIKDGIQKSPCSEPQEPLVISPINTRARTGKCESLCFHSTPIIQRKLLERLPEAPGLSPLSTEPKTQKLSNKKGSNTDTLRRVLLTQAKNQFAAVNTPQKETSQIDGPSLNNTYGFKVSIQNLQEAKALHEIQNLTLISVELHARTRRDLEPDPEFDPICALFYCISSDTPLPDTEKTELTGVIVIDKDKTVFSQDIRYQTPLLIRSGITGLEVTYAADEKALFHEIANIIKRYDPDILLGYEIQMHSWGYLLQRAAALSIDLCRMISRVPDDKIENRFAAERDEYGSYTMSEINIVGRITLNLWRIMRNEVALTNYTFENVSFHVLHQRFPLFTFRVLSDWFDNKTDLYRWKMVDHYVSRVRGNLQMLEQLDLIGKTSEMARLFGIQFLHVLTRGSQYRVESMMLRIAKPMNYIPVTPSVQQRSQMRAPQCVPLIMEPESRFYSNSVLVLDFQSLYPSIVIAYNYCFSTCLGHVENLGKYDEFKFGCTSLRVPPDLLYQVRHDITVSPNGVAFVKPSVRKGVLPRMLEEILKTRFMVKQSMKAYKQDRALSRMLDARQLGLKLIANVTFGYTSANFSGRMPCIEVGDSIVHKARETLERAIKLVNDTKKWGARVVYGDTDSMFVLLKGATKEQSFKIGQEIAEAVTATNPKPVKLKFEKVYLPCVLQTKKRYVGYMYETLDQKDPVFDAKGIETVRRDSCPAVSKILERSLKLLFETRDISLIKQYVQRQCMKLLEGKASIQDFIFAKEYRGSFSYKPGACVPALELTRKMLTYDRRSEPQVGERVPYVIIYGTPGVPLIQLVRRPVEVLQDPTLRLNATYYITKQILPPLARIFSLIGIDVFSWYHELPRIHKATSSSRSEPEGRKGTISQYFTTLHCPVCDDLTQHGICSKCRSQPQHVAVILNQEIRELERQQEQLVKICKNCTGCFDRHIPCVSLNCPVLFKLSRVNRELSKAPYLRQLLDQF", "length": 3052, "header": "sp|O60673-2|REV3L_HUMAN Isoform 2 of DNA polymerase zeta catalytic subunit OS=Homo sapiens OX=9606 GN=REV3L PE=1 SV=2 CANONICAL=O60673-1" }, "locus": { "chromosome": "6", "start_pos": 111416377, "end_pos": 111300019, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000435970.5", "url": "https://www.ensembl.org/id/ENST00000435970.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000402003.1", "url": "https://www.ensembl.org/id/ENSP00000402003.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 2237, "start_aa": "Ser", "end_pos": 2237, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser2237", "evidence": [ { "id": "O60673", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O60673" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "28411811", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28411811" }, { "id": "O60673", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O60673" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 368, "start_aa": "Thr", "end_pos": 368, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr368", "evidence": [ { "id": "O60673", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O60673" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "28411811", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28411811" }, { "id": "O60673", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O60673" } ] } ], "phosphorylation": [ { "start_pos": 1030, "end_pos": 1030, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O60673", "url": "https://www.uniprot.org/uniprot/O60673" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "iPTMnet", "id": "O60673", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60673" } ], "site_lbl": "Ser1030" }, { "start_pos": 1041, "end_pos": 1041, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "O60673", "url": "https://www.uniprot.org/uniprot/O60673" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "iPTMnet", "id": "O60673", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60673" } ], "site_lbl": "Thr1041" }, { "start_pos": 1579, "end_pos": 1579, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O60673", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60673" }, { "database": "PubMed", "id": "18767875", "url": "https://glygen.org/publication/PubMed/18767875" } ], "site_lbl": "Ser1579" }, { "start_pos": 1589, "end_pos": 1589, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O60673", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60673" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" } ], "site_lbl": "Thr1589" }, { "start_pos": 1724, "end_pos": 1724, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O60673", "url": "https://www.uniprot.org/uniprot/O60673" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O60673", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60673" } ], "site_lbl": "Ser1724" }, { "start_pos": 1842, "end_pos": 1842, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O60673", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60673" }, { "database": "PubMed", "id": "16094384", "url": "https://glygen.org/publication/PubMed/16094384" } ], "site_lbl": "Ser1842" }, { "start_pos": 1967, "end_pos": 1967, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O60673", "url": "https://www.uniprot.org/uniprot/O60673" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O60673", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60673" } ], "site_lbl": "Ser1967" }, { "start_pos": 2298, "end_pos": 2298, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O60673", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60673" }, { "database": "PubMed", "id": "16094384", "url": "https://glygen.org/publication/PubMed/16094384" }, { "database": "phospho.ELM", "id": "O60673", "url": "http://phospho.elm.eu.org/byAccession/O60673.html" } ], "site_lbl": "Thr2298" }, { "start_pos": 2522, "end_pos": 2522, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "O60673", "url": "http://phospho.elm.eu.org/byAccession/O60673.html" }, { "database": "iPTMnet", "id": "O60673", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60673" }, { "database": "PubMed", "id": "16094384", "url": "https://glygen.org/publication/PubMed/16094384" } ], "site_lbl": "Ser2522" }, { "start_pos": 470, "end_pos": 470, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O60673", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60673" }, { "database": "PubMed", "id": "18491316", "url": "https://glygen.org/publication/PubMed/18491316" } ], "site_lbl": "Ser470" }, { "start_pos": 582, "end_pos": 582, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O60673", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60673" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "phospho.ELM", "id": "O60673", "url": "http://phospho.elm.eu.org/byAccession/O60673.html" } ], "site_lbl": "Thr582" }, { "start_pos": 583, "end_pos": 583, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O60673", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60673" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "phospho.ELM", "id": "O60673", "url": "http://phospho.elm.eu.org/byAccession/O60673.html" } ], "site_lbl": "Ser583" } ], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "A full-length cDNA of hREV3 is predicted to encode DNA polymerase zeta for damage-induced mutagenesis in humans.", "journal": "Mutat. Res.", "date": "1999", "authors": "Lin W, Wu X, Wang Z", "evidence": [ { "database": "UniProtKB", "id": "O60673", "url": "https://www.uniprot.org/uniprot/O60673" } ], "reference": [ { "type": "PubMed", "id": "10102035", "url": "https://glygen.org/publication/PubMed/10102035" } ] }, { "title": "The human REV1 gene codes for a DNA template-dependent dCMP transferase.", "journal": "Nucleic acids research", "date": "1999", "authors": "Lin W, Xin H, Zhang Y, Wu X, Yuan F, Wang Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-110312", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-110312" } ], "reference": [ { "type": "PubMed", "id": "10536157", "url": "https://glygen.org/publication/PubMed/10536157" } ] }, { "title": "A human REV7 homolog that interacts with the polymerase zeta catalytic subunit hREV3 and the spindle assembly checkpoint protein hMAD2.", "journal": "J. Biol. Chem.", "date": "2000", "authors": "Murakumo Y, Roth T, Ishii H, Rasio D, Numata S, Croce CM, Fishel R", "evidence": [ { "database": "UniProtKB", "id": "O60673", "url": "https://www.uniprot.org/uniprot/O60673" }, { "database": "Reactome", "id": "R-HSA-110312", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-110312" } ], "reference": [ { "type": "PubMed", "id": "10660610", "url": "https://glygen.org/publication/PubMed/10660610" } ] }, { "title": "The function of the human homolog of Saccharomyces cerevisiae REV1 is required for mutagenesis induced by UV light.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2000", "authors": "Gibbs PE, Wang XD, Li Z, McManus TP, McGregor WG, Lawrence CW, Maher VM", "evidence": [ { "database": "Reactome", "id": "R-HSA-110312", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-110312" } ], "reference": [ { "type": "PubMed", "id": "10760286", "url": "https://glygen.org/publication/PubMed/10760286" } ] }, { "title": "Low fidelity DNA synthesis by human DNA polymerase-eta.", "journal": "Nature", "date": "2000", "authors": "Matsuda T, Bebenek K, Masutani C, Hanaoka F, Kunkel TA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5656169", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5656169" } ], "reference": [ { "type": "PubMed", "id": "10801132", "url": "https://glygen.org/publication/PubMed/10801132" } ] }, { "title": "Mechanisms of accurate translesion synthesis by human DNA polymerase eta.", "journal": "The EMBO journal", "date": "2000", "authors": "Masutani C, Kusumoto R, Iwai S, Hanaoka F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5656169", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5656169" } ], "reference": [ { "type": "PubMed", "id": "10856253", "url": "https://glygen.org/publication/PubMed/10856253" } ] }, { "title": "Error-prone bypass of certain DNA lesions by the human DNA polymerase kappa.", "journal": "Genes & development", "date": "2000", "authors": "Ohashi E, Ogi T, Kusumoto R, Iwai S, Masutani C, Hanaoka F, Ohmori H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5655862", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5655862" } ], "reference": [ { "type": "PubMed", "id": "10887153", "url": "https://glygen.org/publication/PubMed/10887153" } ] }, { "title": "Eukaryotic polymerases iota and zeta act sequentially to bypass DNA lesions.", "journal": "Nature", "date": "2000", "authors": "Johnson RE, Washington MT, Haracska L, Prakash S, Prakash L", "evidence": [ { "database": "Reactome", "id": "R-HSA-5656121", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5656121" } ], "reference": [ { "type": "PubMed", "id": "10984059", "url": "https://glygen.org/publication/PubMed/10984059" } ] }, { "title": "Fidelity and processivity of DNA synthesis by DNA polymerase kappa, the product of the human DINB1 gene.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Ohashi E, Bebenek K, Matsuda T, Feaver WJ, Gerlach VL, Friedberg EC, Ohmori H, Kunkel TA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5656169", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5656169" } ], "reference": [ { "type": "PubMed", "id": "11006276", "url": "https://glygen.org/publication/PubMed/11006276" } ] }, { "title": "Error-free and error-prone lesion bypass by human DNA polymerase kappa in vitro.", "journal": "Nucleic acids research", "date": "2000", "authors": "Zhang Y, Yuan F, Wu X, Wang M, Rechkoblit O, Taylor JS, Geacintov NE, Wang Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-5655862", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5655862" } ], "reference": [ { "type": "PubMed", "id": "11058110", "url": "https://glygen.org/publication/PubMed/11058110" } ] }, { "title": "Interactions in the error-prone postreplication repair proteins hREV1, hREV3, and hREV7.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Murakumo Y, Ogura Y, Ishii H, Numata S, Ichihara M, Croce CM, Fishel R, Takahashi M", "evidence": [ { "database": "Reactome", "id": "R-HSA-110312", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-110312" } ], "reference": [ { "type": "PubMed", "id": "11485998", "url": "https://glygen.org/publication/PubMed/11485998" } ] }, { "title": "Stimulation of DNA synthesis activity of human DNA polymerase kappa by PCNA.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Haracska L, Unk I, Johnson RE, Phillips BB, Hurwitz J, Prakash L, Prakash S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5655862", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5655862" } ], "reference": [ { "type": "PubMed", "id": "11784855", "url": "https://glygen.org/publication/PubMed/11784855" } ] }, { "title": "Response of human REV1 to different DNA damage: preferential dCMP insertion opposite the lesion.", "journal": "Nucleic acids research", "date": "2002", "authors": "Zhang Y, Wu X, Rechkoblit O, Geacintov NE, Taylor JS, Wang Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-110312", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-110312" } ], "reference": [ { "type": "PubMed", "id": "11917024", "url": "https://glygen.org/publication/PubMed/11917024" } ] }, { "title": "Human DNA polymerase kappa bypasses and extends beyond thymine glycols during translesion synthesis in vitro, preferentially incorporating correct nucleotides.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Fischhaber PL, Gerlach VL, Feaver WJ, Hatahet Z, Wallace SS, Friedberg EC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5655862", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5655862" } ], "reference": [ { "type": "PubMed", "id": "12145297", "url": "https://glygen.org/publication/PubMed/12145297" } ] }, { "title": "Role of human DNA polymerase kappa as an extender in translesion synthesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Haracska L, Prakash L, Prakash S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5656169", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5656169" } ], "reference": [ { "type": "PubMed", "id": "12444249", "url": "https://glygen.org/publication/PubMed/12444249" } ] }, { "title": "Mammalian translesion DNA synthesis across an acrolein-derived deoxyguanosine adduct. Participation of DNA polymerase eta in error-prone synthesis in human cells.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Yang IY, Miller H, Wang Z, Frank EG, Ohmori H, Hanaoka F, Moriya M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5656121", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5656121" } ], "reference": [ { "type": "PubMed", "id": "12584190", "url": "https://glygen.org/publication/PubMed/12584190" } ] }, { "title": "Human DNA polymerase kappa uses template-primer misalignment as a novel means for extending mispaired termini and for generating single-base deletions.", "journal": "Genes & development", "date": "2003", "authors": "Wolfle WT, Washington MT, Prakash L, Prakash S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5655862", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5655862" } ], "reference": [ { "type": "PubMed", "id": "12952891", "url": "https://glygen.org/publication/PubMed/12952891" } ] }, { "title": "Mouse Rev1 protein interacts with multiple DNA polymerases involved in translesion DNA synthesis.", "journal": "The EMBO journal", "date": "2003", "authors": "Guo C, Fischhaber PL, Luk-Paszyc MJ, Masuda Y, Zhou J, Kamiya K, Kisker C, Friedberg EC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5656121", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5656121" } ], "reference": [ { "type": "PubMed", "id": "14657033", "url": "https://glygen.org/publication/PubMed/14657033" } ] }, { "title": "Interaction of hREV1 with three human Y-family DNA polymerases.", "journal": "Genes to cells : devoted to molecular & cellular mechanisms", "date": "2004", "authors": "Ohashi E, Murakumo Y, Kanjo N, Akagi J, Masutani C, Hanaoka F, Ohmori H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5656121", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5656121" } ], "reference": [ { "type": "PubMed", "id": "15189446", "url": "https://glygen.org/publication/PubMed/15189446" } ] }, { "title": "Efficient and error-free replication past a minor-groove DNA adduct by the sequential action of human DNA polymerases iota and kappa.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Washington MT, Minko IG, Johnson RE, Wolfle WT, Harris TM, Lloyd RS, Prakash S, Prakash L", "evidence": [ { "database": "Reactome", "id": "R-HSA-5656121", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5656121" } ], "reference": [ { "type": "PubMed", "id": "15199127", "url": "https://glygen.org/publication/PubMed/15199127" } ] }, { "title": "Replication by human DNA polymerase-iota occurs by Hoogsteen base-pairing.", "journal": "Nature", "date": "2004", "authors": "Nair DT, Johnson RE, Prakash S, Prakash L, Aggarwal AK", "evidence": [ { "database": "Reactome", "id": "R-HSA-5656121", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5656121" } ], "reference": [ { "type": "PubMed", "id": "15254543", "url": "https://glygen.org/publication/PubMed/15254543" } ] }, { "title": "Quantitative analysis of translesion DNA synthesis across a benzo[a]pyrene-guanine adduct in mammalian cells: the role of DNA polymerase kappa.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Avkin S, Goldsmith M, Velasco-Miguel S, Geacintov N, Friedberg EC, Livneh Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-5655862", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5655862" } ], "reference": [ { "type": "PubMed", "id": "15475561", "url": "https://glygen.org/publication/PubMed/15475561" } ] }, { "title": "A single domain in human DNA polymerase iota mediates interaction with PCNA: implications for translesion DNA synthesis.", "journal": "Molecular and cellular biology", "date": "2005", "authors": "Haracska L, Acharya N, Unk I, Johnson RE, Hurwitz J, Prakash L, Prakash S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5656121", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5656121" } ], "reference": [ { "type": "PubMed", "id": "15657443", "url": "https://glygen.org/publication/PubMed/15657443" } ] }, { "title": "Quantitative phosphoproteome analysis using a dendrimer conjugation chemistry and tandem mass spectrometry.", "journal": "Nature methods", "date": "2005", "authors": "Tao WA, Wollscheid B, O'Brien R, Eng JK, Li XJ, Bodenmiller B, Watts JD, Hood L, Aebersold R", "evidence": [ { "database": "iPTMnet", "id": "O60673-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60673-1" } ], "reference": [ { "type": "PubMed", "id": "16094384", "url": "https://glygen.org/publication/PubMed/16094384" } ] }, { "title": "Ubiquitinated proliferating cell nuclear antigen activates translesion DNA polymerases eta and REV1.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Garg P, Burgers PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-110312", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-110312" } ], "reference": [ { "type": "PubMed", "id": "16344468", "url": "https://glygen.org/publication/PubMed/16344468" } ] }, { "title": "Ubiquitin-binding domains in Y-family polymerases regulate translesion synthesis.", "journal": "Science (New York, N.Y.)", "date": "2005", "authors": "Bienko M, Green CM, Crosetto N, Rudolf F, Zapart G, Coull B, Kannouche P, Wider G, Peter M, Lehmann AR, Hofmann K, Dikic I", "evidence": [ { "database": "Reactome", "id": "R-HSA-5656121", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5656121" } ], "reference": [ { "type": "PubMed", "id": "16357261", "url": "https://glygen.org/publication/PubMed/16357261" } ] }, { "title": "Rad18 regulates DNA polymerase kappa and is required for recovery from S-phase checkpoint-mediated arrest.", "journal": "Molecular and cellular biology", "date": "2006", "authors": "Bi X, Barkley LR, Slater DM, Tateishi S, Yamaizumi M, Ohmori H, Vaziri C", "evidence": [ { "database": "Reactome", "id": "R-HSA-5655862", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5655862" } ], "reference": [ { "type": "PubMed", "id": "16611994", "url": "https://glygen.org/publication/PubMed/16611994" } ] }, { "title": "Hoogsteen base pair formation promotes synthesis opposite the 1,N6-ethenodeoxyadenosine lesion by human DNA polymerase iota.", "journal": "Nature structural & molecular biology", "date": "2006", "authors": "Nair DT, Johnson RE, Prakash L, Prakash S, Aggarwal AK", "evidence": [ { "database": "Reactome", "id": "R-HSA-5656121", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5656121" } ], "reference": [ { "type": "PubMed", "id": "16819516", "url": "https://glygen.org/publication/PubMed/16819516" } ] }, { "title": "Human DNA polymerase kappa forms nonproductive complexes with matched primer termini but not with mismatched primer termini.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Carlson KD, Johnson RE, Prakash L, Prakash S, Washington MT", "evidence": [ { "database": "Reactome", "id": "R-HSA-5656169", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5656169" } ], "reference": [ { "type": "PubMed", "id": "17043239", "url": "https://glygen.org/publication/PubMed/17043239" } ] }, { "title": "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.", "journal": "Cell", "date": "2006", "authors": "Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M", "evidence": [ { "database": "iPTMnet", "id": "O60673-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60673-1" } ], "reference": [ { "type": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ] }, { "title": "A ubiquitin-binding motif in the translesion DNA polymerase Rev1 mediates its essential functional interaction with ubiquitinated proliferating cell nuclear antigen in response to DNA damage.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Wood A, Garg P, Burgers PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-110312", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-110312" } ], "reference": [ { "type": "PubMed", "id": "17517887", "url": "https://glygen.org/publication/PubMed/17517887" } ] }, { "title": "Comparative analysis of in vivo interactions between Rev1 protein and other Y-family DNA polymerases in animals and yeasts.", "journal": "DNA repair", "date": "2008", "authors": "Kosarek JN, Woodruff RV, Rivera-Begeman A, Guo C, D'Souza S, Koonin EV, Walker GC, Friedberg EC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5656121", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5656121" } ], "reference": [ { "type": "PubMed", "id": "18242152", "url": "https://glygen.org/publication/PubMed/18242152" } ] }, { "title": "Motif-specific sampling of phosphoproteomes.", "journal": "Journal of proteome research", "date": "2008", "authors": "Ruse CI, McClatchy DB, Lu B, Cociorva D, Motoyama A, Park SK, Yates JR 3rd", "evidence": [ { "database": "iPTMnet", "id": "O60673-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60673-1" } ], "reference": [ { "type": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" } ] }, { "title": "Phosphoproteome analysis of the human Chang liver cells using SCX and a complementary mass spectrometric strategy.", "journal": "Proteomics", "date": "2008", "authors": "Sui S, Wang J, Yang B, Song L, Zhang J, Chen M, Liu J, Lu Z, Cai Y, Chen S, Bi W, Zhu Y, He F, Qian X", "evidence": [ { "database": "iPTMnet", "id": "O60673-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60673-1" } ], "reference": [ { "type": "PubMed", "id": "18491316", "url": "https://glygen.org/publication/PubMed/18491316" } ] }, { "title": "Successive and selective release of phosphorylated peptides captured by hydroxy acid-modified metal oxide chromatography.", "journal": "Journal of proteome research", "date": "2008", "authors": "Kyono Y, Sugiyama N, Imami K, Tomita M, Ishihama Y", "evidence": [ { "database": "iPTMnet", "id": "O60673-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60673-1" } ], "reference": [ { "type": "PubMed", "id": "18767875", "url": "https://glygen.org/publication/PubMed/18767875" } ] }, { "title": "Two-polymerase mechanisms dictate error-free and error-prone translesion DNA synthesis in mammals.", "journal": "The EMBO journal", "date": "2009", "authors": "Shachar S, Ziv O, Avkin S, Adar S, Wittschieben J, Reissner T, Chaney S, Friedberg EC, Wang Z, Carell T, Geacintov N, Livneh Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-5656169", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5656169" } ], "reference": [ { "type": "PubMed", "id": "19153606", "url": "https://glygen.org/publication/PubMed/19153606" } ] }, { "title": "Identification of a novel REV1-interacting motif necessary for DNA polymerase kappa function.", "journal": "Genes to cells : devoted to molecular & cellular mechanisms", "date": "2009", "authors": "Ohashi E, Hanafusa T, Kamei K, Song I, Tomida J, Hashimoto H, Vaziri C, Ohmori H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5655862", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5655862" } ], "reference": [ { "type": "PubMed", "id": "19170759", "url": "https://glygen.org/publication/PubMed/19170759" } ] }, { "title": "Structure of human DNA polymerase kappa inserting dATP opposite an 8-OxoG DNA lesion.", "journal": "PloS one", "date": "2009", "authors": "Vasquez-Del Carpio R, Silverstein TD, Lone S, Swan MK, Choudhury JR, Johnson RE, Prakash S, Prakash L, Aggarwal AK", "evidence": [ { "database": "Reactome", "id": "R-HSA-5655862", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5655862" } ], "reference": [ { "type": "PubMed", "id": "19492058", "url": "https://glygen.org/publication/PubMed/19492058" } ] }, { "title": "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.", "journal": "Science signaling", "date": "2009", "authors": "Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK", "evidence": [ { "database": "UniProtKB", "id": "O60673", "url": "https://www.uniprot.org/uniprot/O60673" }, { "database": "iPTMnet", "id": "O60673", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60673" } ], "reference": [ { "type": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" } ] }, { "title": "Unconventional ubiquitin recognition by the ubiquitin-binding motif within the Y family DNA polymerases iota and Rev1.", "journal": "Molecular cell", "date": "2010", "authors": "Bomar MG, D'Souza S, Bienko M, Dikic I, Walker GC, Zhou P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5656121", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5656121" } ], "reference": [ { "type": "PubMed", "id": "20159559", "url": "https://glygen.org/publication/PubMed/20159559" } ] }, { "title": "Crystal structure of human REV7 in complex with a human REV3 fragment and structural implication of the interaction between DNA polymerase zeta and REV1.", "journal": "J. Biol. Chem.", "date": "2010", "authors": "Hara K, Hashimoto H, Murakumo Y, Kobayashi S, Kogame T, Unzai S, Akashi S, Takeda S, Shimizu T, Sato M", "evidence": [ { "database": "UniProtKB", "id": "O60673", "url": "https://www.uniprot.org/uniprot/O60673" }, { "database": "Reactome", "id": "R-HSA-110312", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-110312" } ], "reference": [ { "type": "PubMed", "id": "20164194", "url": "https://glygen.org/publication/PubMed/20164194" } ] }, { "title": "Error-free replicative bypass of thymine glycol by the combined action of DNA polymerases kappa and zeta in human cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Yoon JH, Bhatia G, Prakash S, Prakash L", "evidence": [ { "database": "Reactome", "id": "R-HSA-5655862", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5655862" } ], "reference": [ { "type": "PubMed", "id": "20660785", "url": "https://glygen.org/publication/PubMed/20660785" } ] }, { "title": "Bypass of N(2)-ethylguanine by human DNA polymerase kappa.", "journal": "DNA repair", "date": "2011", "authors": "Pence MG, Blans P, Zink CN, Fishbein JC, Perrino FW", "evidence": [ { "database": "Reactome", "id": "R-HSA-5655862", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5655862" } ], "reference": [ { "type": "PubMed", "id": "20952260", "url": "https://glygen.org/publication/PubMed/20952260" } ] }, { "title": "The role of hRev7, the accessory subunit of hPolzeta, in translesion synthesis past DNA damage induced by benzo[a]pyrene diol epoxide (BPDE).", "journal": "BMC cell biology", "date": "2010", "authors": "Neal JA, Fletcher KL, McCormick JJ, Maher VM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5656169", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5656169" } ], "reference": [ { "type": "PubMed", "id": "21143968", "url": "https://glygen.org/publication/PubMed/21143968" } ] }, { "title": "Proliferating cell nuclear antigen (PCNA)-associated KIAA0101/PAF15 protein is a cell cycle-regulated anaphase-promoting complex/cyclosome substrate.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2011", "authors": "Emanuele MJ, Ciccia A, Elia AE, Elledge SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5656169", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5656169" } ], "reference": [ { "type": "PubMed", "id": "21628590", "url": "https://glygen.org/publication/PubMed/21628590" } ] }, { "title": "Multifaceted recognition of vertebrate Rev1 by translesion polymerases zeta and kappa.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Wojtaszek J, Liu J, D'Souza S, Wang S, Xue Y, Walker GC, Zhou P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5655862", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5655862" } ], "reference": [ { "type": "PubMed", "id": "22700975", "url": "https://glygen.org/publication/PubMed/22700975" } ] }, { "title": "Replication of the 2,6-diamino-4-hydroxy-N(5)-(methyl)-formamidopyrimidine (MeFapy-dGuo) adduct by eukaryotic DNA polymerases.", "journal": "Chemical research in toxicology", "date": "2012", "authors": "Christov PP, Yamanaka K, Choi JY, Takata K, Wood RD, Guengerich FP, Lloyd RS, Rizzo CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5655862", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5655862" } ], "reference": [ { "type": "PubMed", "id": "22721435", "url": "https://glygen.org/publication/PubMed/22721435" } ] }, { "title": "Preferred WMSA catalytic mechanism of the nucleotidyl transfer reaction in human DNA polymerase kappa elucidates error-free bypass of a bulky DNA lesion.", "journal": "Nucleic acids research", "date": "2012", "authors": "Lior-Hoffmann L, Wang L, Wang S, Geacintov NE, Broyde S, Zhang Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5655862", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5655862" } ], "reference": [ { "type": "PubMed", "id": "22772988", "url": "https://glygen.org/publication/PubMed/22772988" } ] }, { "title": "Structural basis of Rev1-mediated assembly of a quaternary vertebrate translesion polymerase complex consisting of Rev1, heterodimeric polymerase (Pol) zeta, and Pol kappa.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Wojtaszek J, Lee CJ, D'Souza S, Minesinger B, Kim H, D'Andrea AD, Walker GC, Zhou P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5655862", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5655862" } ], "reference": [ { "type": "PubMed", "id": "22859295", "url": "https://glygen.org/publication/PubMed/22859295" } ] }, { "title": "Structural basis of recruitment of DNA polymerase zeta by interaction between REV1 and REV7 proteins.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Kikuchi S, Hara K, Shimizu T, Sato M, Hashimoto H", "evidence": [ { "database": "Reactome", "id": "R-HSA-110312", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-110312" } ], "reference": [ { "type": "PubMed", "id": "22859296", "url": "https://glygen.org/publication/PubMed/22859296" } ] }, { "title": "Systems-wide analysis of ubiquitylation dynamics reveals a key role for PAF15 ubiquitylation in DNA-damage bypass.", "journal": "Nature cell biology", "date": "2012", "authors": "Povlsen LK, Beli P, Wagner SA, Poulsen SL, Sylvestersen KB, Poulsen JW, Nielsen ML, Bekker-Jensen S, Mailand N, Choudhary C", "evidence": [ { "database": "Reactome", "id": "R-HSA-5656169", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5656169" } ], "reference": [ { "type": "PubMed", "id": "23000965", "url": "https://glygen.org/publication/PubMed/23000965" } ] }, { "title": "Structural insights into the assembly of human translesion polymerase complexes.", "journal": "Protein & cell", "date": "2012", "authors": "Xie W, Yang X, Xu M, Jiang T", "evidence": [ { "database": "Reactome", "id": "R-HSA-110312", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-110312" } ], "reference": [ { "type": "PubMed", "id": "23143872", "url": "https://glygen.org/publication/PubMed/23143872" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "O60673", "url": "https://www.uniprot.org/uniprot/O60673" }, { "database": "iPTMnet", "id": "O60673", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60673" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "p15(PAF) is an Rb/E2F-regulated S-phase protein essential for DNA synthesis and cell cycle progression.", "journal": "PloS one", "date": "2013", "authors": "Chang CN, Feng MJ, Chen YL, Yuan RH, Jeng YM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5656169", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5656169" } ], "reference": [ { "type": "PubMed", "id": "23593430", "url": "https://glygen.org/publication/PubMed/23593430" } ] }, { "title": "Human Pol zeta purified with accessory subunits is active in translesion DNA synthesis and complements Pol eta in cisplatin bypass.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2014", "authors": "Lee YS, Gregory MT, Yang W", "evidence": [ { "database": "UniProtKB", "id": "O60673", "url": "https://www.uniprot.org/uniprot/O60673" }, { "database": "Reactome", "id": "R-HSA-5656169", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5656169" } ], "reference": [ { "type": "PubMed", "id": "24449906", "url": "https://glygen.org/publication/PubMed/24449906" } ] }, { "title": "A role for DNA polymerase theta in promoting replication through oxidative DNA lesion, thymine glycol, in human cells.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Yoon JH, Roy Choudhury J, Park J, Prakash S, Prakash L", "evidence": [ { "database": "Reactome", "id": "R-HSA-5655862", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5655862" } ], "reference": [ { "type": "PubMed", "id": "24648516", "url": "https://glygen.org/publication/PubMed/24648516" } ] }, { "title": "Modification of PCNA by ISG15 plays a crucial role in termination of error-prone translesion DNA synthesis.", "journal": "Molecular cell", "date": "2014", "authors": "Park JM, Yang SW, Yu KR, Ka SH, Lee SW, Seol JH, Jeon YJ, Chung CH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5656169", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5656169" } ], "reference": [ { "type": "PubMed", "id": "24768535", "url": "https://glygen.org/publication/PubMed/24768535" } ] }, { "title": "A novel strategy for global mapping of O-GlcNAc proteins and peptides using selective enzymatic deglycosylation, HILIC enrichment and mass spectrometry identification.", "journal": "Talanta", "date": "2017", "authors": "Shen B, Zhang W, Shi Z, Tian F, Deng Y, Sun C, Wang G, Qin W, Qian X", "evidence": [ { "database": "O-GlcNAc Database", "id": "O60673", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O60673" } ], "reference": [ { "type": "PubMed", "id": "28411811", "url": "https://glygen.org/publication/PubMed/28411811" } ] }, { "title": "A triarylphosphine-trimethylpiperidine reagent for the one-step derivatization and enrichment of protein post-translational modifications and identification by mass spectrometry.", "journal": "Chemical communications (Cambridge, England)", "date": "2018", "authors": "Huo B, Zhang W, Zhao X, Dong H, Yu Y, Wang J, Qian X, Qin W", "evidence": [ { "database": "O-GlcNAc Database", "id": "O60673", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O60673" }, { "database": "O-GlcNAc Atlas", "id": "O60673", "url": "https://oglcnac.org/atlas/detail/O60673" } ], "reference": [ { "type": "PubMed", "id": "30379171", "url": "https://glygen.org/publication/PubMed/30379171" } ] }, { "title": "Disruption of DNA polymerase zeta engages an innate immune response.", "journal": "Cell reports", "date": "2021", "authors": "Martin SK, Tomida J, Wood RD", "evidence": [ { "database": "RefSeq", "id": "NP_001273360", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273360" } ], "reference": [ { "type": "PubMed", "id": "33626348", "url": "https://glygen.org/publication/PubMed/33626348" } ] }, { "title": "REV1-Polzeta maintains the viability of homologous recombination-deficient cancer cells through mutagenic repair of PRIMPOL-dependent ssDNA gaps.", "journal": "Molecular cell", "date": "2021", "authors": "Taglialatela A, Leuzzi G, Sannino V, Cuella-Martin R, Huang JW, Wu-Baer F, Baer R, Costanzo V, Ciccia A", "evidence": [ { "database": "RefSeq", "id": "NP_001273360", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273360" } ], "reference": [ { "type": "PubMed", "id": "34508659", "url": "https://glygen.org/publication/PubMed/34508659" } ] }, { "title": "DNA polymerase zeta contributes to heterochromatin replication to prevent genome instability.", "journal": "The EMBO journal", "date": "2021", "authors": "Ben Yamin B, Ahmed-Seghir S, Tomida J, Despras E, Pouvelle C, Yurchenko A, Goulas J, Corre R, Delacour Q, Droin N, Dessen P, Goidin D, Lange SS, Bhetawal S, Mitjavila-Garcia MT, Baldacci G, Nikolaev S, Cadoret JC, Wood RD, Kannouche PL", "evidence": [ { "database": "RefSeq", "id": "NP_001273360", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273360" } ], "reference": [ { "type": "PubMed", "id": "34533226", "url": "https://glygen.org/publication/PubMed/34533226" } ] }, { "title": "The Protexin complex counters resection on stalled forks to promote homologous recombination and crosslink repair.", "journal": "Molecular cell", "date": "2021", "authors": "Adeyemi RO, Willis NA, Elia AEH, Clairmont C, Li S, Wu X, D'Andrea AD, Scully R, Elledge SJ", "evidence": [ { "database": "RefSeq", "id": "NP_001273360", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273360" } ], "reference": [ { "type": "PubMed", "id": "34597596", "url": "https://glygen.org/publication/PubMed/34597596" } ] }, { "title": "REV3L single nucleotide variants lead to increased susceptibility towards non-small cell lung cancer in the population of Jammu and Kashmir.", "journal": "Cancer epidemiology", "date": "2021", "authors": "Jamwal RS, Mahajan N, Bhat GR, Bhat A, Shah R, Verma S, Sharma M, Sharma B, Qadri RA, Kumar R, Bhat A", "evidence": [ { "database": "RefSeq", "id": "NP_001273360", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001273360" } ], "reference": [ { "type": "PubMed", "id": "34655923", "url": "https://glygen.org/publication/PubMed/34655923" } ] }, { "title": "Detection of smoking-related covalent DNA adducts in human placenta.", "journal": "Science (New York, N.Y.)", "date": "1986", "authors": "Everson RB, Randerath E, Santella RM, Cefalo RC, Avitts TA, Randerath K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5655862", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5655862" } ], "reference": [ { "type": "PubMed", "id": "3941892", "url": "https://glygen.org/publication/PubMed/3941892" } ] }, { "title": "Thymine-thymine dimer bypass by yeast DNA polymerase zeta.", "journal": "Science (New York, N.Y.)", "date": "1996", "authors": "Nelson JR, Lawrence CW, Hinkle DC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5656169", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5656169" } ], "reference": [ { "type": "PubMed", "id": "8658138", "url": "https://glygen.org/publication/PubMed/8658138" } ] }, { "title": "Deoxycytidyl transferase activity of yeast REV1 protein.", "journal": "Nature", "date": "1996", "authors": "Nelson JR, Lawrence CW, Hinkle DC", "evidence": [ { "database": "Reactome", "id": "R-HSA-110312", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-110312" } ], "reference": [ { "type": "PubMed", "id": "8751446", "url": "https://glygen.org/publication/PubMed/8751446" } ] }, { "title": "A human homolog of the Saccharomyces cerevisiae REV3 gene, which encodes the catalytic subunit of DNA polymerase zeta.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1998", "authors": "Gibbs PE, McGregor WG, Maher VM, Nisson P, Lawrence CW", "evidence": [ { "database": "UniProtKB", "id": "O60673", "url": "https://www.uniprot.org/uniprot/O60673" } ], "reference": [ { "type": "PubMed", "id": "9618506", "url": "https://glygen.org/publication/PubMed/9618506" } ] }, { "title": "Alternative splicing, genomic structure, and fine chromosome localization of REV3L.", "journal": "Cytogenet. Cell Genet.", "date": "1998", "authors": "Morelli C, Mungall AJ, Negrini M, Barbanti-Brodano G, Croce CM", "evidence": [ { "database": "UniProtKB", "id": "O60673", "url": "https://www.uniprot.org/uniprot/O60673" } ], "reference": [ { "type": "PubMed", "id": "9925914", "url": "https://glygen.org/publication/PubMed/9925914" } ] } ], "pathway": [ { "id": "R-HSA-110312", "name": "Translesion synthesis by REV1", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-110312", "resource": "Reactome", "description": "Translesion synthesis by REV1" }, { "id": "R-HSA-5655862", "name": "Translesion synthesis by POLK", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5655862", "resource": "Reactome", "description": "Translesion synthesis by POLK" }, { "id": "R-HSA-5656121", "name": "Translesion synthesis by POLI", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5656121", "resource": "Reactome", "description": "Translesion synthesis by POLI" }, { "id": "R-HSA-5656169", "name": "Termination of translesion DNA synthesis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5656169", "resource": "Reactome", "description": "Termination of translesion DNA synthesis" } ], "orthologs": [ { "uniprot_canonical_ac": "F1M8G6-1", "protein_name": "DNA polymerase zeta catalytic subunit", "gene_name": "Rev3l", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MFSVRIVTADYYMASPLPGLDICQSPLTQHPVKKVPVVRVFGATPAGQKTCLHLHGVFPYLYVPYDGYGQQPERYLSQMALSIDRALNVALGNPSSTAQHVFKVSLVSGMPFYGYHEKERHFMKIYLYNPAMVKRICELLQSGAIMNKFYQPHEAHIPYLLQLFIDYNLYGMNLINLAAVKFRKARRKGDASHATGLFKPQLSGNSPAGTLFRWEEDEIPSSLLLEGVEPLSTCELEVDAVAADILNRLDIEAQIGGNPGLQAIWEDEKQRRRNRNENSQISQPESQDCRLVPATESEKIFQKRLQEILKQNDFSVTLSGSVDYSSGSQEFSAELTLHSEILSPEMLPCSPANMIEVHRDNDWSKGNTKHKVEEALINEEAILNLIENSQTFQPLTQRLSETPVFMDSSPDESLVHLLAGLESDGYQGEKNRMPLPRHTFGESQNPQNSDDEENAPQMEKEEMELSVLMSQRWDSDTEEQCAKKRSLCRNAHRSSTEEDDSSSEEEMEWTDNSLLFANLSIPQLDGTADENSDNPLNNENSRAHSSVIATSKLSVRPSVFHKDAATLEPPSSAKITFQCKHTSALSSHGLNKDDLIEGLSQPNNTEKGRDSSVTFTKESTYSMKYSGSLSSTVHSDNSHKEICKKDKSLPVPSCESSVFDYEEDIPSVTRQAPSRKYSNMRKIEKDAPFIHANRHTSESTLGKNSFNFADLNHSKNKLSSEGNERGNSTALNSVFPSSLAESCDLLSSSGENRSVAHSLDSITDESGRSKLKIRYEEFQEHKMERPSLSQQAAHYMFFPSVVLSNCLTRPQKLSPVTYKLQPGSKTSRLKLNKKKLISLQETSTKSSETGAAKDSCTHNHPYSGTPEKESGLSSDLIKATHGTFENKTPTEHFIDCHFGDGSLETEQSFGLYGNKYTLRAKRKVNYETEDSESSFVTHNSKISLPHPMEIGENLDGTLKSRKRRKMSKKLPPVIIKYIIINRFRGRKNMLVKLGKIDSKEKQVILTEEKMELYKKLAPLKDFWPKVPDSPATKYPIYPLTPKKSHRRKSKHKSAKRKPGKQHRASSENIKRTLSFRKKRTHAVLSPPSPSYIAETEDCDLNYSDVMSKLGFLSERSTSPVNSSPPRCWSPTDPRAEEIMAAAEKESVLFKGPNVCNTKTVSPRVGKASRARAQVKKSKARLAKSSVVTNKRNKRNQTNQLVDNGKKKPRAKQKQRANEKGISRKPVIPTDETTKPPSEAELTPSQRSVPELTSSSGIHTLSKQKEMTQTGPAMDHPLPPCQPTGINAQQRLSNCFSSFLESRKSVQFPTFPSSRGDSRSSVYSSIGPGVSKVNTQRSHSQSAMFTRKETTLIQKSIFDLSNHLSQVAQSTQLCSGIISPKTEESSNTQKNCGSSIGKLNEYRSSLESKPEKVCAPNFLHCRDSQQQTVNVSEQSKPSETCSPGNAASEESQTPNCFVTSLRSPIKQITWEQRQRGCILEMSSFKPEKVKQRSLSEAISQTKALSQCKNQNVSTPSVFGEGQSGLAVLKELLQKRQQKAQTTNVQDSASSHQPDKDISVSAEHKKTNKRTRAVASPRKPRAPRRTKPKEQTPRRLKVDPLNLQTSGHLDNSLSDDSPILFSDPGFESCYSLEDSLSPEHNYNFDINTIGQTGFCSLYSGSQFVPADQNLPQKFLSDAVQDLFPGQAIEKNELLSHDRQSCTEEKHHVSDSGPWVRASTLNPELFEKVGIDNNENHRHSQWKTSFHPLTSHSNSIMESFCVQQAESCLPEKSRLNRSSVSKEVFLSLPQASSSDWIQGHNGKEIEQSLDSANTSFTTVLSSPDGELVDAASEDLELYVSRNNDVLTPTPDSSPRSTSSPLQSKNGSFTPRTAHILKPLMSPPSREEIVATLLDHDLSEAIYQEPFCSNPSDVPEKPREIGGRLLMVETRLPNDLIEFEGDFSLEGLRLWKTAFSAMTQNPRPGSPLRNGPAVVNKESSNSHKTVEDKKIVIMPCRYAPSRQLVQAWLQAKEEYVRSKRLPRTESTPVIKSADNVSPSLNPGDTRAVAPQMDTCPHTLSSTAHAKEEVCQSQIALQTSRTGCGQTVSASQTLLPAASAAVPEEEEEEEEEEEEEEEDENGYVSYSSPDSPGIPPWQQAASPDFRALNGEHRCSSPVEELCSRAVENFLKPIKDGIQKASCCESQVISPIHARTRTEKCEPLCLHSTPVMPRKFLEKLPEATGLSPLSVEPKTQKLYNKKGSDTDHLRRVLLTTQVENQFAAVNTPKKETSQIDGPSLNNTYGFKVSIQNLQEAKALHEIQNLTLISVELHARTRRDLQPDPEFDPICALFYCISSDTPLPDTEKTELTGVIVIDKDKTVTHQDIRCQTPLLIRSGVTGLEVTYAADEKALFQEVTNIMKRYDPDILLGYEIQMHSWGYLLQRAAALSVDLCQMISRVPDDKIENRFAAERDDYGSDTMSEINIVGRITLNLWRIMRNEVALTNYTFENVSFHVLHQRFPLFTFRVLSDWFDNKTDLYRWKMVDHYVSRVRGNLQMLEQLDLIGKTSEMARLFGIQFLHVLTRGSQYRVESMMLRIAKPMNYIPVTPSVQQRSQMRAPQCVPLIMEPESRFYSNSVLVLDFQSLYPSIVIAYNYCFSTCLGHIENLGKYDEFKFGCTSLRVPPDLLYQIRHDITVSPNGVAFVKPSVRKGVLPRMLEEILKTRFMVKQSMKAYRQDRALSRMLNARQLGLKLIANVTFGYTSANFSGRMPCIEVGDSIVHKARETLERAIKLVNDTKKWGARVVYGDTDSMFVLLKGATKEQSFKIGQEIAEAVTATNPKPVKLKFEKVYLPCVLQTKKRYVGYMYETLDQKDPVFDAKGIETVRRDSCPAVSKILERSLKLLFETRDISLIKQYVQRQCMKLVEGKASIQDFIFAKEYRGSFSYRPGACVPALELTRKMLAYDRRSEPRVGERVPYVIVYGTPGLPLIQLIRRPAEVLQDPTLRLNATYYITKQILPPLARIFSLIGIDVFSWYQELPRIQKATSSSRSDLEGRKGTISQYFTTLHCPVCDGLTQHGICSQCRSQPQHVAIILNQEIRELERQQEQLVKICRNCTGSFDRHIPCVSLNCPVLFKLSRVNRELSKAPYLRQLLDQF", "length": 3132 }, "evidence": [ { "id": "45925958", "url": "http://www.informatics.jax.org/homology/45925958", "database": "MGI" }, { "id": "O60673", "url": "https://omabrowser.org/oma/group/O60673/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q61493-1", "protein_name": "DNA polymerase zeta catalytic subunit", "gene_name": "Rev3l", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MFSVRIVTADYYMASPLPGLDTCQSPLTQLPVKKVPVVRVFGATPAGQKTCLHLHGIFPYLYVPYDGYGQQPESYLSQMAFSIDRALNVALGNPSSTAQHVFKVSLVSGMPFYGYHEKERHFMKIYLYNPAMVKRICELLQSGAIMNKCYQPHEAHIPYLLQLFIDYNLYGMNLINLAAVKFRKARRKGNASHATGLFKHQLSGNSPAGTLFRWEEDEIPSSLLLEGVEPLSTCELEVDAVAADILNRLDIEAQIGGNPGLQAIWEDEKQRRRNRNESSQISQPESQDCRFVPATESEKQFQKRLQEVLKQNDFSVTLSGSVDYSNGSQEFSAELTLHSEILSPEMLPCSPANMIEVHKDTDLSKGNTKHKVEEALINEEAILNLIENSQTFQPLTQRLSETPVFMGSSPDESLVHLLAGLESDGYQGEKNRMPLPCHSFGESQNPQNSDDEENEPQIEKEEMELSVVMSQRWDSDIEEHCAKKRSLCRNAHRSSTEEDDSSSEEEMEWTDNSLLFANLSIPQLDGTADENSDNPLNNENSRAHSSVIATSKLSVRPSIFHKDAATLEPPSSAKITFQCKHTSALSSHVLNKDGLTEDLSQPNSTEKGRDNSVTFTKESTYSMKYSGSLSSTVHSDNSHKEICKKDKSLPVSSCESSVFDYEEDIPSVTRQVPSRKYSNMRKIEKDASCIHVNRHISETILGKNSFNFADLNHSKRKLSSEGNEKGNSTSLSGVFPSSLTENCDLLPSSGENRSMAHSLESITDESGLNKLKIRYEEFQEHKMEKPSLSQQAAHYMFFPSVVLSNCLTRPQKLSPVTYKLQSGNKPSRLKLNKKKLIGLQETSTKSTETGATKDSCTHNDLYTGASEKENGLSSDSAKATHGTFENKPPTEHFIDCHFGDGSLEAEQSFGLYGNKYTLRAKRKVNYETEDSESSFVTQNSKISLPHPMEIGENLDGTLKSRKRRKMSKKLPPVIIKYIIINRFRGRKNMLVKLGKIDSKEKQVILTEEKMELYKKLAPLKDFWPKVPDSPATKYPIYPLTPKKSHRRKSKHKSAKKKPGKQHRTNSENIKRTLSFRKKRTHAVLSPPSPSYIAETEDCDLSYSDVMSKLGFLSERSTSPINSSPPRCWSPTDPRAEEIMAAAEKESMLFKGPNVYNTKTVSPRVGKASRARAQVKKSKARLANSSVVTNKRNKRNQTTKLVDDGKKKPRAKQKQRANEKSLSRKHAIPADEKMKPHSEAELTPNHQSVSELTSSSGAQALSKQKEMSQTGPAVDHPLPPAQPTGISAQQRLSNCFSSFLESKKSVDLRTFPSSRDDSHSSVVYSSIGPGISKINIQRSHNQSAMFTRKETTLIQKSIFDLSNHLSQVAQSTQVCSGIISPKTEESSSTQKNCGSSMGKLNEYRSSLESKPEQVCAPNFLHCKDSQQQTVSVSEQSKTSETCSPGNAASEESQTPNCFVTSLKSPIKQIAWEQKQRGFILDMSNFKPEKVKQRSLSEAISQTKALSQCKNQNVSTPSVFGEGQSGLAVLKELLQKRQQKAQSTNVVQDSTSTHQPDKNISVSNEHKKANKRTRPVTSPRKPRTPRRTKPKEQTPRRLKVDPLNLQTSGHLDNSLSDDSPILFSDPGFESCYSLEDSLSPEHNYNFDINTIGQTGFCSFYSGSQFVPADQNLPQKFLSDAVQDLFPGQAIDKSELLSHDRQSCSEEKHHVSDSSPWIRASTLNPELFEKVAMDNNENHRHSQWKNSFHPLTSHSNSIMESFCVQQAENCLTEKSRLNRSSVSKEVFLSLPQANSSDWIQGHNRKEADQSLHSANTSFTTILSSPDGELVDAASEDLELYVSRNNDVLTPTPDSSPRSTSSPLQSKNGSFTPRTAHILKPLMSPPSREEIVATLLDHDLSEAIYQEPFCSNPSDVPEKPREIGGRLLMVETRLPNDLIEFEGDFSLEGLRLWKTAFSAMTQNPRPGSPLRNGQAVVNKESSNSHKMVEDKKIVIMPCKYAPSRQLVQAWLQAKEEYERSKKLPKTELTPVTKSAENVSPSLNPGDTCAVSPQVDKCPHTLSSSAHTKEEVSKSQIALQTSTTGCSQTLLAAASAAVPEEDEDDNDNCYVSYSSPDSPGIPPWQQAASPDFRSLNGDDRHSSPGKELCSLAVENFLKPIKDGIQKSSCSESWEPQVISPIHARARTGKWDPLCLHSTPVMQRKFLEKLPEATGLSPLSVEPKTQKLYNKKGSDADGLRRVLLTTQVENQFAAVNTPKKETSQIDGPSLNNTYGFKVSIQNLQEAKALHEIQNLTLISVELHARTRRDLQPDPEFDPICALFYCISSDTPLPDTEKTELTGVIVIDKDKTVTHQDIRSQTPLLIRSGITGLEVTYAADEKALFQEITNIIKRYDPDILLGYEIQMHSWGYLLQRAAALSVDLCQMISRVPDDKIENRFAAERDDYGSDTMSEINIVGRITLNLWRIMRNEVALTNYTFENVSFHVLHQRFPLFTFRVLSDWFDNKTDLYRWKMVDHYVSRVRGNLQMLEQLDLIGKTSEMARLFGIQFLHVLTRGSQYRVESMMLRIAKPMNYIPVTPSIQQRSQMRAPQCVPLIMEPESRFYSNSVLVLDFQSLYPSIVIAYNYCFSTCLGHVENLGKYDEFKFGCTSLRVPPDLLYQIRHDVTVSPNGVAFVKPSVRKGVLPRMLEEILKTRLMVKQSMKSYKQDRALSRMLNARQLGLKLIANVTFGYTAANFSGRMPCIEVGDSIVHKARETLERAIKLVNDTKKWGARVVYGDTDSMFVLLKGATKEQSFKIGQEIAEAVTATNPRPVKLKFEKVYLPCVLQTKKRYVGYMYETLDQKEPVFDAKGIETVRRDSCPAVSKILERSLKLLFETRDISLIKQYVQRQCMKLVEGKASIQDFIFAKEYRGSFSYRPGACVPALELTRKMLAYDRRSEPRVGERVPYVIIYGTPGLPLIQLIRRPAEVLQDPTLRLNATYYITKQILPPLARIFSLIGIDVFSWYQELPRIQKATSSSRSELEGRKGTISQYFTTLHCPVCDDLTQHGICSKCRSQPQHVAIILNQEIRELERKQEQLIKICRNCTGSFDRHIPCVSLNCPVLFKLSRVNRELSKAPYLRQLLDQF", "length": 3122 }, "evidence": [ { "id": "45925958", "url": "http://www.informatics.jax.org/homology/45925958", "database": "MGI" }, { "id": "O60673", "url": "https://omabrowser.org/oma/group/O60673/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 5, "go_terms": [ { "name": "DNA-directed DNA polymerase activity", "id": "GO:0003887", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003887", "evidence": [ { "database": "UniProtKB", "id": "O60673", "url": "https://www.uniprot.org/uniprot/O60673" } ], "pmid": "" }, { "name": "DNA binding", "id": "GO:0003677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "database": "UniProtKB", "id": "O60673", "url": "https://www.uniprot.org/uniprot/O60673" } ], "pmid": "" }, { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "O60673", "url": "https://www.uniprot.org/uniprot/O60673" } ], "pmid": "" }, { "name": "4 iron, 4 sulfur cluster binding", "id": "GO:0051539", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051539", "evidence": [ { "database": "UniProtKB", "id": "O60673", "url": "https://www.uniprot.org/uniprot/O60673" } ], "pmid": "" }, { "name": "nucleotide binding", "id": "GO:0000166", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000166", "evidence": [ { "database": "UniProtKB", "id": "O60673", "url": "https://www.uniprot.org/uniprot/O60673" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "O60673", "url": "https://www.uniprot.org/uniprot/O60673" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "O60673", "url": "https://www.uniprot.org/uniprot/O60673" } ], "pmid": "" }, { "name": "nucleolus", "id": "GO:0005730", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005730", "evidence": [ { "database": "UniProtKB", "id": "O60673", "url": "https://www.uniprot.org/uniprot/O60673" } ], "pmid": "" }, { "name": "zeta DNA polymerase complex", "id": "GO:0016035", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016035", "evidence": [ { "database": "UniProtKB", "id": "O60673", "url": "https://www.uniprot.org/uniprot/O60673" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "double-strand break repair via homologous recombination", "id": "GO:0000724", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000724", "evidence": [ { "database": "UniProtKB", "id": "O60673", "url": "https://www.uniprot.org/uniprot/O60673" } ], "pmid": "" }, { "name": "error-prone translesion synthesis", "id": "GO:0042276", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042276", "evidence": [ { "database": "UniProtKB", "id": "O60673", "url": "https://www.uniprot.org/uniprot/O60673" } ], "pmid": "" }, { "name": "DNA-templated DNA replication", "id": "GO:0006261", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006261", "evidence": [ { "database": "UniProtKB", "id": "O60673", "url": "https://www.uniprot.org/uniprot/O60673" } ], "pmid": "" }, { "name": "translesion synthesis", "id": "GO:0019985", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019985", "evidence": [ { "database": "UniProtKB", "id": "O60673", "url": "https://www.uniprot.org/uniprot/O60673" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 1102, "end_pos": 1104, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1122, "end_pos": 1124, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1195, "end_pos": 1197, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1247, "end_pos": 1249, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1341, "end_pos": 1343, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1513, "end_pos": 1515, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1545, "end_pos": 1547, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1560, "end_pos": 1562, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1608, "end_pos": 1610, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1778, "end_pos": 1780, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1794, "end_pos": 1796, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1815, "end_pos": 1817, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1867, "end_pos": 1869, "annotation": "n_glycosylation_sequon" }, { "start_pos": 2036, "end_pos": 2038, "annotation": "n_glycosylation_sequon" }, { "start_pos": 2273, "end_pos": 2275, "annotation": "n_glycosylation_sequon" }, { "start_pos": 2296, "end_pos": 2298, "annotation": "n_glycosylation_sequon" }, { "start_pos": 2478, "end_pos": 2480, "annotation": "n_glycosylation_sequon" }, { "start_pos": 2483, "end_pos": 2485, "annotation": "n_glycosylation_sequon" }, { "start_pos": 2507, "end_pos": 2509, "annotation": "n_glycosylation_sequon" }, { "start_pos": 2729, "end_pos": 2731, "annotation": "n_glycosylation_sequon" }, { "start_pos": 2738, "end_pos": 2740, "annotation": "n_glycosylation_sequon" }, { "start_pos": 2768, "end_pos": 2770, "annotation": "n_glycosylation_sequon" }, { "start_pos": 276, "end_pos": 278, "annotation": "n_glycosylation_sequon" }, { "start_pos": 2981, "end_pos": 2983, "annotation": "n_glycosylation_sequon" }, { "start_pos": 3088, "end_pos": 3090, "annotation": "n_glycosylation_sequon" }, { "start_pos": 619, "end_pos": 621, "annotation": "n_glycosylation_sequon" }, { "start_pos": 708, "end_pos": 710, "annotation": "n_glycosylation_sequon" }, { "start_pos": 713, "end_pos": 715, "annotation": "n_glycosylation_sequon" }, { "start_pos": 728, "end_pos": 730, "annotation": "n_glycosylation_sequon" }, { "start_pos": 753, "end_pos": 755, "annotation": "n_glycosylation_sequon" }, { "start_pos": 761, "end_pos": 763, "annotation": "n_glycosylation_sequon" }, { "start_pos": 887, "end_pos": 889, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "22508", "name": "", "equation": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q673L6-1", "Q5RKI3-1", "O54747-1", "O89042-1", "P06766-1", "Q9QYV8-1", "D3Z8X4-1", "E9PT58-1", "F1M8G6-1", "F7F6Z7-1", "Q07864-1", "P28340-1", "P06746-1", "Q9UGP5-1", "P54098-1", "Q9NP87-1", "P09884-1", "Q7Z5Q5-1", "O75417-1", "O00370-1", "Q9WJR5-1", "Q9UBT6-1", "O60673-1", "Q9UNA4-1", "Q9Y253-1", "P63135-1", "P10266-1", "P63132-1", "P63133-1", "P63136-1", "Q9UQG0-1", "Q9QC07-1", "P63128-1", "Q9BXR3-1", "P04053-1", "O14746-1", "P10400-1", "P11369-1", "P52431-1", "Q7TQ07-1", "Q9JIW4-1", "P54099-1", "Q8K409-1", "P33609-1", "Q9WVF7-1", "Q9QXE2-1", "Q8CGS6-1", "Q61493-1", "O70372-1", "P09838-2", "Q6R3M4-1", "Q9JJN0-1", "Q9QUG2-1", "P13382-1", "P14284-1", "P15436-1", "P15801-1", "P21951-1", "P25384-1", "P25615-1", "P46957-1", "Q04049-1", "Q06163-1", "A0A0B7P3V8-1", "O13527-1", "O13535-1", "P0C2I2-1", "P0C2I3-1", "P0C2I5-1", "P0C2I6-1", "P0C2I9-1", "P0C2J0-1", "P0C2J1-1", "P0C2J3-1", "P0C2J7-1", "P0CX63-1", "P0CX64-1", "Q99231-1", "P39985-1", "P47024-1", "P47098-1", "P47100-1", "Q12472-1", "Q03434-1", "Q03494-1", "Q03612-1", "Q03619-1", "Q03855-1", "Q04214-1", "Q04670-1", "Q04711-1", "Q07791-1", "Q07793-1", "Q12088-1", "Q12112-1", "Q12113-1", "Q12141-1", "Q12193-1", "Q12269-1", "Q12273-1", "Q12316-1", "Q12414-1", "Q12490-1", "Q12491-1", "Q12501-1", "Q7LHG5-1", "Q92393-1", "Q99315-1", "Q99337-1", "Q55AZ3-1", "Q1ZXF2-1", "Q54B44-1", "Q54N97-1", "Q54RD4-1", "Q54SV8-1", "Q9GSR1-1", "Q9VHV1-1", "Q9VNX1-1", "Q9VCN1-1", "P26019-1", "P54358-1", "Q27607-1", "O18475-1" ], "evidence": [ { "id": "22508", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/22508" } ] }, { "id": "R-HSA-110311", "name": "POLZ extends translesion synthesis", "equation": "", "summary": "After REV1 inserts a nucleotide directly opposite the template lesion, translesion synthesis (TLS) is continued by DNA polymerase zeta (POLZ), a complex of REV3L and MAD2L2 (REV3 and REV7 in yeast) (Nelson et al. 1996a, Neal et al. 2010). POLZ is a poorly processive enzyme in both yeast and humans and usually incorporates less than 30 nucleotides before it dissociates from the template. In human cells, the processivity of POLZ is increased in the presence of DNA polymerase delta (POLD) subunits POLD2 and POLD3, which act as accessory subunits for POLZ (Nelson et al. 1996b, Lee et al. 2014). POLZ is error-prone, especially in the context of TLS across AP (apurinic/apyrimidinic) sites, resulting in incorporation of mispaired dNTPs, which contributes to TLS-related mutagenesis (Shachar et al. 2009, Lee et al. 2014).", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [ "R-HSA-110279" ], "enzyme_list": [ "Q9UBZ9-1", "O60673-1" ], "evidence": [ { "id": "R-HSA-110311", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-110311" } ] }, { "id": "R-HSA-110322", "name": "Formation of Pol zeta complex", "equation": "", "summary": "REV3L (hREV3), the catalytic subunit of DNA polymerase zeta (POLZ) belonging to B family of DNA polymerases, binds the adapter protein MAD2L2 (hREV7) to form a functional POLZ complex (Murakamo et al. 2000, Murakamo et al. 2001, Hara et al. 2010).", "cellular_location": "nucleoplasm", "input_participant_list": [ "R-HSA-110278", "R-HSA-59092" ], "output_participant_list": [], "enzyme_list": [ "O60673-1" ], "evidence": [ { "id": "R-HSA-110322", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-110322" } ] }, { "id": "R-HSA-5652151", "name": "REV1 recruits POLZ to (AP:Cyt)-DNA Template", "equation": "", "summary": "REV1, bound to the replication complex, recruits DNA polymerase zeta (POLZ, REV3L:MAD2L2) to the damaged DNA template. REV3L does not bind REV1 directly. Instead, REV3L binding to MAD2L2 (REV7) during the formation of POLZ complex causes a conformational change in MAD2L2 that allows the C-terminal domain of MAD2L2 to bind the C-terminus of REV1 (Nelson et al. 1996, Hara et al. 2010, Kikuchi et al. 2012, Xie et al. 2012)", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9UBZ9-1", "O60673-1" ], "evidence": [ { "id": "R-HSA-5652151", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5652151" } ] }, { "id": "R-HSA-5655835", "name": "POLK forms a quaternary complex with REV1 and POLZ on damaged DNA template", "equation": "", "summary": "DNA polymerase kappa (POLK) forms a quaternary complex with REV1 and the DNA polymerase zeta (POLZ) heterodimer, composed of REV3L and MAD2L2 (REV7), at DNA damage sites (Ohashi et al. 2009, Wojtaszek et al. 2012a, Wojtaszek et al. 2012b, Xie et al. 2012). POLK simultaneously interacts with the C-terminus of REV1 through its RIR (REV1-interacting region) (Ohashi et al. 2009) and with monoubiquitinated PCNA (Haracska et al. 2002, Bi et al. 2006). POLK requires Mg2+ or Mn2+ for its activity. POLK is more catalytically active in the presence of Mn2+, but exhibits higher fidelity in the presence of Mg2+ (Pence et al. 2012)", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9UBZ9-1", "Q9UBT6-1", "O60673-1" ], "evidence": [ { "id": "R-HSA-5655835", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5655835" } ] }, { "id": "R-HSA-5655892", "name": "POLK incorporates dNMP opposite to damaged DNA base", "equation": "", "summary": "DNA polymerase kappa (POLK) is the most efficient in incorporation of nucleotides opposite to oxidation derivatives of DNA bases, such as thymine glycol (Tg) and 8-oxoguanine (OGUA). POLK preferentially incorporates dAMP opposite both Tg and OGUA, resulting in error-free translesion DNA synthesis (TLS) across Tg lesions (Fischhaber et al. 2002, Yoon et al. 2010, Yoon et al. 2014) and frequent G:C -> T:A transversions at OGUA lesions (Zhang et al. 2000, Vasquez-Del Carpio et al. 2009). POLK is also efficient in TLS across bulky DNA adducts, such as the smoking-related benzo(a)pyrene diol epoxide guanine adduct (BPDE-G) (Everson et al. 1986), and it correctly incorporates dCMP opposite to BPDE-G (Zhang et al. 2000, Avkin et al. 2004, Lior-Hoffmann et al. 2012, Christov et al. 2012). POLK is incapable of TLS across thymine-thymine dimers (Ohashi et al. 2000) and shows a very low efficiency in TLS across AP sites, where it mainly causes single base deletions (-1 frameshifts) through template-primer misalignment (Ohashi et al. 2000, Wolfle et al. 2003).", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9UBZ9-1", "Q9UBT6-1", "O60673-1" ], "evidence": [ { "id": "R-HSA-5655892", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5655892" } ] }, { "id": "R-HSA-5655965", "name": "POLK and POLZ cooperate in elongation of mispaired primer termini", "equation": "", "summary": "DNA polymerase kappa (POLK) can elongate mispaired primer termini generated when an incorrect nucleotide is incorporated opposite a damaged DNA base either by POLK or by another translesion DNA synthesis (TLS) polymerase (Haracska et al. 2002, Carlson et al. 2006). POLK can processively synthesize polynucleotide chains that are usually not more than 20 nucleotides long, generating single base substitutions at a rate of 7/1000 and single base deletions at a rate of 3/1000 (Ohashi et al. 2000). POLK and POLZ can cooperate in the elongation of nucleotides inserted opposite to lesioned bases by POLK (Yoon et al. 2010, Wojtaszek et al. 2012a, Wojtaszek et al. 2012b, Xie et al. 2012, Yoon et al. 2014)", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [ "R-HSA-3006726" ], "enzyme_list": [ "Q9UBZ9-1", "Q9UBT6-1", "O60673-1" ], "evidence": [ { "id": "R-HSA-5655965", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5655965" } ] }, { "id": "R-HSA-5656105", "name": "POLI simultaneously binds REV1 and monoUb:K164-PCNA at damaged DNA", "equation": "", "summary": "DNA polymerase iota (POLI) is recruited to DNA damage sites through its interaction with PCNA and REV1. POLI has a functional PIP box in the C-terminus and two ubiquitin binding motifs (UBMs). The PIP box and UBMs are responsible for POLI binding to monoubiquitinated PCNA (MonoUb:K164-PCNA) (Bienko et al. 2005, Haracska et al. 2005, Bomar et al. 2010). The interaction between POLI and the C-terminus of REV1 is evolutionarily conserved (Kosarek et al. 2003, Guo et al. 2003, Ohashi et al. 2004). Since REV1 and POLI likely cooperate in the bypass of bulky DNA lesions (Yang et al. 2003) and the DNA polymerase zeta complex (POLZ) is needed for extension of nucleotides incorporated by POLI (Johnson et al. 2000), it is plausible that POLI forms a quaternary complex with REV1 and POLZ, as shown for POLK and proposed for other Y family DNA polymerases (Xie et al. 2012).", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9UNA4-1", "Q9UBZ9-1", "O60673-1" ], "evidence": [ { "id": "R-HSA-5656105", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5656105" } ] }, { "id": "R-HSA-5656148", "name": "POLI incorporates dNMP opposite to damaged DNA base", "equation": "", "summary": "DNA polymerase iota (POLI) has an active site that favours Hoogsteen base pairing instead of Watson-Crick base pairing. POLI has the highest efficiency and fidelity in incorporating dTTP opposite to a template adenine (A). The active site of POLI causes the template A to rotate about its glycosidic bond and acquire a syn conformation. The hydrogen bonds are then established between the Hoogsteen edge of the template A in syn conformation (N7 and N6) and the Watson-Crick edge of dTMP (N3 and O4), which remains in anti conformation. POLI shows lower efficiency in incorporating dCTP opposite the template guanine (G) (Nair et al. 2004).


Hoogsteen base pairing and rotation of template purines from anti to syn conformation serves as a mechanism to displace adducts on template G or template A that interfere with DNA replication, as is the case with gamma-hydroxy-1,N2-propano-2'deoxyguanosine (gamma-HOPdG), or to allow base pairing of damaged purines with a disrupted Watson-Crick edge but an intact Hoogsteen edge, as is the case with 1,N6-ethenodeoxyadenosine (EtAD) (Nair et al. 2006).


Gamma-HOPdG is formed when acrolein, an alpha,beta-unsaturated aldehyde generated as an end product of lipid peroxidation or oxidation of polyamines, reacts with the N2 of guanine, leading to formation of a cyclic adduct. POLI incorporates dCMP opposite gamma-HOPdG as efficiently as opposite an undamaged G (Washington et al. 2004). EtAD is generated when DNA is exposed to chemical carcinogens, such as vinyl chloride, or epoxyaldehydes that are produced by lipid peroxidation. POLI shows preferential dTMP incorporation opposite to a template EtAD, but can also erroneously incorporate dCMP although with four times lower efficiency (Nair et al. 2006).", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9UNA4-1", "Q9UBZ9-1", "O60673-1" ], "evidence": [ { "id": "R-HSA-5656148", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5656148" } ] }, { "id": "R-HSA-5656158", "name": "POLZ elongates POLI-incorporated dNMP", "equation": "", "summary": "After it incorporates a dNMP opposite to a damaged template base, DNA polymerase iota (POLI) is unable to efficiently elongate the DNA strand further. The elongation step is performed by the DNA polymerase zeta complex (POLZ), composed of REV3L and MAD2L2 subunits (Johnson et al. 2000). POLK has also been implicated in the elongation step (Washington et al. 2004).", "cellular_location": "nucleoplasm", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9UNA4-1", "Q9UBZ9-1", "O60673-1" ], "evidence": [ { "id": "R-HSA-5656158", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5656158" } ] } ], "reaction_participants": [ { "participant_id": "R-HSA-110278", "participant_name": "REV3L [nucleoplasm]", "crossref": [ { "id": "O60673", "database": "UniProt", "url": "" }, { "id": "3ABE", "database": "PDB", "url": "" }, { "id": "ENSG00000009413", "database": "OpenTargets", "url": "" }, { "id": "6WS5", "database": "PDB", "url": "" }, { "id": "6WS0", "database": "PDB", "url": "" }, { "id": "3VU7", "database": "PDB", "url": "" }, { "id": "O60673", "database": "Pharos - Targets", "url": "" }, { "id": "4GK0", "database": "PDB", "url": "" }, { "id": "4EXT", "database": "PDB", "url": "" }, { "id": "O60673", "database": "GeneCards", "url": "" }, { "id": "6EKM", "database": "PDB", "url": "" }, { "id": "6KEA", "database": "PDB", "url": "" }, { "id": "2.7.7.7", "database": "IntEnz", "url": "" }, { "id": "O60673", "database": "PRO", "url": "" }, { "id": "3ABD", "database": "PDB", "url": "" }, { "id": "NP_001273361.1", "database": "RefSeq", "url": "" }, { "id": "NP_002903.3", "database": "RefSeq", "url": "" }, { "id": "6BI7", "database": "PDB", "url": "" }, { "id": "HMDBP00959", "database": "HMDB Protein", "url": "" }, { "id": "6BCD", "database": "PDB", "url": "" }, { "id": "ENSG00000009413-REV3L", "database": "HPA", "url": "" }, { "id": "23362", "database": "Orphanet", "url": "" }, { "id": "5O8K", "database": "PDB", "url": "" }, { "id": "NP_001273360.1", "database": "RefSeq", "url": "" }, { "id": "ENSP00000351697", "database": "Ensembl", "url": "" }, { "id": "ENSP00000357792", "database": "Ensembl", "url": "" }, { "id": "4GK5", "database": "PDB", "url": "" }, { "id": "ENSP00000402003", "database": "Ensembl", "url": "" }, { "id": "ENST00000358835", "database": "Ensembl", "url": "" }, { "id": "ENSG00000009413", "database": "Ensembl", "url": "" }, { "id": "ENST00000435970", "database": "Ensembl", "url": "" }, { "id": "6BC8", "database": "PDB", "url": "" }, { "id": "ENST00000368802", "database": "Ensembl", "url": "" } ] }, { "participant_id": "R-HSA-110279", "participant_name": "POLZ [nucleoplasm]", "crossref": [ { "id": "CPX-994", "database": "ComplexPortal", "url": "" } ] }, { "participant_id": "R-HSA-3006726", "participant_name": "REV1 [nucleoplasm]", "crossref": [ { "id": "Q9UBZ9", "database": "PRO", "url": "" }, { "id": "NP_001032961.1", "database": "RefSeq", "url": "" }, { "id": "4GK0", "database": "PDB", "url": "" }, { "id": "ENSG00000135945-REV1", "database": "HPA", "url": "" }, { "id": "ENST00000258428", "database": "Ensembl", "url": "" }, { "id": "Q9UBZ9", "database": "GeneCards", "url": "" }, { "id": "NP_057400.1", "database": "RefSeq", "url": "" }, { "id": "NP_001308383.1", "database": "RefSeq", "url": "" }, { "id": "2LSK", "database": "PDB", "url": "" }, { "id": "ENSG00000135945", "database": "OpenTargets", "url": "" }, { "id": "4EXT", "database": "PDB", "url": "" }, { "id": "6AXD", "database": "PDB", "url": "" }, { "id": "3VU7", "database": "PDB", "url": "" }, { "id": "Q9UBZ9", "database": "UniProt", "url": "" }, { "id": "5VZM", "database": "PDB", "url": "" }, { "id": "ENSG00000135945", "database": "Ensembl", "url": "" }, { "id": "2LSI", "database": "PDB", "url": "" }, { "id": "Q9UBZ9", "database": "Pharos - Targets", "url": "" }, { "id": "NP_001308389.1", "database": "RefSeq", "url": "" }, { "id": "2LSY", "database": "PDB", "url": "" }, { "id": "6WS5", "database": "PDB", "url": "" }, { "id": "ENSP00000377091", "database": "Ensembl", "url": "" }, { "id": "2N1G", "database": "PDB", "url": "" }, { "id": "ENSP00000258428", "database": "Ensembl", "url": "" }, { "id": "NP_001308384.1", "database": "RefSeq", "url": "" }, { "id": "4GK5", "database": "PDB", "url": "" }, { "id": "3GQC", "database": "PDB", "url": "" }, { "id": "6ASR", "database": "PDB", "url": "" }, { "id": "4BA9", "database": "PDB", "url": "" }, { "id": "6WS0", "database": "PDB", "url": "" }, { "id": "NP_001308387.1", "database": "RefSeq", "url": "" }, { "id": "NP_001308388.1", "database": "RefSeq", "url": "" }, { "id": "2EBW", "database": "PDB", "url": "" }, { "id": "ENST00000393445", "database": "Ensembl", "url": "" } ] }, { "participant_id": "R-HSA-59092", "participant_name": "MAD2L2 [nucleoplasm]", "crossref": [ { "id": "Q9UI95", "database": "UniProt", "url": "" }, { "id": "3VU7", "database": "PDB", "url": "" }, { "id": "6KEA", "database": "PDB", "url": "" }, { "id": "7L9P", "database": "PDB", "url": "" }, { "id": "3ABE", "database": "PDB", "url": "" }, { "id": "6K08", "database": "PDB", "url": "" }, { "id": "3ABD", "database": "PDB", "url": "" }, { "id": "XP_011538809.1", "database": "RefSeq", "url": "" }, { "id": "ENSG00000116670", "database": "OpenTargets", "url": "" }, { "id": "6WS5", "database": "PDB", "url": "" }, { "id": "Q9UI95", "database": "PRO", "url": "" }, { "id": "NP_001120797.1", "database": "RefSeq", "url": "" }, { "id": "25126", "database": "Orphanet", "url": "" }, { "id": "6K07", "database": "PDB", "url": "" }, { "id": "6BI7", "database": "PDB", "url": "" }, { "id": "6WW9", "database": "PDB", "url": "" }, { "id": "6WWA", "database": "PDB", "url": "" }, { "id": "NP_006332.3", "database": "RefSeq", "url": "" }, { "id": "6NIF", "database": "PDB", "url": "" }, { "id": "Q9UI95", "database": "Pharos - Targets", "url": "" }, { "id": "5XPU", "database": "PDB", "url": "" }, { "id": "6M7B", "database": "PDB", "url": "" }, { "id": "ENSG00000116670-MAD2L2", "database": "HPA", "url": "" }, { "id": "6VE5", "database": "PDB", "url": "" }, { "id": "6BCD", "database": "PDB", "url": "" }, { "id": "6WS0", "database": "PDB", "url": "" }, { "id": "6BC8", "database": "PDB", "url": "" }, { "id": "ENSP00000365882", "database": "Ensembl", "url": "" }, { "id": "ENST00000376667", "database": "Ensembl", "url": "" }, { "id": "4EXT", "database": "PDB", "url": "" }, { "id": "ENSP00000365855", "database": "Ensembl", "url": "" }, { "id": "4GK0", "database": "PDB", "url": "" }, { "id": "4GK5", "database": "PDB", "url": "" }, { "id": "6KTO", "database": "PDB", "url": "" }, { "id": "6M7A", "database": "PDB", "url": "" }, { "id": "Q9UI95", "database": "GeneCards", "url": "" }, { "id": "ENST00000376692", "database": "Ensembl", "url": "" }, { "id": "ENST00000235310", "database": "Ensembl", "url": "" }, { "id": "ENSG00000116670", "database": "Ensembl", "url": "" }, { "id": "ENSP00000400982", "database": "Ensembl", "url": "" }, { "id": "ENST00000456915", "database": "Ensembl", "url": "" }, { "id": "5XPT", "database": "PDB", "url": "" }, { "id": "ENSP00000235310", "database": "Ensembl", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "A0A0B7P3V8", "gene_name": "TY4B-P", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "A0A0B7P3V8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0B7P3V8" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "A0A0B7P3V8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0B7P3V8" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "A0A0B7P3V8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0B7P3V8" } ] }, { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "A0A0B7P3V8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0B7P3V8" } ] } ] }, { "uniprot_ac": "D3Z8X4", "gene_name": "Pole", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "D3Z8X4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3Z8X4" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "D3Z8X4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3Z8X4" } ] } ] }, { "uniprot_ac": "E9PT58", "gene_name": "Dntt", "activity": [ { "ec_number": "2.7.7.31", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "E9PT58", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9PT58" } ] }, { "ec_number": "2.7.7.31", "activity": "", "evidence": [ { "id": "E9PT58", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/E9PT58" } ] } ] }, { "uniprot_ac": "F1M8G6", "gene_name": "Rev3l", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "F1M8G6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M8G6" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "F1M8G6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M8G6" } ] } ] }, { "uniprot_ac": "F7F6Z7", "gene_name": "Polm", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "F7F6Z7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F7F6Z7" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "F7F6Z7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F7F6Z7" } ] } ] }, { "uniprot_ac": "O00370", "gene_name": "", "activity": [ { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "O00370", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00370" } ] }, { "ec_number": "3.1.21.-", "activity": "", "evidence": [ { "id": "O00370", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O00370" } ] } ] }, { "uniprot_ac": "O13527", "gene_name": "TY1B-A", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "O13527", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O13527" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "O13527", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O13527" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "O13527", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O13527" } ] } ] }, { "uniprot_ac": "O13535", "gene_name": "TY1B-H", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "O13535", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O13535" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "O13535", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O13535" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "O13535", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O13535" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "O13535", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O13535" } ] } ] }, { "uniprot_ac": "O14746", "gene_name": "TERT", "activity": [ { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "O14746", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14746" } ] }, { "ec_number": "2.7.7.49", "activity": "", "evidence": [ { "id": "O14746", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14746" } ] } ] }, { "uniprot_ac": "O18475", "gene_name": "PolQ", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "O18475", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O18475" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "O18475", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O18475" } ] } ] }, { "uniprot_ac": "O54747", "gene_name": "Pold1", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "O54747", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54747" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "O54747", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54747" } ] }, { "ec_number": "3.1.11.-", "activity": "", "evidence": [ { "id": "O54747", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O54747" } ] } ] }, { "uniprot_ac": "O60673", "gene_name": "REV3L", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "O60673", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60673" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "O60673", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60673" } ] } ] }, { "uniprot_ac": "O70372", "gene_name": "Tert", "activity": [ { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "O70372", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70372" } ] }, { "ec_number": "2.7.7.49", "activity": "", "evidence": [ { "id": "O70372", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O70372" } ] } ] }, { "uniprot_ac": "O75417", "gene_name": "POLQ", "activity": [ { "ec_number": "3.6.4.12", "activity": "ATP + H2O = ADP + H(+) + phosphate.", "evidence": [ { "id": "O75417", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75417" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "O75417", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75417" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "O75417", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75417" } ] } ] }, { "uniprot_ac": "O89042", "gene_name": "Pola1", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "O89042", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O89042" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "O89042", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O89042" } ] } ] }, { "uniprot_ac": "P04053", "gene_name": "DNTT", "activity": [ { "ec_number": "2.7.7.31", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P04053", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04053" } ] }, { "ec_number": "2.7.7.31", "activity": "", "evidence": [ { "id": "P04053", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04053" } ] } ] }, { "uniprot_ac": "P06746", "gene_name": "POLB", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P06746", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06746" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "P06746", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06746" } ] }, { "ec_number": "4.2.99.18", "activity": "2'-deoxyribonucleotide-(2'-deoxyribose 5'-phosphate)-2'-deoxyribonucleotide-DNA = a 3'-end 2'-deoxyribonucleotide-(2,3-dehydro-2,3-deoxyribose 5'-phosphate)-DNA + a 5'-end 5'-monophospho-2'-deoxyribonucleoside-DNA + H(+).", "evidence": [ { "id": "P06746", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06746" } ] }, { "ec_number": "4.2.99.-", "activity": "", "evidence": [ { "id": "P06746", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06746" } ] } ] }, { "uniprot_ac": "P06766", "gene_name": "Polb", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P06766", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06766" } ] }, { "ec_number": "4.2.99.18", "activity": "2'-deoxyribonucleotide-(2'-deoxyribose 5'-phosphate)-2'-deoxyribonucleotide-DNA = a 3'-end 2'-deoxyribonucleotide-(2,3-dehydro-2,3-deoxyribose 5'-phosphate)-DNA + a 5'-end 5'-monophospho-2'-deoxyribonucleoside-DNA + H(+).", "evidence": [ { "id": "P06766", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06766" } ] }, { "ec_number": "4.2.99.-", "activity": "", "evidence": [ { "id": "P06766", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06766" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "P06766", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06766" } ] } ] }, { "uniprot_ac": "P09838", "gene_name": "Dntt", "activity": [ { "ec_number": "3.1.11.-", "activity": "", "evidence": [ { "id": "P09838", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09838" } ] }, { "ec_number": "2.7.7.31", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P09838", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09838" } ] }, { "ec_number": "2.7.7.31", "activity": "", "evidence": [ { "id": "P09838", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09838" } ] } ] }, { "uniprot_ac": "P09884", "gene_name": "POLA1", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P09884", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09884" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "P09884", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09884" } ] } ] }, { "uniprot_ac": "P0C2I2", "gene_name": "TY1B-DR5", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P0C2I2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2I2" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "P0C2I2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2I2" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P0C2I2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2I2" } ] }, { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "P0C2I2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2I2" } ] } ] }, { "uniprot_ac": "P0C2I3", "gene_name": "TY1B-DR6", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "P0C2I3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2I3" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P0C2I3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2I3" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "P0C2I3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2I3" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P0C2I3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2I3" } ] } ] }, { "uniprot_ac": "P0C2I5", "gene_name": "TY1B-LR2", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "P0C2I5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2I5" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P0C2I5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2I5" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "P0C2I5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2I5" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P0C2I5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2I5" } ] } ] }, { "uniprot_ac": "P0C2I6", "gene_name": "TY1B-LR3", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "P0C2I6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2I6" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P0C2I6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2I6" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "P0C2I6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2I6" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P0C2I6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2I6" } ] } ] }, { "uniprot_ac": "P0C2I9", "gene_name": "TY1B-PR1", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "P0C2I9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2I9" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P0C2I9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2I9" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "P0C2I9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2I9" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P0C2I9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2I9" } ] } ] }, { "uniprot_ac": "P0C2J0", "gene_name": "TY1B-PR2", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "P0C2J0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2J0" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P0C2J0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2J0" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "P0C2J0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2J0" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P0C2J0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2J0" } ] } ] }, { "uniprot_ac": "P0C2J1", "gene_name": "TY1B-PR3", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "P0C2J1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2J1" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P0C2J1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2J1" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "P0C2J1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2J1" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P0C2J1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2J1" } ] } ] }, { "uniprot_ac": "P0C2J3", "gene_name": "TY2B-LR1", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P0C2J3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2J3" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "P0C2J3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2J3" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P0C2J3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2J3" } ] }, { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "P0C2J3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2J3" } ] } ] }, { "uniprot_ac": "P0C2J7", "gene_name": "TY4B-H", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P0C2J7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2J7" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "P0C2J7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2J7" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P0C2J7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2J7" } ] }, { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "P0C2J7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C2J7" } ] } ] }, { "uniprot_ac": "P0CX63", "gene_name": "TY2B-F", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P0CX63", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0CX63" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "P0CX63", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0CX63" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P0CX63", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0CX63" } ] }, { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "P0CX63", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0CX63" } ] } ] }, { "uniprot_ac": "P0CX64", "gene_name": "TY2B-GR2", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P0CX64", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0CX64" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "P0CX64", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0CX64" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P0CX64", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0CX64" } ] }, { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "P0CX64", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0CX64" } ] } ] }, { "uniprot_ac": "P10266", "gene_name": "ERVK-10", "activity": [ { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P10266", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10266" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "P10266", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10266" } ] }, { "ec_number": "3.4.23.50", "activity": "Processing at the authentic HIV-1 PR recognition site and release of the mature p17 matrix and the p24 capsid protein, as a result of the cleavage of the -SQNY-|-PIVQ- cleavage site.", "evidence": [ { "id": "P10266", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10266" } ] } ] }, { "uniprot_ac": "P10400", "gene_name": "Pol", "activity": [ { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P10400", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P10400" } ] } ] }, { "uniprot_ac": "P11369", "gene_name": "Pol", "activity": [ { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P11369", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11369" } ] }, { "ec_number": "3.1.21.-", "activity": "", "evidence": [ { "id": "P11369", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P11369" } ] } ] }, { "uniprot_ac": "P13382", "gene_name": "POL1", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P13382", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13382" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "P13382", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P13382" } ] } ] }, { "uniprot_ac": "P14284", "gene_name": "REV3", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P14284", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14284" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "P14284", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14284" } ] } ] }, { "uniprot_ac": "P15436", "gene_name": "POL3", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P15436", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15436" } ] }, { "ec_number": "3.1.11.-", "activity": "", "evidence": [ { "id": "P15436", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15436" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "P15436", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15436" } ] } ] }, { "uniprot_ac": "P15801", "gene_name": "MIP1", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P15801", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15801" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "P15801", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15801" } ] } ] }, { "uniprot_ac": "P21951", "gene_name": "POL2", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P21951", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21951" } ] }, { "ec_number": "3.1.11.-", "activity": "", "evidence": [ { "id": "P21951", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21951" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "P21951", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P21951" } ] } ] }, { "uniprot_ac": "P25384", "gene_name": "TY2B-C", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P25384", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25384" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "P25384", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25384" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P25384", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25384" } ] }, { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "P25384", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25384" } ] } ] }, { "uniprot_ac": "P25615", "gene_name": "POL4", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P25615", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25615" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "P25615", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P25615" } ] } ] }, { "uniprot_ac": "P26019", "gene_name": "PolA1", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P26019", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P26019" } ] }, { "ec_number": "3.1.11.-", "activity": "", "evidence": [ { "id": "P26019", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P26019" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "P26019", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P26019" } ] } ] }, { "uniprot_ac": "P28340", "gene_name": "POLD1", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P28340", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28340" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "P28340", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28340" } ] }, { "ec_number": "3.1.11.-", "activity": "", "evidence": [ { "id": "P28340", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P28340" } ] } ] }, { "uniprot_ac": "P33609", "gene_name": "Pola1", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P33609", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P33609" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "P33609", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P33609" } ] } ] }, { "uniprot_ac": "P39985", "gene_name": "POL5", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P39985", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39985" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "P39985", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P39985" } ] } ] }, { "uniprot_ac": "P46957", "gene_name": "POL31", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P46957", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46957" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "P46957", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P46957" } ] } ] }, { "uniprot_ac": "P47024", "gene_name": "TY4B-J", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P47024", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47024" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "P47024", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47024" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P47024", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47024" } ] }, { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "P47024", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47024" } ] } ] }, { "uniprot_ac": "P47098", "gene_name": "TY1B-JR1", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "P47098", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47098" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P47098", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47098" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "P47098", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47098" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P47098", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47098" } ] } ] }, { "uniprot_ac": "P47100", "gene_name": "TY1B-JR2", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "P47100", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47100" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P47100", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47100" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "P47100", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47100" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P47100", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P47100" } ] } ] }, { "uniprot_ac": "P52431", "gene_name": "Pold1", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P52431", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P52431" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "P52431", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P52431" } ] }, { "ec_number": "3.1.11.-", "activity": "", "evidence": [ { "id": "P52431", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P52431" } ] } ] }, { "uniprot_ac": "P54098", "gene_name": "POLG", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P54098", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54098" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "P54098", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54098" } ] } ] }, { "uniprot_ac": "P54099", "gene_name": "Polg", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P54099", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54099" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "P54099", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54099" } ] } ] }, { "uniprot_ac": "P54358", "gene_name": "PolD1", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P54358", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54358" } ] }, { "ec_number": "3.1.11.-", "activity": "", "evidence": [ { "id": "P54358", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54358" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "P54358", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54358" } ] } ] }, { "uniprot_ac": "P63128", "gene_name": "ERVK-9", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P63128", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63128" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "P63128", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63128" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P63128", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63128" } ] }, { "ec_number": "3.4.23.50", "activity": "Processing at the authentic HIV-1 PR recognition site and release of the mature p17 matrix and the p24 capsid protein, as a result of the cleavage of the -SQNY-|-PIVQ- cleavage site.", "evidence": [ { "id": "P63128", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63128" } ] } ] }, { "uniprot_ac": "P63132", "gene_name": "HERVK_113", "activity": [ { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P63132", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63132" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "P63132", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63132" } ] } ] }, { "uniprot_ac": "P63133", "gene_name": "ERVK-8", "activity": [ { "ec_number": "3.4.23.50", "activity": "Processing at the authentic HIV-1 PR recognition site and release of the mature p17 matrix and the p24 capsid protein, as a result of the cleavage of the -SQNY-|-PIVQ- cleavage site.", "evidence": [ { "id": "P63133", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63133" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P63133", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63133" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "P63133", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63133" } ] } ] }, { "uniprot_ac": "P63135", "gene_name": "ERVK-7", "activity": [ { "ec_number": "3.4.23.50", "activity": "Processing at the authentic HIV-1 PR recognition site and release of the mature p17 matrix and the p24 capsid protein, as a result of the cleavage of the -SQNY-|-PIVQ- cleavage site.", "evidence": [ { "id": "P63135", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63135" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P63135", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63135" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "P63135", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63135" } ] } ] }, { "uniprot_ac": "P63136", "gene_name": "ERVK-25", "activity": [ { "ec_number": "3.4.23.50", "activity": "Processing at the authentic HIV-1 PR recognition site and release of the mature p17 matrix and the p24 capsid protein, as a result of the cleavage of the -SQNY-|-PIVQ- cleavage site.", "evidence": [ { "id": "P63136", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63136" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "P63136", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63136" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "P63136", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P63136" } ] } ] }, { "uniprot_ac": "Q03434", "gene_name": "TY1B-ML2", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "Q03434", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03434" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q03434", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03434" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q03434", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03434" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q03434", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03434" } ] } ] }, { "uniprot_ac": "Q03494", "gene_name": "TY2B-DR2", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q03494", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03494" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q03494", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03494" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q03494", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03494" } ] }, { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "Q03494", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03494" } ] } ] }, { "uniprot_ac": "Q03612", "gene_name": "TY1B-ER1", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "Q03612", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03612" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q03612", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03612" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q03612", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03612" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q03612", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03612" } ] } ] }, { "uniprot_ac": "Q03619", "gene_name": "TY1B-ER2", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "Q03619", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03619" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q03619", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03619" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q03619", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03619" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q03619", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03619" } ] } ] }, { "uniprot_ac": "Q03855", "gene_name": "TY1B-DR1", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "Q03855", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03855" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q03855", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03855" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q03855", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03855" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q03855", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q03855" } ] } ] }, { "uniprot_ac": "Q04049", "gene_name": "RAD30", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q04049", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04049" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "Q04049", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04049" } ] } ] }, { "uniprot_ac": "Q04214", "gene_name": "TY1B-MR1", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "Q04214", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04214" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q04214", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04214" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q04214", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04214" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q04214", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04214" } ] } ] }, { "uniprot_ac": "Q04670", "gene_name": "TY1B-MR2", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "Q04670", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04670" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q04670", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04670" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q04670", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04670" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q04670", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04670" } ] } ] }, { "uniprot_ac": "Q04711", "gene_name": "TY1B-ML1", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "Q04711", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04711" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q04711", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04711" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q04711", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04711" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q04711", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04711" } ] } ] }, { "uniprot_ac": "Q06163", "gene_name": "EST2", "activity": [ { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q06163", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q06163" } ] }, { "ec_number": "2.7.7.49", "activity": "", "evidence": [ { "id": "Q06163", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q06163" } ] } ] }, { "uniprot_ac": "Q07791", "gene_name": "TY2B-DR3", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "Q07791", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q07791" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q07791", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q07791" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q07791", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q07791" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q07791", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q07791" } ] } ] }, { "uniprot_ac": "Q07793", "gene_name": "TY1B-DR4", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "Q07793", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q07793" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q07793", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q07793" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q07793", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q07793" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q07793", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q07793" } ] } ] }, { "uniprot_ac": "Q07864", "gene_name": "POLE", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q07864", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q07864" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "Q07864", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q07864" } ] }, { "ec_number": "3.1.11.-", "activity": "", "evidence": [ { "id": "Q07864", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q07864" } ] } ] }, { "uniprot_ac": "Q12088", "gene_name": "TY1B-LR1", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "Q12088", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12088" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q12088", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12088" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q12088", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12088" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q12088", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12088" } ] } ] }, { "uniprot_ac": "Q12112", "gene_name": "TY1B-NL1", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "Q12112", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12112" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q12112", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12112" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q12112", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12112" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q12112", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12112" } ] } ] }, { "uniprot_ac": "Q12113", "gene_name": "TY2B-OR1", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q12113", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12113" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q12113", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12113" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q12113", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12113" } ] }, { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "Q12113", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12113" } ] } ] }, { "uniprot_ac": "Q12141", "gene_name": "TY1B-GR1", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "Q12141", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12141" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q12141", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12141" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q12141", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12141" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q12141", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12141" } ] } ] }, { "uniprot_ac": "Q12193", "gene_name": "TY1B-BR", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "Q12193", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12193" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q12193", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12193" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q12193", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12193" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q12193", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12193" } ] } ] }, { "uniprot_ac": "Q12269", "gene_name": "TY1B-GR2", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "Q12269", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12269" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q12269", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12269" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q12269", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12269" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q12269", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12269" } ] } ] }, { "uniprot_ac": "Q12273", "gene_name": "TY1B-OL", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "Q12273", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12273" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q12273", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12273" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q12273", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12273" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q12273", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12273" } ] } ] }, { "uniprot_ac": "Q12316", "gene_name": "TY1B-GR3", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "Q12316", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12316" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q12316", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12316" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q12316", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12316" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q12316", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12316" } ] } ] }, { "uniprot_ac": "Q12414", "gene_name": "TY1B-PL", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "Q12414", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12414" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q12414", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12414" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q12414", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12414" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q12414", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12414" } ] } ] }, { "uniprot_ac": "Q12472", "gene_name": "TY2B-DR1", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q12472", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12472" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q12472", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12472" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q12472", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12472" } ] }, { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "Q12472", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12472" } ] } ] }, { "uniprot_ac": "Q12490", "gene_name": "TY1B-BL", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "Q12490", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12490" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q12490", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12490" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q12490", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12490" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q12490", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12490" } ] } ] }, { "uniprot_ac": "Q12491", "gene_name": "TY2B-B", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q12491", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12491" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q12491", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12491" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q12491", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12491" } ] }, { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "Q12491", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12491" } ] } ] }, { "uniprot_ac": "Q12501", "gene_name": "TY2B-OR2", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q12501", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12501" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q12501", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12501" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q12501", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12501" } ] }, { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "Q12501", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12501" } ] } ] }, { "uniprot_ac": "Q1ZXF2", "gene_name": "polB", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q1ZXF2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q1ZXF2" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "Q1ZXF2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q1ZXF2" } ] } ] }, { "uniprot_ac": "Q27607", "gene_name": "PolG1", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q27607", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q27607" } ] }, { "ec_number": "3.1.11.-", "activity": "", "evidence": [ { "id": "Q27607", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q27607" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "Q27607", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q27607" } ] } ] }, { "uniprot_ac": "Q54B44", "gene_name": "", "activity": [ { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q54B44", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54B44" } ] }, { "ec_number": "2.7.7.49", "activity": "", "evidence": [ { "id": "Q54B44", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54B44" } ] } ] }, { "uniprot_ac": "Q54N97", "gene_name": "pold1", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q54N97", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54N97" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "Q54N97", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54N97" } ] } ] }, { "uniprot_ac": "Q54RD4", "gene_name": "pole", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q54RD4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54RD4" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "Q54RD4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54RD4" } ] } ] }, { "uniprot_ac": "Q54SV8", "gene_name": "pola1", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q54SV8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54SV8" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "Q54SV8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q54SV8" } ] } ] }, { "uniprot_ac": "Q55AZ3", "gene_name": "polZ", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q55AZ3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55AZ3" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "Q55AZ3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q55AZ3" } ] } ] }, { "uniprot_ac": "Q5RKI3", "gene_name": "Poll", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q5RKI3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5RKI3" } ] }, { "ec_number": "4.2.99.-", "activity": "", "evidence": [ { "id": "Q5RKI3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5RKI3" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "Q5RKI3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5RKI3" } ] } ] }, { "uniprot_ac": "Q61493", "gene_name": "Rev3l", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q61493", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61493" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "Q61493", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61493" } ] } ] }, { "uniprot_ac": "Q673L6", "gene_name": "Tert", "activity": [ { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q673L6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q673L6" } ] }, { "ec_number": "2.7.7.49", "activity": "", "evidence": [ { "id": "Q673L6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q673L6" } ] } ] }, { "uniprot_ac": "Q6R3M4", "gene_name": "Poli", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q6R3M4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6R3M4" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "Q6R3M4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6R3M4" } ] } ] }, { "uniprot_ac": "Q7LHG5", "gene_name": "TY3B-I", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q7LHG5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7LHG5" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q7LHG5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7LHG5" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q7LHG5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7LHG5" } ] }, { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "Q7LHG5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7LHG5" } ] } ] }, { "uniprot_ac": "Q7TQ07", "gene_name": "Poln", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q7TQ07", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TQ07" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "Q7TQ07", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7TQ07" } ] } ] }, { "uniprot_ac": "Q7Z5Q5", "gene_name": "POLN", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q7Z5Q5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7Z5Q5" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "Q7Z5Q5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7Z5Q5" } ] } ] }, { "uniprot_ac": "Q8CGS6", "gene_name": "Polq", "activity": [ { "ec_number": "3.6.4.12", "activity": "ATP + H2O = ADP + H(+) + phosphate.", "evidence": [ { "id": "Q8CGS6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CGS6" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q8CGS6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CGS6" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q8CGS6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CGS6" } ] } ] }, { "uniprot_ac": "Q8K409", "gene_name": "Polb", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q8K409", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K409" } ] }, { "ec_number": "4.2.99.18", "activity": "2'-deoxyribonucleotide-(2'-deoxyribose 5'-phosphate)-2'-deoxyribonucleotide-DNA = a 3'-end 2'-deoxyribonucleotide-(2,3-dehydro-2,3-deoxyribose 5'-phosphate)-DNA + a 5'-end 5'-monophospho-2'-deoxyribonucleoside-DNA + H(+).", "evidence": [ { "id": "Q8K409", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K409" } ] }, { "ec_number": "4.2.99.-", "activity": "", "evidence": [ { "id": "Q8K409", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K409" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "Q8K409", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K409" } ] } ] }, { "uniprot_ac": "Q92393", "gene_name": "TY1B-OR", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "Q92393", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92393" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q92393", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92393" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q92393", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92393" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q92393", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92393" } ] } ] }, { "uniprot_ac": "Q99231", "gene_name": "TY1B-DR3", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "Q99231", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99231" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q99231", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99231" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q99231", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99231" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q99231", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99231" } ] } ] }, { "uniprot_ac": "Q99315", "gene_name": "TY3B-G", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q99315", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99315" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q99315", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99315" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q99315", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99315" } ] }, { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "Q99315", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99315" } ] } ] }, { "uniprot_ac": "Q99337", "gene_name": "TY1B-NL2", "activity": [ { "ec_number": "3.4.23.-", "activity": "", "evidence": [ { "id": "Q99337", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99337" } ] }, { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q99337", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99337" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q99337", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99337" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q99337", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99337" } ] } ] }, { "uniprot_ac": "Q9BXR3", "gene_name": "ERVK-6", "activity": [ { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q9BXR3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BXR3" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q9BXR3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BXR3" } ] }, { "ec_number": "3.4.23.50", "activity": "Processing at the authentic HIV-1 PR recognition site and release of the mature p17 matrix and the p24 capsid protein, as a result of the cleavage of the -SQNY-|-PIVQ- cleavage site.", "evidence": [ { "id": "Q9BXR3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BXR3" } ] } ] }, { "uniprot_ac": "Q9GSR1", "gene_name": "PolZ1", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q9GSR1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9GSR1" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "Q9GSR1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9GSR1" } ] } ] }, { "uniprot_ac": "Q9JIW4", "gene_name": "Polm", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q9JIW4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JIW4" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "Q9JIW4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JIW4" } ] } ] }, { "uniprot_ac": "Q9JJN0", "gene_name": "Polh", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q9JJN0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JJN0" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "Q9JJN0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JJN0" } ] } ] }, { "uniprot_ac": "Q9NP87", "gene_name": "POLM", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q9NP87", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NP87" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "Q9NP87", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NP87" } ] } ] }, { "uniprot_ac": "Q9QC07", "gene_name": "ERVK-18", "activity": [ { "ec_number": "3.4.23.50", "activity": "Processing at the authentic HIV-1 PR recognition site and release of the mature p17 matrix and the p24 capsid protein, as a result of the cleavage of the -SQNY-|-PIVQ- cleavage site.", "evidence": [ { "id": "Q9QC07", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QC07" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q9QC07", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QC07" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q9QC07", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QC07" } ] } ] }, { "uniprot_ac": "Q9QUG2", "gene_name": "Polk", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q9QUG2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QUG2" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "Q9QUG2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QUG2" } ] } ] }, { "uniprot_ac": "Q9QXE2", "gene_name": "Poll", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q9QXE2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QXE2" } ] }, { "ec_number": "4.2.99.-", "activity": "", "evidence": [ { "id": "Q9QXE2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QXE2" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "Q9QXE2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QXE2" } ] } ] }, { "uniprot_ac": "Q9QYV8", "gene_name": "Polg", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q9QYV8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QYV8" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "Q9QYV8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QYV8" } ] } ] }, { "uniprot_ac": "Q9UBT6", "gene_name": "POLK", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q9UBT6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UBT6" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "Q9UBT6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UBT6" } ] } ] }, { "uniprot_ac": "Q9UBZ9", "gene_name": "REV1", "activity": [ { "ec_number": "2.7.7.-", "activity": "", "evidence": [ { "id": "Q9UBZ9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UBZ9" } ] } ] }, { "uniprot_ac": "Q9UGP5", "gene_name": "POLL", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q9UGP5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UGP5" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "Q9UGP5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UGP5" } ] }, { "ec_number": "4.2.99.-", "activity": "", "evidence": [ { "id": "Q9UGP5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UGP5" } ] } ] }, { "uniprot_ac": "Q9UNA4", "gene_name": "POLI", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q9UNA4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UNA4" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "Q9UNA4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UNA4" } ] } ] }, { "uniprot_ac": "Q9UQG0", "gene_name": "ERVK-11", "activity": [ { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q9UQG0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UQG0" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q9UQG0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UQG0" } ] } ] }, { "uniprot_ac": "Q9VCN1", "gene_name": "PolE1", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q9VCN1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VCN1" } ] }, { "ec_number": "3.1.11.-", "activity": "", "evidence": [ { "id": "Q9VCN1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VCN1" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "Q9VCN1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VCN1" } ] } ] }, { "uniprot_ac": "Q9VHV1", "gene_name": "PolI", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q9VHV1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VHV1" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "Q9VHV1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VHV1" } ] } ] }, { "uniprot_ac": "Q9VNX1", "gene_name": "PolH", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q9VNX1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VNX1" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "Q9VNX1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VNX1" } ] } ] }, { "uniprot_ac": "Q9WJR5", "gene_name": "ERVK-19", "activity": [ { "ec_number": "3.4.23.50", "activity": "Processing at the authentic HIV-1 PR recognition site and release of the mature p17 matrix and the p24 capsid protein, as a result of the cleavage of the -SQNY-|-PIVQ- cleavage site.", "evidence": [ { "id": "Q9WJR5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WJR5" } ] }, { "ec_number": "2.7.7.49", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q9WJR5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WJR5" } ] }, { "ec_number": "3.1.26.4", "activity": "Endonucleolytic cleavage to 5'-phosphomonoester.", "evidence": [ { "id": "Q9WJR5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WJR5" } ] } ] }, { "uniprot_ac": "Q9WVF7", "gene_name": "Pole", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q9WVF7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WVF7" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "Q9WVF7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WVF7" } ] }, { "ec_number": "3.1.11.-", "activity": "", "evidence": [ { "id": "Q9WVF7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9WVF7" } ] } ] }, { "uniprot_ac": "Q9Y253", "gene_name": "POLH", "activity": [ { "ec_number": "2.7.7.7", "activity": "a 2'-deoxyribonucleoside 5'-triphosphate + DNA(n) = diphosphate + DNA(n+1).", "evidence": [ { "id": "Q9Y253", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y253" } ] }, { "ec_number": "2.7.7.7", "activity": "", "evidence": [ { "id": "Q9Y253", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y253" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 368, 2237 ], "snv_sites": [ 189, 326, 368, 386, 456, 484, 499, 500, 511, 518, 552, 700, 788, 827, 878, 956, 1043, 1217, 1303, 1360, 1387, 1389, 1437, 1448, 1560, 1618, 1730, 1832, 1847, 1873, 1898, 1943, 1981, 1984, 2054, 2237, 2239, 2260, 2328, 2351, 2375, 2607, 2901, 2997, 3105 ], "glycation_sites": [], "phosphorylation_sites": [ 470, 582, 583, 1030, 1041, 1579, 1589, 1724, 1842, 1967, 2298, 2522 ], "sequon_annotation_sites": [ { "start_pos": 1102, "end_pos": 1104 }, { "start_pos": 1122, "end_pos": 1124 }, { "start_pos": 1195, "end_pos": 1197 }, { "start_pos": 1247, "end_pos": 1249 }, { "start_pos": 1341, "end_pos": 1343 }, { "start_pos": 1513, "end_pos": 1515 }, { "start_pos": 1545, "end_pos": 1547 }, { "start_pos": 1560, "end_pos": 1562 }, { "start_pos": 1608, "end_pos": 1610 }, { "start_pos": 1778, "end_pos": 1780 }, { "start_pos": 1794, "end_pos": 1796 }, { "start_pos": 1815, "end_pos": 1817 }, { "start_pos": 1867, "end_pos": 1869 }, { "start_pos": 2036, "end_pos": 2038 }, { "start_pos": 2273, "end_pos": 2275 }, { "start_pos": 2296, "end_pos": 2298 }, { "start_pos": 2478, "end_pos": 2480 }, { "start_pos": 2483, "end_pos": 2485 }, { "start_pos": 2507, "end_pos": 2509 }, { "start_pos": 2729, "end_pos": 2731 }, { "start_pos": 2738, "end_pos": 2740 }, { "start_pos": 2768, "end_pos": 2770 }, { "start_pos": 276, "end_pos": 278 }, { "start_pos": 2981, "end_pos": 2983 }, { "start_pos": 3088, "end_pos": 3090 }, { "start_pos": 619, "end_pos": 621 }, { "start_pos": 708, "end_pos": 710 }, { "start_pos": 713, "end_pos": 715 }, { "start_pos": 728, "end_pos": 730 }, { "start_pos": 753, "end_pos": 755 }, { "start_pos": 761, "end_pos": 763 }, { "start_pos": 887, "end_pos": 889 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 12 }, { "field": "total_sites", "count": 12 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 48 }, { "field": "total_sites", "count": 45 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 12 }, { "field": "total_sites", "count": 12 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 36 }, { "field": "total_sites", "count": 34 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 69 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }