{ "uniprot_canonical_ac": "O60656-1", "uniprot_ac": "O60656", "uniprot_id": "UD19_HUMAN", "mass": { "chemical_mass": 59941.0, "monoisotopic_mass": 59941.0 }, "refseq": { "ac": "NP_066307", "name": "UDP-glucuronosyltransferase 1A9 precursor", "summary": "This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The enzyme encoded by this gene is active on phenols. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_066307" }, "gene_names": [ { "name": "UGT1A9", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O60656", "id": "O60656" }, { "name": "GNT1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O60656", "id": "O60656" }, { "name": "HLUGP4; LUGP4; UDPGT; UDPGT 1-9; UGT-1I; UGT1-09; UGT1-9; UGT1.9; UGT1A9S; UGT1AI; UGT1I", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_066307", "id": "NP_066307" }, { "name": "UGT1A9", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_066307", "id": "NP_066307" }, { "name": "UGT1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O60656", "id": "O60656" } ], "protein_names": [ { "name": "UDP-glucuronosyltransferase 1A9", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O60656" }, { "name": "2.4.1.17", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O60656" }, { "name": "UDP glycosyltransferase 1 family, polypeptide A9; UDP-glucuronosyltransferase 1A9; UDP-glucuronosyltransferase 1-9; UDP-glucuronosyltransferase 1-I; UDP-glucuronosyltransferase 1 family polypeptide A9s; UDP glucuronosyltransferase 1 family, polypeptide A9", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_066307", "id": "NP_066307" }, { "name": "UDP-glucuronosyltransferase 1-9", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O60656" }, { "name": "UDP-glucuronosyltransferase 1-I", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O60656" }, { "name": "UDP-glucuronosyltransferase 1A9 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_066307", "id": "NP_066307" }, { "name": "UDPGT 1-9", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O60656" }, { "name": "UGT-1I", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O60656" }, { "name": "UGT1*9", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O60656" }, { "name": "UGT1-09", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O60656" }, { "name": "UGT1.9", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O60656" }, { "name": "UGT1A9", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O60656" }, { "name": "UGT1I", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O60656" }, { "name": "lugP4", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O60656" } ], "function": [ { "annotation": "Cytochrome P450 2B6 and UDP-Glucuronosyltransferase Enzyme-Mediated Clearance of Ciprofol (HSK3486) in Humans: The Role of Hepatic and Extrahepatic Metabolism. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_066307", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_066307" }, { "database": "PubMed", "id": "38071562", "url": "https://glygen.org/publication/PubMed/38071562" } ] }, { "annotation": "Genetic variants in CYP2A6 and UGT1A9 genes associated with urinary nicotine metabolites in young Mexican smokers.", "evidence": [ { "database": "RefSeq", "id": "NP_066307", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_066307" }, { "database": "PubMed", "id": "31959879", "url": "https://glygen.org/publication/PubMed/31959879" } ] }, { "annotation": "Lacks UGT glucuronidation activity but acts as a negative regulator of isoform 1.", "evidence": [ { "database": "UniProtKB", "id": "O60656", "url": "https://www.uniprot.org/uniprot/O60656#function" }, { "database": "PubMed", "id": "20610558", "url": "https://glygen.org/publication/PubMed/20610558" }, { "database": "PubMed", "id": "18004212", "url": "https://glygen.org/publication/PubMed/18004212" } ] }, { "annotation": "Significance of UGT1A6, UGT1A9, and UGT2B7 genetic variants and their mRNA expression in the clinical outcome of renal cell carcinoma.", "evidence": [ { "database": "RefSeq", "id": "NP_066307", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_066307" }, { "database": "PubMed", "id": "36571650", "url": "https://glygen.org/publication/PubMed/36571650" } ] }, { "annotation": "This gene encodes a UDP-glucuronosyltransferase, an enzyme of the glucuronidation pathway that transforms small lipophilic molecules, such as steroids, bilirubin, hormones, and drugs, into water-soluble, excretable metabolites. This gene is part of a complex locus that encodes several UDP-glucuronosyltransferases. The locus includes thirteen unique alternate first exons followed by four common exons. Four of the alternate first exons are considered pseudogenes. Each of the remaining nine 5' exons may be spliced to the four common exons, resulting in nine proteins with different N-termini and identical C-termini. Each first exon encodes the substrate binding site, and is regulated by its own promoter. The enzyme encoded by this gene is active on phenols. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_066307", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_066307" } ] }, { "annotation": "UDP-glucuronosyltransferase (UGT) that catalyzes phase II biotransformation reactions in which lipophilic substrates are conjugated with glucuronic acid to increase the metabolite's water solubility, thereby facilitating excretion into either the urine or bile (PubMed:12181437, PubMed:15472229, PubMed:15470161, PubMed:18004212, PubMed:18052087, PubMed:18674515, PubMed:19545173). Essential for the elimination and detoxification of drugs, xenobiotics and endogenous compounds (PubMed:12181437, PubMed:18004212). Catalyzes the glucuronidation of endogenous estrogen hormones such as estradiol and estrone (PubMed:15472229). Also catalyzes the glucuronidation of the isoflavones genistein, daidzein, glycitein, formononetin, biochanin A and prunetin, which are phytoestrogens with anticancer and cardiovascular properties (PubMed:18052087, PubMed:19545173). Involved in the glucuronidation of the AGTR1 angiotensin receptor antagonist caderastan, a drug which can inhibit the effect of angiotensin II (PubMed:18674515). Involved in the biotransformation of 7-ethyl-10-hydroxycamptothecin (SN-38), the pharmacologically active metabolite of the anticancer drug irinotecan (PubMed:12181437, PubMed:20610558). Also metabolizes mycophenolate, an immunosuppressive agent (PubMed:15470161, PubMed:18004212).", "evidence": [ { "database": "UniProtKB", "id": "O60656", "url": "https://www.uniprot.org/uniprot/O60656#function" }, { "database": "PubMed", "id": "19545173", "url": "https://glygen.org/publication/PubMed/19545173" }, { "database": "PubMed", "id": "20610558", "url": "https://glygen.org/publication/PubMed/20610558" }, { "database": "PubMed", "id": "18052087", "url": "https://glygen.org/publication/PubMed/18052087" }, { "database": "PubMed", "id": "12181437", "url": "https://glygen.org/publication/PubMed/12181437" }, { "database": "PubMed", "id": "15470161", "url": "https://glygen.org/publication/PubMed/15470161" }, { "database": "PubMed", "id": "18674515", "url": "https://glygen.org/publication/PubMed/18674515" }, { "database": "PubMed", "id": "15472229", "url": "https://glygen.org/publication/PubMed/15472229" }, { "database": "PubMed", "id": "18004212", "url": "https://glygen.org/publication/PubMed/18004212" } ] }, { "annotation": "UGT1A1 and UGT1A9 Are Responsible for Phase II Metabolism of Tectorigenin and Irigenin In Vitro. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_066307", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_066307" }, { "database": "PubMed", "id": "35807350", "url": "https://glygen.org/publication/PubMed/35807350" } ] }, { "annotation": "Worsening of Kidney Transplant Function During 2-Year Follow-up Is Associated With the Genetic Variants of CYP3A4, MDR1, and UGT1A9.", "evidence": [ { "database": "RefSeq", "id": "NP_066307", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_066307" }, { "database": "PubMed", "id": "32222391", "url": "https://glygen.org/publication/PubMed/32222391" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs1466984544", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1466984544" }, { "id": "rs1466984544", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1466984544#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 246, "end_pos": 246, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SHT->NHT).", "chr_id": "2", "chr_pos": "233672671", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S246", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs928021157", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs928021157" }, { "id": "rs928021157", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs928021157#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 294, "end_pos": 294, "sequence_org": "S", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NAS->NAY).", "chr_id": "2", "chr_pos": "233767059", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S294", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O60656", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O60656" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 340, "end_pos": 340, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "L", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "2", "chr_pos": "233767880", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "S340", "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] }, { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] }, { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs771899094", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771899094" }, { "id": "rs771899094", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771899094" }, { "id": "rs771899094", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs771899094" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 343, "end_pos": 343, "sequence_org": "A", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NLA->NLS).", "chr_id": "2", "chr_pos": "233767888", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A343", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs771899094", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771899094" }, { "id": "rs771899094", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771899094" }, { "id": "rs771899094", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs771899094" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 343, "end_pos": 343, "sequence_org": "A", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NLA->NLT).", "chr_id": "2", "chr_pos": "233767888", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A343", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1575830712", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1575830712" }, { "id": "rs1575830712", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1575830712" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 344, "end_pos": 344, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->KNT).", "chr_id": "2", "chr_pos": "233767893", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N344", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs776227074", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776227074" }, { "id": "rs776227074", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776227074" }, { "id": "rs776227074", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776227074" }, { "id": "rs776227074", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs776227074" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 346, "end_pos": 346, "sequence_org": "T", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->NNK).", "chr_id": "2", "chr_pos": "233767898", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T346", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs776227074", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776227074" }, { "id": "rs776227074", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776227074" }, { "id": "rs776227074", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs776227074" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 346, "end_pos": 346, "sequence_org": "T", "sequence_mut": "M", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NNT->NNM).", "chr_id": "2", "chr_pos": "233767898", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T346", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs202172337", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs202172337" }, { "id": "rs202172337", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs202172337" }, { "id": "rs202172337", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs202172337" }, { "id": "rs202172337", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs202172337#frequency_tab" }, { "id": "rs202172337", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs202172337" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 438, "end_pos": 438, "sequence_org": "M", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NIM->NIT).", "chr_id": "2", "chr_pos": "233772279", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "M438", "keywords": [ "ebi", "germline", "disease" ], "disease": [ { "disease_id": "DOID:2739", "recommended_name": { "id": "DOID:2739", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2739", "name": "Gilbert syndrome", "description": "A bilirubin metabolic disorder that involves elevated levels of unconjugated bilirubin as bilirubin is not being conjugated as a result of reduced glucuronyltransferase activity." }, "synonyms": [ { "id": "DOID:2739", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2739", "name": "Constitutional hyperbilirubinemia", "description": "" }, { "id": "DOID:2739", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2739", "name": "Gilbert's disease", "description": "" }, { "id": "DOID:2739", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2739", "name": "Gilbert's syndrome", "description": "" }, { "id": "DOID:2739", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2739", "name": "Gilbert-Meulengracht syndrome", "description": "" }, { "id": "DOID:2739", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2739", "name": "hereditary nonhemolytic jaundice", "description": "" }, { "id": "MONDO:0007745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007745", "name": "Gilbert syndrome", "description": "An autosomal recessive inherited disorder characterized by unconjugated hyperbilirubinemia, resulting in harmless intermittent jaundice." }, { "id": "MONDO:0007745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007745", "name": "Gilbert disease", "description": "" }, { "id": "MONDO:0007745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007745", "name": "Gilbert syndrome", "description": "" }, { "id": "MONDO:0007745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007745", "name": "Gilbert's disease", "description": "" }, { "id": "MONDO:0007745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007745", "name": "Gilbert's syndrome", "description": "" }, { "id": "MONDO:0007745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007745", "name": "Gilbert-Meulengracht syndrome", "description": "" }, { "id": "MONDO:0007745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007745", "name": "constitutional hyperbilirubinemia", "description": "" }, { "id": "MONDO:0007745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007745", "name": "familial cholemia", "description": "" }, { "id": "MONDO:0007745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007745", "name": "hereditary nonhemolytic jaundice", "description": "" }, { "id": "MONDO:0007745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007745", "name": "hyperbilirubinemia type 1", "description": "" }, { "id": "MONDO:0007745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007745", "name": "hyperbilirubinemia 1", "description": "" }, { "id": "MONDO:0007745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007745", "name": "hyperbilirubinemia, Arias type", "description": "" }, { "id": "MONDO:0007745", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007745", "name": "hyperbilirubinemia, Gilbert type", "description": "" }, { "id": "MIM:143500", "resource": "MIM", "url": "https://www.omim.org/entry/143500", "name": "Gilbert syndrome", "description": "Gilbert syndrome" } ] } ] }, { "evidence": [ { "id": "O60656", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O60656" }, { "id": "rs751579554", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751579554" }, { "id": "rs751579554", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751579554" }, { "id": "rs751579554", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751579554" }, { "id": "rs751579554", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs751579554#frequency_tab" }, { "id": "rs751579554", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs751579554" }, { "id": "22980975", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22980975" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 477, "end_pos": 477, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "D", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (DLT->NLT).", "chr_id": "2", "chr_pos": "233772395", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "D477", "disease": [ { "disease_id": "DOID:1115", "recommended_name": { "id": "DOID:1115", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1115", "name": "sarcoma", "description": "A cell type cancer that has_material_basis_in abnormally proliferating cells derives from embryonic mesoderm." }, "synonyms": [ { "id": "DOID:1115", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1115", "name": "connective and soft tissue neoplasm", "description": "" }, { "id": "DOID:1115", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1115", "name": "tumor of soft tissue and skeleton", "description": "" } ] }, { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi" ] }, { "evidence": [ { "id": "rs34993780", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs34993780" }, { "id": "rs34993780", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs34993780" }, { "id": "rs34993780", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs34993780" }, { "id": "rs34993780", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs34993780#frequency_tab" }, { "id": "rs34993780", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs34993780" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 483, "end_pos": 483, "sequence_org": "Y", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (YHS->NHS).", "chr_id": "2", "chr_pos": "233772413", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "0.000799", "site_lbl": "Y483", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs527774940", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs527774940" }, { "id": "rs527774940", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs527774940" }, { "id": "rs527774940", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs527774940" }, { "id": "rs527774940", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs527774940" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 71, "end_pos": 71, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->SCT).", "chr_id": "2", "chr_pos": "233672146", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "N71", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs749791560", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749791560" }, { "id": "rs749791560", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs749791560" }, { "id": "rs749791560", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs749791560" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 73, "end_pos": 73, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCT->NCA).", "chr_id": "2", "chr_pos": "233672151", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T73", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "98.46", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000241119", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000241119" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "53.47", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000241119", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000241119" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "17.43", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000241119", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000241119" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "55.38", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000241119", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000241119" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "51.52", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000241119", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000241119" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "19.27", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000241119", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000241119" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "91.76", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000241119", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000241119" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "19.86", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000241119", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000241119" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "17.37", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000241119", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000241119" } ] } ], "expression_disease": [ { "significant": "No", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O60656", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60656" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O60656", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60656" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O60656", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60656" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O60656", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60656" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O60656", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60656" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O60656", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60656" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O60656", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60656" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O60656", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60656" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O60656", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60656" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O60656", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60656" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O60656", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60656" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O60656", "url": "https://www.uniprot.org/uniprot/O60656" } ], "common_name": "Human" } ], "gene": [ { "name": "UGT1A9", "url": "https://www.uniprot.org/uniprot/O60656", "locus": { "chromosome": "2", "start_pos": 233773300, "end_pos": 233671898, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000241119", "url": "https://www.ensembl.org/id/ENSG00000241119" } ] } } ], "crossref": [ { "id": "ENSG00000241119", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000241119", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "O60656", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O60656", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "2.4.1.17", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.4.1.17&UniProtAcc=O60656", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "GT1", "url": "http://www.cazy.org/GT1.html", "database": "CAZy", "categories": [ "Protein Classification" ] }, { "id": "cd03784", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd03784", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL1743319", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL1743319", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "UGT1A9", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=UGT1A9", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "54600", "url": "https://www.ncbi.nlm.nih.gov/gene/54600", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "1881", "url": "https://glyconnect.expasy.org/browser/proteins/1881", "database": "GlyConnect", "categories": [ "Glycoproteomics", "Glycan" ] }, { "id": "12541", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=12541", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O60656", "url": "https://www.ebi.ac.uk/intact/interactors/id:O60656*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR002213", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002213", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR035595", "url": "https://www.ebi.ac.uk/interpro/entry/IPR035595", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:54600", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:54600", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "191740", "url": "http://www.omim.org/entry/191740", "database": "MIM", "categories": [ "Other" ] }, { "id": "606434", "url": "http://www.omim.org/entry/606434", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O60656", "url": "https://www.nextprot.org/entry/NX_O60656", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "LMGSYND", "url": "https://omabrowser.org/oma/group/LMGSYND/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "382054at2759", "url": "http://www.orthodb.org/?query=382054at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR48043", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48043", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR48043:SF147", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48043:SF147", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00201", "url": "http://pfam.xfam.org/family/PF00201", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O60656", "url": "https://pharos.nih.gov/targets/O60656", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O60656", "url": "http://purl.obolibrary.org/obo/PR_O60656", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-156588", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156588", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_066307", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_066307", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "21032", "url": "https://www.rhea-db.org/rhea/21032", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "53004", "url": "https://www.rhea-db.org/rhea/53004", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "53040", "url": "https://www.rhea-db.org/rhea/53040", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "53048", "url": "https://www.rhea-db.org/rhea/53048", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "53060", "url": "https://www.rhea-db.org/rhea/53060", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "63612", "url": "https://www.rhea-db.org/rhea/63612", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "63696", "url": "https://www.rhea-db.org/rhea/63696", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "63704", "url": "https://www.rhea-db.org/rhea/63704", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "63724", "url": "https://www.rhea-db.org/rhea/63724", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "O60656", "url": "https://www.uniprot.org/uniprot/O60656", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O60656-1", "url": "https://www.uniprot.org/uniprot/O60656-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O60656-2", "url": "https://www.uniprot.org/uniprot/O60656-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MACTGWTSPLPLCVCLLLTCGFAEAGKLLVVPMDGSHWFTMRSVVEKLILRGHEVVVVMPEVSWQLGRSLNCTVKTYSTSYTLEDLDREFKAFAHAQWKAQVRSIYSLLMGSYNDIFDLFFSNCRSLFKDKKLVEYLKESSFDAVFLDPFDNCGLIVAKYFSLPSVVFARGILCHYLEEGAQCPAPLSYVPRILLGFSDAMTFKERVRNHIMHLEEHLLCHRFFKNALEIASEILQTPVTEYDLYSHTSIWLLRTDFVLDYPKPVMPNMIFIGGINCHQGKPLPMEFEAYINASGEHGIVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQNDLLGHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDLENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH", "length": 530, "header": "sp|O60656-1|UD19_HUMAN Isoform 1 of UDP-glucuronosyltransferase 1A9 OS=Homo sapiens OX=9606 GN=UGT1A9 PE=1 SV=1 CANONICAL=O60656-1" }, "isoforms": [ { "isoform_ac": "O60656-1", "url": "", "sequence": { "sequence": "MACTGWTSPLPLCVCLLLTCGFAEAGKLLVVPMDGSHWFTMRSVVEKLILRGHEVVVVMPEVSWQLGRSLNCTVKTYSTSYTLEDLDREFKAFAHAQWKAQVRSIYSLLMGSYNDIFDLFFSNCRSLFKDKKLVEYLKESSFDAVFLDPFDNCGLIVAKYFSLPSVVFARGILCHYLEEGAQCPAPLSYVPRILLGFSDAMTFKERVRNHIMHLEEHLLCHRFFKNALEIASEILQTPVTEYDLYSHTSIWLLRTDFVLDYPKPVMPNMIFIGGINCHQGKPLPMEFEAYINASGEHGIVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQNDLLGHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDLENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH", "length": 530, "header": "sp|O60656-1|UD19_HUMAN Isoform 1 of UDP-glucuronosyltransferase 1A9 OS=Homo sapiens OX=9606 GN=UGT1A9 PE=1 SV=1 CANONICAL=O60656-1" }, "locus": { "chromosome": "2", "start_pos": 233772556, "end_pos": 233671935, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000354728.5", "url": "https://www.ensembl.org/id/ENST00000354728.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000346768.4", "url": "https://www.ensembl.org/id/ENSP00000346768.4" } ] } }, { "isoform_ac": "O60656-2", "url": "", "sequence": { "sequence": "MACTGWTSPLPLCVCLLLTCGFAEAGKLLVVPMDGSHWFTMRSVVEKLILRGHEVVVVMPEVSWQLGRSLNCTVKTYSTSYTLEDLDREFKAFAHAQWKAQVRSIYSLLMGSYNDIFDLFFSNCRSLFKDKKLVEYLKESSFDAVFLDPFDNCGLIVAKYFSLPSVVFARGILCHYLEEGAQCPAPLSYVPRILLGFSDAMTFKERVRNHIMHLEEHLLCHRFFKNALEIASEILQTPVTEYDLYSHTSIWLLRTDFVLDYPKPVMPNMIFIGGINCHQGKPLPMEFEAYINASGEHGIVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQNDLLGHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDLENALKAVINDKRKKQQSGRQM", "length": 441, "header": "sp|O60656-2|UD19_HUMAN Isoform 2 of UDP-glucuronosyltransferase 1A9 OS=Homo sapiens OX=9606 GN=UGT1A9 PE=1 SV=1 CANONICAL=O60656-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 292, "start_aa": "Asn", "end_pos": 292, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn292", "evidence": [ { "id": "O60656", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60656#ptm_processing" }, { "id": "19951703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19951703" } ] }, { "glytoucan_ac": "G14669DU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 344, "start_aa": "Asn", "end_pos": 344, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn344", "evidence": [ { "id": "1881", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1881" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "G39188ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 344, "start_aa": "Asn", "end_pos": 344, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn344", "evidence": [ { "id": "1881", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1881" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 344, "start_aa": "Asn", "end_pos": 344, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn344", "evidence": [ { "id": "O60656", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60656#ptm_processing" }, { "id": "19951703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19951703" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 71, "start_aa": "Asn", "end_pos": 71, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn71", "evidence": [ { "id": "O60656", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60656#ptm_processing" }, { "id": "19951703", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19951703" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme", "glycosyltransferase-activity", "glycoprotein", "glycoprotein_reported", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Drug resistance and ATP-dependent conjugate transport mediated by the apical multidrug resistance protein, MRP2, permanently expressed in human and canine cells.", "journal": "Molecular pharmacology", "date": "1999", "authors": "Cui Y, Konig J, Buchholz JK, Spring H, Leier I, Keppler D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "10220572", "url": "https://glygen.org/publication/PubMed/10220572" } ] }, { "title": "Characterization of the CoA ligases of human liver mitochondria catalyzing the activation of short- and medium-chain fatty acids and xenobiotic carboxylic acids.", "journal": "Biochimica et biophysica acta", "date": "1999", "authors": "Vessey DA, Kelley M, Warren RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "10434065", "url": "https://glygen.org/publication/PubMed/10434065" } ] }, { "title": "Contribution of CYP2E1 and CYP3A to acetaminophen reactive metabolite formation.", "journal": "Clinical pharmacology and therapeutics", "date": "2000", "authors": "Manyike PT, Kharasch ED, Kalhorn TF, Slattery JT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "10741631", "url": "https://glygen.org/publication/PubMed/10741631" } ] }, { "title": "The murine and human cholesterol 7alpha-hydroxylase gene promoters are differentially responsive to regulation by fatty acids mediated via peroxisome proliferator-activated receptor alpha.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Cheema SK, Agellon LB", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "10777541", "url": "https://glygen.org/publication/PubMed/10777541" } ] }, { "title": "Alternative splicing and tissue-specific transcription of human and rodent ubiquitous 5-aminolevulinate synthase (ALAS1) genes.", "journal": "Biochimica et biophysica acta", "date": "2001", "authors": "Roberts AG, Elder GH", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "11267664", "url": "https://glygen.org/publication/PubMed/11267664" } ] }, { "title": "Isolation of a family of organic anion transporters from human liver and kidney.", "journal": "Biochemical and biophysical research communications", "date": "2001", "authors": "Sun W, Wu RR, van Poelje PD, Erion MD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "11327718", "url": "https://glygen.org/publication/PubMed/11327718" } ] }, { "title": "Thirteen UDP-glucuronosyltransferase genes are encoded at the human UGT1 gene complex locus.", "journal": "Pharmacogenetics", "date": "2001", "authors": "Gong QH, Cho JW, Huang T, Potter C, Gholami N, Basu NK, Kubota S, Carvalho S, Pennington MW, Owens IS, Popescu NC", "evidence": [ { "database": "UniProtKB", "id": "O60656", "url": "https://www.uniprot.org/uniprot/O60656" } ], "reference": [ { "type": "PubMed", "id": "11434514", "url": "https://glygen.org/publication/PubMed/11434514" } ] }, { "title": "Characterization of drug transport by the human multidrug resistance protein 3 (ABCC3).", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Zelcer N, Saeki T, Reid G, Beijnen JH, Borst P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "11581266", "url": "https://glygen.org/publication/PubMed/11581266" } ] }, { "title": "Interindividual variability in acetaminophen glucuronidation by human liver microsomes: identification of relevant acetaminophen UDP-glucuronosyltransferase isoforms.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "2001", "authors": "Court MH, Duan SX, von Moltke LL, Greenblatt DJ, Patten CJ, Miners JO, Mackenzie PI", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "11714888", "url": "https://glygen.org/publication/PubMed/11714888" } ] }, { "title": "Peroxisome proliferator-activated receptor alpha (PPARalpha ) turnover by the ubiquitin-proteasome system controls the ligand-induced expression level of its target genes.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Blanquart C, Barbier O, Fruchart JC, Staels B, Glineur C", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "12118000", "url": "https://glygen.org/publication/PubMed/12118000" } ] }, { "title": "Transcriptional activities of nuclear SREBP-1a, -1c, and -2 to different target promoters of lipogenic and cholesterogenic genes.", "journal": "Journal of lipid research", "date": "2002", "authors": "Amemiya-Kudo M, Shimano H, Hasty AH, Yahagi N, Yoshikawa T, Matsuzaka T, Okazaki H, Tamura Y, Iizuka Y, Ohashi K, Osuga J, Harada K, Gotoda T, Sato R, Kimura S, Ishibashi S, Yamada N", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "12177166", "url": "https://glygen.org/publication/PubMed/12177166" } ] }, { "title": "Common human UGT1A polymorphisms and the altered metabolism of irinotecan active metabolite 7-ethyl-10-hydroxycamptothecin (SN-38).", "journal": "Molecular pharmacology", "date": "2002", "authors": "Gagne JF, Montminy V, Belanger P, Journault K, Gaucher G, Guillemette C", "evidence": [ { "database": "UniProtKB", "id": "O60656", "url": "https://www.uniprot.org/uniprot/O60656" } ], "reference": [ { "type": "PubMed", "id": "12181437", "url": "https://glygen.org/publication/PubMed/12181437" } ] }, { "title": "Characterization of nicotine and cotinine N-glucuronidations in human liver microsomes.", "journal": "Drug metabolism and disposition: the biological fate of chemicals", "date": "2002", "authors": "Nakajima M, Tanaka E, Kwon JT, Yokoi T", "evidence": [ { "database": "Reactome", "id": "R-HSA-156588", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156588" } ], "reference": [ { "type": "PubMed", "id": "12433823", "url": "https://glygen.org/publication/PubMed/12433823" } ] }, { "title": "Sequence identification and characterization of human carnosinase and a closely related non-specific dipeptidase.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Teufel M, Saudek V, Ledig JP, Bernhardt A, Boularand S, Carreau A, Cairns NJ, Carter C, Cowley DJ, Duverger D, Ganzhorn AJ, Guenet C, Heintzelmann B, Laucher V, Sauvage C, Smirnova T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "12473676", "url": "https://glygen.org/publication/PubMed/12473676" } ] }, { "title": "Regulation of P450 4A expression by peroxisome proliferator activated receptors.", "journal": "Toxicology", "date": "2002", "authors": "Johnson EF, Hsu MH, Savas U, Griffin KJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "12505311", "url": "https://glygen.org/publication/PubMed/12505311" } ] }, { "title": "The UDP-glucuronosyltransferase 1A9 enzyme is a peroxisome proliferator-activated receptor alpha and gamma target gene.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Barbier O, Villeneuve L, Bocher V, Fontaine C, Torra IP, Duhem C, Kosykh V, Fruchart JC, Guillemette C, Staels B", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "12582161", "url": "https://glygen.org/publication/PubMed/12582161" } ] }, { "title": "Isolation, sequencing, and expression of a cDNA for the HXM-A form of xenobiotic/medium-chain fatty acid:CoA ligase from human liver mitochondria.", "journal": "Journal of biochemical and molecular toxicology", "date": "2003", "authors": "Vessey DA, Lau E, Kelley M, Warren RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "12616642", "url": "https://glygen.org/publication/PubMed/12616642" } ] }, { "title": "A novel complex locus UGT1 encodes human bilirubin, phenol, and other UDP-glucuronosyltransferase isozymes with identical carboxyl termini.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Ritter JK, Chen F, Sheen YY, Tran HM, Kimura S, Yeatman MT, Owens IS", "evidence": [ { "database": "Reactome", "id": "R-HSA-156588", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156588" } ], "reference": [ { "type": "PubMed", "id": "1339448", "url": "https://glygen.org/publication/PubMed/1339448" } ] }, { "title": "Interaction of serum and sodium salicylate: changes during acute infection and its influence on pharmacological activity.", "journal": "Bulletin of the Johns Hopkins Hospital", "date": "1960", "authors": "REYNOLDS RC, CLUFF LE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "13741103", "url": "https://glygen.org/publication/PubMed/13741103" } ] }, { "title": "N-glucuronidation of nicotine and cotinine by human liver microsomes and heterologously expressed UDP-glucuronosyltransferases.", "journal": "Drug metabolism and disposition: the biological fate of chemicals", "date": "2003", "authors": "Kuehl GE, Murphy SE", "evidence": [ { "database": "Reactome", "id": "R-HSA-156588", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156588" } ], "reference": [ { "type": "PubMed", "id": "14570768", "url": "https://glygen.org/publication/PubMed/14570768" } ] }, { "title": "Effect of peroxisome proliferator-activated receptor alpha on human angiotensinogen promoter.", "journal": "International journal of molecular medicine", "date": "2004", "authors": "Shimamoto Y, Hirota K, Fukamizu A", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "15067378", "url": "https://glygen.org/publication/PubMed/15067378" } ] }, { "title": "Functional analysis of peroxisome-proliferator-responsive element motifs in genes of fatty acid-binding proteins.", "journal": "The Biochemical journal", "date": "2004", "authors": "Schachtrup C, Emmler T, Bleck B, Sandqvist A, Spener F", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "15130092", "url": "https://glygen.org/publication/PubMed/15130092" } ] }, { "title": "Quaternary ammonium-linked glucuronidation of tamoxifen by human liver microsomes and UDP-glucuronosyltransferase 1A4.", "journal": "Biochemical pharmacology", "date": "2004", "authors": "Kaku T, Ogura K, Nishiyama T, Ohnuma T, Muro K, Hiratsuka A", "evidence": [ { "database": "Reactome", "id": "R-HSA-156588", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156588" } ], "reference": [ { "type": "PubMed", "id": "15135306", "url": "https://glygen.org/publication/PubMed/15135306" } ] }, { "title": "Identification of the UDP-glucuronosyltransferase isoforms involved in mycophenolic acid phase II metabolism.", "journal": "Drug metabolism and disposition: the biological fate of chemicals", "date": "2005-01", "authors": "Picard Nicolas, Ratanasavanh Damrong, Pr\u00e9maud Aur\u00e9lie, Le Meur Yonnick, Marquet Pierre", "evidence": [ { "database": "UniProtKB", "id": "O60656", "url": "https://www.uniprot.org/uniprot/O60656" } ], "reference": [ { "type": "PubMed", "id": "15470161", "url": "https://glygen.org/publication/PubMed/15470161" } ] }, { "title": "Specificity and regioselectivity of the conjugation of estradiol, estrone, and their catecholestrogen and methoxyestrogen metabolites by human uridine diphospho-glucuronosyltransferases expressed in endometrium.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2004-10", "authors": "L\u00e9pine Johanie, Bernard Olivier, Plante Marie, T\u00eatu Bernard, Pelletier Georges, Labrie Fernand, B\u00e9langer Alain, Guillemette Chantal", "evidence": [ { "database": "UniProtKB", "id": "O60656", "url": "https://www.uniprot.org/uniprot/O60656" } ], "reference": [ { "type": "PubMed", "id": "15472229", "url": "https://glygen.org/publication/PubMed/15472229" } ] }, { "title": "Regulation of human hepatic hydroxysteroid sulfotransferase gene expression by the peroxisome proliferator-activated receptor alpha transcription factor.", "journal": "Molecular pharmacology", "date": "2005", "authors": "Fang HL, Strom SC, Cai H, Falany CN, Kocarek TA, Runge-Morris M", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "15635043", "url": "https://glygen.org/publication/PubMed/15635043" } ] }, { "title": "Glucuronidation of the aspirin metabolite salicylic acid by expressed UDP-glucuronosyltransferases and human liver microsomes.", "journal": "Drug metabolism and disposition: the biological fate of chemicals", "date": "2006", "authors": "Kuehl GE, Bigler J, Potter JD, Lampe JW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "16258079", "url": "https://glygen.org/publication/PubMed/16258079" } ] }, { "title": "Identification of novel PPARgamma target genes in primary human adipocytes.", "journal": "Gene", "date": "2006", "authors": "Perera RJ, Marcusson EG, Koo S, Kang X, Kim Y, White N, Dean NM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "16380219", "url": "https://glygen.org/publication/PubMed/16380219" } ] }, { "title": "Human UDP-glucuronosyltransferase, UGT1A8, glucuronidates dihydrotestosterone to a monoglucuronide and further to a structurally novel diglucuronide.", "journal": "Drug Metab. Dispos.", "date": "2006", "authors": "Murai Takahiro, Samata Naozumi, Iwabuchi Haruo, Ikeda Toshihiko", "evidence": [ { "database": "UniProtKB", "id": "O60656", "url": "https://www.uniprot.org/uniprot/O60656" } ], "reference": [ { "type": "PubMed", "id": "16595710", "url": "https://glygen.org/publication/PubMed/16595710" } ] }, { "title": "Kinetics of acetaminophen glucuronidation by UDP-glucuronosyltransferases 1A1, 1A6, 1A9 and 2B15. Potential implications in acetaminophen-induced hepatotoxicity.", "journal": "Chemical research in toxicology", "date": "2006", "authors": "Mutlib AE, Goosen TC, Bauman JN, Williams JA, Kulkarni S, Kostrubsky S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "16696573", "url": "https://glygen.org/publication/PubMed/16696573" } ] }, { "title": "Substrate specificity of carboxylesterase isozymes and their contribution to hydrolase activity in human liver and small intestine.", "journal": "Drug metabolism and disposition: the biological fate of chemicals", "date": "2006", "authors": "Imai T, Taketani M, Shii M, Hosokawa M, Chiba K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "16837570", "url": "https://glygen.org/publication/PubMed/16837570" } ] }, { "title": "Human carboxylesterase isozymes: catalytic properties and rational drug design.", "journal": "Drug metabolism and pharmacokinetics", "date": "2006", "authors": "Imai T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "16858120", "url": "https://glygen.org/publication/PubMed/16858120" } ] }, { "title": "Antiplatelet agents aspirin and clopidogrel are hydrolyzed by distinct carboxylesterases, and clopidogrel is transesterificated in the presence of ethyl alcohol.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "2006", "authors": "Tang M, Mukundan M, Yang J, Charpentier N, LeCluyse EL, Black C, Yang D, Shi D, Yan B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "16943252", "url": "https://glygen.org/publication/PubMed/16943252" } ] }, { "title": "The consensus coding sequences of human breast and colorectal cancers.", "journal": "Science (New York, N.Y.)", "date": "2006", "authors": "Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE", "evidence": [ { "database": "UniProtKB", "id": "O60656", "url": "https://www.uniprot.org/uniprot/O60656" } ], "reference": [ { "type": "PubMed", "id": "16959974", "url": "https://glygen.org/publication/PubMed/16959974" } ] }, { "title": "The arylhydrocarbon receptor repressor (AhRR): structure, expression, and function.", "journal": "Biological chemistry", "date": "2006", "authors": "Haarmann-Stemmann T, Abel J", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "16972786", "url": "https://glygen.org/publication/PubMed/16972786" } ] }, { "title": "Oligomerization of the UDP-glucuronosyltransferase 1A proteins: homo- and heterodimerization analysis by fluorescence resonance energy transfer and co-immunoprecipitation.", "journal": "J. Biol. Chem.", "date": "2007", "authors": "Opera\u00f1a Theresa N, Tukey Robert H", "evidence": [ { "database": "UniProtKB", "id": "O60656", "url": "https://www.uniprot.org/uniprot/O60656" } ], "reference": [ { "type": "PubMed", "id": "17179145", "url": "https://glygen.org/publication/PubMed/17179145" } ] }, { "title": "Molecular mechanism of phase I and phase II drug-metabolizing enzymes: implications for detoxification.", "journal": "International review of cytology", "date": "2007", "authors": "Iyanagi T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "17482904", "url": "https://glygen.org/publication/PubMed/17482904" } ] }, { "title": "Induction of hepatobiliary efflux transporters in acetaminophen-induced acute liver failure cases.", "journal": "Drug metabolism and disposition: the biological fate of chemicals", "date": "2007", "authors": "Barnes SN, Aleksunes LM, Augustine L, Scheffer GL, Goedken MJ, Jakowski AB, Pruimboom-Brees IM, Cherrington NJ, Manautou JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "17627974", "url": "https://glygen.org/publication/PubMed/17627974" } ] }, { "title": "Model representation of salicylate pharmacokinetics using unbound plasma salicylate concentrations and metabolite urinary excretion rates following a single oral dose.", "journal": "Journal of pharmacokinetics and biopharmaceutics", "date": "1991", "authors": "Shen J, Wanwimolruk S, Purves RD, McQueen EG, Roberts MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "1783992", "url": "https://glygen.org/publication/PubMed/1783992" } ] }, { "title": "Kinetic characterization and identification of the acylation and glycosylation sites of recombinant human gamma-glutamyltranspeptidase.", "journal": "Biochemistry", "date": "2007", "authors": "Castonguay R, Halim D, Morin M, Furtos A, Lherbet C, Bonneil E, Thibault P, Keillor JW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "17924658", "url": "https://glygen.org/publication/PubMed/17924658" } ] }, { "title": "Genetic diversity at the UGT1 locus is amplified by a novel 3' alternative splicing mechanism leading to nine additional UGT1A proteins that act as regulators of glucuronidation activity.", "journal": "Pharmacogenetics and genomics", "date": "2007-12", "authors": "Girard Hugo, L\u00e9vesque Eric, Bellemare Judith, Journault Kim, Caillier Bertrand, Guillemette Chantal", "evidence": [ { "database": "UniProtKB", "id": "O60656", "url": "https://www.uniprot.org/uniprot/O60656" } ], "reference": [ { "type": "PubMed", "id": "18004212", "url": "https://glygen.org/publication/PubMed/18004212" } ] }, { "title": "Commentary: bioavailability of flavonoids and polyphenols: call to arms.", "journal": "Molecular pharmaceutics", "date": "2007", "authors": "Hu M", "evidence": [ { "database": "Reactome", "id": "R-HSA-156588", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156588" } ], "reference": [ { "type": "PubMed", "id": "18052085", "url": "https://glygen.org/publication/PubMed/18052085" } ] }, { "title": "Disposition of flavonoids via enteric recycling: enzyme stability affects characterization of prunetin glucuronidation across species, organs, and UGT isoforms.", "journal": "Molecular pharmaceutics", "date": "2007", "authors": "Joseph TB, Wang SW, Liu X, Kulkarni KH, Wang J, Xu H, Hu M", "evidence": [ { "database": "UniProtKB", "id": "O60656", "url": "https://www.uniprot.org/uniprot/O60656" } ], "reference": [ { "type": "PubMed", "id": "18052087", "url": "https://glygen.org/publication/PubMed/18052087" } ] }, { "title": "Interindividual variability in acetaminophen sulfation by human fetal liver: implications for pharmacogenetic investigations of drug-induced birth defects.", "journal": "Birth defects research. Part A, Clinical and molecular teratology", "date": "2008", "authors": "Adjei AA, Gaedigk A, Simon SD, Weinshilboum RM, Leeder JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "18232020", "url": "https://glygen.org/publication/PubMed/18232020" } ] }, { "title": "The human gamma-glutamyltransferase gene family.", "journal": "Human genetics", "date": "2008", "authors": "Heisterkamp N, Groffen J, Warburton D, Sneddon TP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "18357469", "url": "https://glygen.org/publication/PubMed/18357469" } ] }, { "title": "The aryl hydrocarbon receptor complex and the control of gene expression.", "journal": "Critical reviews in eukaryotic gene expression", "date": "2008", "authors": "Beischlag TV, Luis Morales J, Hollingshead BD, Perdew GH", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "18540824", "url": "https://glygen.org/publication/PubMed/18540824" } ] }, { "title": "The human UDP-glucuronosyltransferase UGT1A3 is highly selective towards N2 in the tetrazole ring of losartan, candesartan, and zolarsartan.", "journal": "Biochemical pharmacology", "date": "2008-09-15", "authors": "Alonen Anna, Finel Moshe, Kostiainen Risto", "evidence": [ { "database": "UniProtKB", "id": "O60656", "url": "https://www.uniprot.org/uniprot/O60656" } ], "reference": [ { "type": "PubMed", "id": "18674515", "url": "https://glygen.org/publication/PubMed/18674515" } ] }, { "title": "Differential regulation of human ALAS1 mRNA and protein levels by heme and cobalt protoporphyrin.", "journal": "Molecular and cellular biochemistry", "date": "2008", "authors": "Zheng J, Shan Y, Lambrecht RW, Donohue SE, Bonkovsky HL", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "18719978", "url": "https://glygen.org/publication/PubMed/18719978" } ] }, { "title": "Regulation of constitutive and inducible AHR signaling: complex interactions involving the AHR repressor.", "journal": "Biochemical pharmacology", "date": "2009", "authors": "Hahn ME, Allan LL, Sherr DH", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "18848529", "url": "https://glygen.org/publication/PubMed/18848529" } ] }, { "title": "Transcriptional regulation of HMG-CoA synthase and HMG-CoA reductase genes by human ACBP.", "journal": "Cellular physiology and biochemistry : international journal of experimental cellular physiology, biochemistry, and pharmacology", "date": "2008", "authors": "Vock C, Doring F, Nitz I", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "19088433", "url": "https://glygen.org/publication/PubMed/19088433" } ] }, { "title": "Cloning and stable expression of a new member of the human liver phenol/bilirubin: UDP-glucuronosyltransferase cDNA family.", "journal": "Biochem. J.", "date": "1991", "authors": "Wooster R, Sutherland L, Ebner T, Clarke D, Da Cruz e Silva O, Burchell B", "evidence": [ { "database": "UniProtKB", "id": "O60656", "url": "https://www.uniprot.org/uniprot/O60656" } ], "reference": [ { "type": "PubMed", "id": "1910331", "url": "https://glygen.org/publication/PubMed/1910331" } ] }, { "title": "Analysis of inherited genetic variations at the UGT1 locus in the French-Canadian population.", "journal": "Hum. Mutat.", "date": "2009", "authors": "Menard V, Girard H, Harvey M, Perusse L, Guillemette C", "evidence": [ { "database": "UniProtKB", "id": "O60656", "url": "https://www.uniprot.org/uniprot/O60656" } ], "reference": [ { "type": "PubMed", "id": "19204906", "url": "https://glygen.org/publication/PubMed/19204906" } ] }, { "title": "Human kidney gamma-glutamyl transpeptidase. Catalytic properties, subunit structure, and localization of the gamma-glutamyl binding site on the light subunit.", "journal": "The Journal of biological chemistry", "date": "1977", "authors": "Tate SS, Ross ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "19463", "url": "https://glygen.org/publication/PubMed/19463" } ] }, { "title": "Structure and concentration changes affect characterization of UGT isoform-specific metabolism of isoflavones.", "journal": "Molecular pharmaceutics", "date": "2009", "authors": "Tang L, Singh R, Liu Z, Hu M", "evidence": [ { "database": "UniProtKB", "id": "O60656", "url": "https://www.uniprot.org/uniprot/O60656" }, { "database": "Reactome", "id": "R-HSA-156588", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156588" } ], "reference": [ { "type": "PubMed", "id": "19545173", "url": "https://glygen.org/publication/PubMed/19545173" } ] }, { "title": "Comparative analysis of gene regulation by the transcription factor PPARalpha between mouse and human.", "journal": "PloS one", "date": "2009", "authors": "Rakhshandehroo M, Hooiveld G, Muller M, Kersten S", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "19710929", "url": "https://glygen.org/publication/PubMed/19710929" } ] }, { "title": "Reaction of human albumin with aspirin in vitro: mass spectrometric identification of acetylated lysines 199, 402, 519, and 545.", "journal": "Biochemical pharmacology", "date": "2010", "authors": "Liyasova MS, Schopfer LM, Lockridge O", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "19836360", "url": "https://glygen.org/publication/PubMed/19836360" } ] }, { "title": "Isoform-selective inactivation of human arylamine N-acetyltransferases by reactive metabolites of carcinogenic arylamines.", "journal": "Chemical research in toxicology", "date": "2009", "authors": "Liu L, Wagner CR, Hanna PE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "19842618", "url": "https://glygen.org/publication/PubMed/19842618" } ] }, { "title": "Activating peroxisome proliferator-activated receptor gamma mutant promotes tumor growth in vivo by enhancing angiogenesis.", "journal": "Cancer research", "date": "2009", "authors": "Tian L, Zhou J, Casimiro MC, Liang B, Ojeifo JO, Wang M, Hyslop T, Wang C, Pestell RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "19934321", "url": "https://glygen.org/publication/PubMed/19934321" } ] }, { "title": "N-Glycosylation plays a role in protein folding of human UGT1A9.", "journal": "Biochemical pharmacology", "date": "2010", "authors": "Nakajima M, Koga T, Sakai H, Yamanaka H, Fujiwara R, Yokoi T", "evidence": [ { "database": "UniProtKB", "id": "O60656", "url": "https://www.uniprot.org/uniprot/O60656#ptm_processing" }, { "database": "UniProtKB", "id": "O60656", "url": "https://www.uniprot.org/uniprot/O60656" } ], "reference": [ { "type": "PubMed", "id": "19951703", "url": "https://glygen.org/publication/PubMed/19951703" } ] }, { "title": "Profiling of promoter occupancy by PPARalpha in human hepatoma cells via ChIP-chip analysis.", "journal": "Nucleic acids research", "date": "2010", "authors": "van der Meer DL, Degenhardt T, Vaisanen S, de Groot PJ, Heinaniemi M, de Vries SC, Muller M, Carlberg C, Kersten S", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "20110263", "url": "https://glygen.org/publication/PubMed/20110263" } ] }, { "title": "Membrane transporters in drug development.", "journal": "Nature reviews. Drug discovery", "date": "2010", "authors": "Giacomini KM, Huang SM, Tweedie DJ, Benet LZ, Brouwer KL, Chu X, Dahlin A, Evers R, Fischer V, Hillgren KM, Hoffmaster KA, Ishikawa T, Keppler D, Kim RB, Lee CA, Niemi M, Polli JW, Sugiyama Y, Swaan PW, Ware JA, Wright SH, Yee SW, Zamek-Gliszczynski MJ, Zhang L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "20190787", "url": "https://glygen.org/publication/PubMed/20190787" } ] }, { "title": "Alternatively spliced products of the UGT1A gene interact with the enzymatically active proteins to inhibit glucuronosyltransferase activity in vitro.", "journal": "Drug metabolism and disposition: the biological fate of chemicals", "date": "2010-10", "authors": "Bellemare Judith, Rouleau M\u00e9lanie, Girard Hugo, Harvey Mario, Guillemette Chantal", "evidence": [ { "database": "UniProtKB", "id": "O60656", "url": "https://www.uniprot.org/uniprot/O60656" } ], "reference": [ { "type": "PubMed", "id": "20610558", "url": "https://glygen.org/publication/PubMed/20610558" } ] }, { "title": "UGT1A6 and UGT2B15 polymorphisms and acetaminophen conjugation in response to a randomized, controlled diet of select fruits and vegetables.", "journal": "Drug metabolism and disposition: the biological fate of chemicals", "date": "2011", "authors": "Navarro SL, Chen Y, Li L, Li SS, Chang JL, Schwarz Y, King IB, Potter JD, Bigler J, Lampe JW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "21666065", "url": "https://glygen.org/publication/PubMed/21666065" } ] }, { "title": "Autocatalytic cleavage of human gamma-glutamyl transpeptidase is highly dependent on N-glycosylation at asparagine 95.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "West MB, Wickham S, Quinalty LM, Pavlovicz RE, Li C, Hanigan MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "21712391", "url": "https://glygen.org/publication/PubMed/21712391" } ] }, { "title": "Human alpha/beta hydrolase domain containing 10 (ABHD10) is responsible enzyme for deglucuronidation of mycophenolic acid acyl-glucuronide in liver.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Iwamura A, Fukami T, Higuchi R, Nakajima M, Yokoi T", "evidence": [ { "database": "Reactome", "id": "R-HSA-156588", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156588" } ], "reference": [ { "type": "PubMed", "id": "22294686", "url": "https://glygen.org/publication/PubMed/22294686" } ] }, { "title": "Aminoacylase 1-catalysed deacetylation of bioactives epoxides mycotoxin-derived mercapturates; 3,4-epoxyprecocenes as models of cytotoxic epoxides.", "journal": "Biochimie", "date": "2012", "authors": "Stocker P, Brunel JM, de Rezende L, do Amaral AT, Morelli X, Roche P, Vidal N, Giardina T, Perrier J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "22349737", "url": "https://glygen.org/publication/PubMed/22349737" } ] }, { "title": "Impact of probe compound in MRP2 vesicular transport assays.", "journal": "European journal of pharmaceutical sciences : official journal of the European Federation for Pharmaceutical Sciences", "date": "2012", "authors": "Kidron H, Wissel G, Manevski N, Hakli M, Ketola RA, Finel M, Yliperttula M, Xhaard H, Urtti A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "22406294", "url": "https://glygen.org/publication/PubMed/22406294" } ] }, { "title": "Biowaiver monograph for immediate-release solid oral dosage forms: acetylsalicylic acid.", "journal": "Journal of pharmaceutical sciences", "date": "2012", "authors": "Dressman JB, Nair A, Abrahamsson B, Barends DM, Groot DW, Kopp S, Langguth P, Polli JE, Shah VP, Zimmer M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "22674043", "url": "https://glygen.org/publication/PubMed/22674043" } ] }, { "title": "Mapping the hallmarks of lung adenocarcinoma with massively parallel sequencing.", "journal": "Cell", "date": "2012", "authors": "Imielinski M, Berger AH, Hammerman PS, Hernandez B, Pugh TJ, Hodis E, Cho J, Suh J, Capelletti M, Sivachenko A, Sougnez C, Auclair D, Lawrence MS, Stojanov P, Cibulskis K, Choi K, de Waal L, Sharifnia T, Brooks A, Greulich H, Banerji S, Zander T, Seidel D, Leenders F, Ansen S, Ludwig C, Engel-Riedel W, Stoelben E, Wolf J, Goparju C, Thompson K, Winckler W, Kwiatkowski D, Johnson BE, Janne PA, Miller VA, Pao W, Travis WD, Pass HI, Gabriel SB, Lander ES, Thomas RK, Garraway LA, Getz G, Meyerson M", "evidence": [ { "database": "dbSNP", "id": "rs751579554", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751579554" } ], "reference": [ { "type": "PubMed", "id": "22980975", "url": "https://glygen.org/publication/PubMed/22980975" } ] }, { "title": "Regiospecificity and stereospecificity of human UDP-glucuronosyltransferases in the glucuronidation of estriol, 16-epiestriol, 17-epiestriol, and 13-epiestradiol.", "journal": "Drug Metab. Dispos.", "date": "2013", "authors": "Sneitz N, Vahermo M, Mosorin J, Laakkonen L, Poirier D, Finel M", "evidence": [ { "database": "UniProtKB", "id": "O60656", "url": "https://www.uniprot.org/uniprot/O60656" } ], "reference": [ { "type": "PubMed", "id": "23288867", "url": "https://glygen.org/publication/PubMed/23288867" } ] }, { "title": "Human GGT2 does not autocleave into a functional enzyme: A cautionary tale for interpretation of microarray data on redox signaling.", "journal": "Antioxidants & redox signaling", "date": "2013", "authors": "West MB, Wickham S, Parks EE, Sherry DM, Hanigan MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "23682772", "url": "https://glygen.org/publication/PubMed/23682772" } ] }, { "title": "Nuclear receptor-mediated cell-autonomous oscillatory expression of the circadian transcription factor, neuronal PAS domain protein 2 (NPAS2).", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Matsumura R, Matsubara C, Node K, Takumi T, Akashi M", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "24196956", "url": "https://glygen.org/publication/PubMed/24196956" } ] }, { "title": "Different gamma-glutamyl transpeptidase mRNAs are expressed in human liver and kidney.", "journal": "Biochemical and biophysical research communications", "date": "1989", "authors": "Pawlak A, Wu SJ, Bulle F, Suzuki A, Chikhi N, Ferry N, Baik JH, Siegrist S, Guellaen G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "2573352", "url": "https://glygen.org/publication/PubMed/2573352" } ] }, { "title": "Aromatic hydroxylation of salicylic acid and aspirin by human cytochromes P450.", "journal": "European journal of pharmaceutical sciences : official journal of the European Federation for Pharmaceutical Sciences", "date": "2015", "authors": "Bojic M, Sedgeman CA, Nagy LD, Guengerich FP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "25840124", "url": "https://glygen.org/publication/PubMed/25840124" } ] }, { "title": "PharmGKB summary: pathways of acetaminophen metabolism at the therapeutic versus toxic doses.", "journal": "Pharmacogenetics and genomics", "date": "2015", "authors": "Mazaleuskaya LL, Sangkuhl K, Thorn CF, FitzGerald GA, Altman RB, Klein TE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "26049587", "url": "https://glygen.org/publication/PubMed/26049587" } ] }, { "title": "Sulphation of acetaminophen by the human cytosolic sulfotransferases: a systematic analysis.", "journal": "Journal of biochemistry", "date": "2015", "authors": "Yamamoto A, Liu MY, Kurogi K, Sakakibara Y, Saeki Y, Suiko M, Liu MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "26067475", "url": "https://glygen.org/publication/PubMed/26067475" } ] }, { "title": "Natural Polyphenols for Prevention and Treatment of Cancer.", "journal": "Nutrients", "date": "2016", "authors": "Zhou Y, Zheng J, Li Y, Xu DP, Li S, Chen YM, Li HB", "evidence": [ { "database": "Reactome", "id": "R-HSA-156588", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156588" } ], "reference": [ { "type": "PubMed", "id": "27556486", "url": "https://glygen.org/publication/PubMed/27556486" } ] }, { "title": "Carboxylesterases in lipid metabolism: from mouse to human.", "journal": "Protein & cell", "date": "2018", "authors": "Lian J, Nelson R, Lehner R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "28677105", "url": "https://glygen.org/publication/PubMed/28677105" } ] }, { "title": "Reanalysis of Global Proteomic and Phosphoproteomic Data Identified a Large Number of Glycopeptides.", "journal": "Analytical chemistry", "date": "2018", "authors": "Hu Y, Shah P, Clark DJ, Ao M, Zhang H", "evidence": [ { "database": "GlyConnect", "id": "1881", "url": "https://glyconnect.expasy.org/browser/proteins/1881" } ], "reference": [ { "type": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "title": "Microsomal UDP-glucuronyltransferase-catalyzed bilirubin diglucuronide formation in human liver.", "journal": "Journal of hepatology", "date": "1986", "authors": "Peters WH, Jansen PL", "evidence": [ { "database": "Reactome", "id": "R-HSA-156588", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156588" } ], "reference": [ { "type": "PubMed", "id": "3082969", "url": "https://glygen.org/publication/PubMed/3082969" } ] }, { "title": "Genetic variants in CYP2A6 and UGT1A9 genes associated with urinary nicotine metabolites in young Mexican smokers.", "journal": "The pharmacogenomics journal", "date": "2020", "authors": "Borrego-Soto G, Perez-Paramo YX, Chen G, Santuario-Facio SK, Santos-Guzman J, Posadas-Valay R, Alvarado-Monroy FM, Balderas-Renteria I, Medina-Gonzalez R, Ortiz-Lopez R, Lazarus P, Rojas-Martinez A", "evidence": [ { "database": "RefSeq", "id": "NP_066307", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_066307" } ], "reference": [ { "type": "PubMed", "id": "31959879", "url": "https://glygen.org/publication/PubMed/31959879" } ] }, { "title": "Worsening of Kidney Transplant Function During 2-Year Follow-up Is Associated With the Genetic Variants of CYP3A4, MDR1, and UGT1A9.", "journal": "Transplantation proceedings", "date": "2020", "authors": "Hryniewiecka E, Zegarska J, Zochowska D, Paczek L", "evidence": [ { "database": "RefSeq", "id": "NP_066307", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_066307" } ], "reference": [ { "type": "PubMed", "id": "32222391", "url": "https://glygen.org/publication/PubMed/32222391" } ] }, { "title": "Human multidrug resistance protein 4 (MRP4) is a cellular efflux transporter for paracetamol glutathione and cysteine conjugates.", "journal": "Archives of toxicology", "date": "2020", "authors": "Koenderink JB, van den Heuvel JJMW, Bilos A, Vredenburg G, Vermeulen NPE, Russel FGM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "32472168", "url": "https://glygen.org/publication/PubMed/32472168" } ] }, { "title": "2,3-Dihydroxybenzoic acid is a product of human aspirin metabolism.", "journal": "Biochemical pharmacology", "date": "1988", "authors": "Grootveld M, Halliwell B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "3342084", "url": "https://glygen.org/publication/PubMed/3342084" } ] }, { "title": "The spontaneous and enzymatic reaction of N-acetyl-p-benzoquinonimine with glutathione: a stopped-flow kinetic study.", "journal": "Archives of biochemistry and biophysics", "date": "1988", "authors": "Coles B, Wilson I, Wardman P, Hinson JA, Nelson SD, Ketterer B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "3395122", "url": "https://glygen.org/publication/PubMed/3395122" } ] }, { "title": "UGT1A1 and UGT1A9 Are Responsible for Phase II Metabolism of Tectorigenin and Irigenin In Vitro.", "journal": "Molecules (Basel, Switzerland)", "date": "2022", "authors": "Li J, Xu Z, Gu J", "evidence": [ { "database": "RefSeq", "id": "NP_066307", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_066307" } ], "reference": [ { "type": "PubMed", "id": "35807350", "url": "https://glygen.org/publication/PubMed/35807350" } ] }, { "title": "Significance of UGT1A6, UGT1A9, and UGT2B7 genetic variants and their mRNA expression in the clinical outcome of renal cell carcinoma.", "journal": "Molecular and cellular biochemistry", "date": "2022-12-26", "authors": "Matsumoto Jun, Nishimoto Anzu, Watari Shogo, Ueki Hideo, Shiromizu Shoya, Iwata Naohiro, Takeda Tatsuaki, Ushio Soichiro, Kajizono Makoto, Fujiyoshi Masachika, Koyama Toshihiro, Araki Motoo, Wada Koichiro, Zamami Yoshito, Nasu Yasutomo, Ariyoshi Noritaka", "evidence": [ { "database": "RefSeq", "id": "NP_066307", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_066307" } ], "reference": [ { "type": "PubMed", "id": "36571650", "url": "https://glygen.org/publication/PubMed/36571650" } ] }, { "title": "The metabolism of aspirin in man: a population study.", "journal": "Xenobiotica; the fate of foreign compounds in biological systems", "date": "1986", "authors": "Hutt AJ, Caldwell J, Smith RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "3705620", "url": "https://glygen.org/publication/PubMed/3705620" } ] }, { "title": "Cytochrome P450 2B6 and UDP-Glucuronosyltransferase Enzyme-Mediated Clearance of Ciprofol (HSK3486) in Humans: The Role of Hepatic and Extrahepatic Metabolism.", "journal": "Drug metabolism and disposition: the biological fate of chemicals", "date": "2024-01-09", "authors": "Zhou Yufan, Dong Hongjiao, Fan Jiang, Zhu Mingshe, Liu Lu, Wang Yongbin, Tang Pingming, Chen Xiaoyan", "evidence": [ { "database": "RefSeq", "id": "NP_066307", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_066307" } ], "reference": [ { "type": "PubMed", "id": "38071562", "url": "https://glygen.org/publication/PubMed/38071562" } ] }, { "title": "Bilirubin conjugates in bile of man and rat in the normal state and in liver disease.", "journal": "The Journal of clinical investigation", "date": "1972", "authors": "Fevery J, Van Damme B, Michiels R, De Groote J, Heirwegh KP", "evidence": [ { "database": "Reactome", "id": "R-HSA-156588", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156588" } ], "reference": [ { "type": "PubMed", "id": "4639028", "url": "https://glygen.org/publication/PubMed/4639028" } ] }, { "title": "Absorption kinetics of aspirin in man following oral administration of an aqueous solution.", "journal": "Journal of pharmaceutical sciences", "date": "1972", "authors": "Rowland M, Riegelman S, Harris PA, Sholkoff SD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "5013373", "url": "https://glygen.org/publication/PubMed/5013373" } ] }, { "title": "Structural changes in human serum albumin induced by ingestion of acetylsalicylic acid.", "journal": "The Journal of clinical investigation", "date": "1969", "authors": "Hawkins D, Pinckard RN, Crawford IP, Farr RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "5773090", "url": "https://glygen.org/publication/PubMed/5773090" } ] }, { "title": "Pharmacokinetics of salicylate elimination in man.", "journal": "Journal of pharmaceutical sciences", "date": "1965", "authors": "Levy G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "5862532", "url": "https://glygen.org/publication/PubMed/5862532" } ] }, { "title": "Difference in hepatic uptake kinetics of aspirin and salicylamide in rats.", "journal": "Biochemical pharmacology", "date": "1984", "authors": "Iwamoto K, Furune Y, Watanabe J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "6487359", "url": "https://glygen.org/publication/PubMed/6487359" } ] }, { "title": "The hepatic microsomal formation of bilirubin diglucuronide.", "journal": "The Journal of biological chemistry", "date": "1983", "authors": "Gordon ER, Sommerer U, Goresky CA", "evidence": [ { "database": "Reactome", "id": "R-HSA-156588", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156588" } ], "reference": [ { "type": "PubMed", "id": "6654901", "url": "https://glygen.org/publication/PubMed/6654901" } ] }, { "title": "Plasma aspirin esterases in normal individuals, patients with alcoholic liver disease and rheumatoid arthritis: characterization and the importance of the enzymic components.", "journal": "European journal of clinical investigation", "date": "1980", "authors": "Rainsford KD, Ford NL, Brooks PM, Watson HM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "6777177", "url": "https://glygen.org/publication/PubMed/6777177" } ] }, { "title": "Bilirubin mono- and diglucuronide formation by human liver in vitro: assay by high-pressure liquid chromatography.", "journal": "Hepatology (Baltimore, Md.)", "date": "1981", "authors": "Chowdhury JR, Chowdhury NR, Wu G, Shouval R, Arias IM", "evidence": [ { "database": "Reactome", "id": "R-HSA-156588", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156588" } ], "reference": [ { "type": "PubMed", "id": "6796486", "url": "https://glygen.org/publication/PubMed/6796486" } ] }, { "title": "Identification and partial purification of the major aspirin hydrolyzing enzyme in human blood.", "journal": "Arthritis and rheumatism", "date": "1983", "authors": "Costello PB, Green FA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "6838677", "url": "https://glygen.org/publication/PubMed/6838677" } ] }, { "title": "Acetaminophen and phenol: substrates for both a thermostable and a thermolabile form of human platelet phenol sulfotransferase.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "1982", "authors": "Reiter C, Weinshilboum RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "6950087", "url": "https://glygen.org/publication/PubMed/6950087" } ] }, { "title": "Treatment of paracetamol (acetaminophen) poisoning with N-acetylcysteine.", "journal": "Lancet (London, England)", "date": "1977", "authors": "Prescott LF, Park J, Ballantyne A, Adriaenssens P, Proudfoot AT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "70646", "url": "https://glygen.org/publication/PubMed/70646" } ] }, { "title": "Comparative study of human intestinal and hepatic esterases as related to enzymatic properties and hydrolizing activity for ester-type drugs.", "journal": "Japanese journal of pharmacology", "date": "1980", "authors": "Inoue M, Morikawa M, Tsuboi M, Ito Y, Sugiura M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "7206363", "url": "https://glygen.org/publication/PubMed/7206363" } ] }, { "title": "Treatment of severe acetaminophen poisoning with intravenous acetylcysteine.", "journal": "Archives of internal medicine", "date": "1981", "authors": "Prescott LF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "7469630", "url": "https://glygen.org/publication/PubMed/7469630" } ] }, { "title": "Transcriptional regulation by lovastatin and 25-hydroxycholesterol in HepG2 cells and molecular cloning and expression of the cDNA for the human hepatic squalene synthase.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Jiang G, McKenzie TL, Conrad DG, Shechter I", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "7685352", "url": "https://glygen.org/publication/PubMed/7685352" } ] }, { "title": "Purification to homogeneity of mitochondrial acyl coa:glycine n-acyltransferase from human liver.", "journal": "Biochemical and biophysical research communications", "date": "1994", "authors": "Mawal YR, Qureshi IA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "7802672", "url": "https://glygen.org/publication/PubMed/7802672" } ] }, { "title": "Human liver mitochondrial carnitine palmitoyltransferase I: characterization of its cDNA and chromosomal localization and partial analysis of the gene.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Britton CH, Schultz RA, Zhang B, Esser V, Foster DW, McGarry JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "7892212", "url": "https://glygen.org/publication/PubMed/7892212" } ] }, { "title": "Bilirubin UDP-glucuronosyltransferase 1 is the only relevant bilirubin glucuronidating isoform in man.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Bosma PJ, Seppen J, Goldhoorn B, Bakker C, Oude Elferink RP, Chowdhury JR, Chowdhury NR, Jansen PL", "evidence": [ { "database": "Reactome", "id": "R-HSA-156588", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156588" } ], "reference": [ { "type": "PubMed", "id": "8027054", "url": "https://glygen.org/publication/PubMed/8027054" } ] }, { "title": "A direct role for sterol regulatory element binding protein in activation of 3-hydroxy-3-methylglutaryl coenzyme A reductase gene.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Vallett SM, Sanchez HB, Rosenfeld JM, Osborne TF", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "8647822", "url": "https://glygen.org/publication/PubMed/8647822" } ] }, { "title": "Glucuronide conjugates of 4-aminobiphenyl and its N-hydroxy metabolites. pH stability and synthesis by human and dog liver.", "journal": "Biochemical pharmacology", "date": "1996", "authors": "Babu SR, Lakshmi VM, Huang GP, Zenser TV, Davis BB", "evidence": [ { "database": "Reactome", "id": "R-HSA-156588", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156588" } ], "reference": [ { "type": "PubMed", "id": "8687483", "url": "https://glygen.org/publication/PubMed/8687483" } ] }, { "title": "Immunohistochemical detection of gamma-glutamyl transpeptidase in normal human tissue.", "journal": "The journal of histochemistry and cytochemistry : official journal of the Histochemistry Society", "date": "1996", "authors": "Hanigan MH, Frierson HF Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "8813074", "url": "https://glygen.org/publication/PubMed/8813074" } ] }, { "title": "Molecular characterization of two mammalian bHLH-PAS domain proteins selectively expressed in the central nervous system.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Zhou YD, Barnard M, Tian H, Li X, Ring HZ, Francke U, Shelton J, Richardson J, Russell DW, McKnight SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "9012850", "url": "https://glygen.org/publication/PubMed/9012850" } ] }, { "title": "Influence of polymorphic N-acetyltransferase phenotype on the inhibition and induction of acetaminophen bioactivation with long-term isoniazid.", "journal": "Clinical pharmacology and therapeutics", "date": "1997", "authors": "Chien JY, Peter RM, Nolan CM, Wartell C, Slattery JT, Nelson SD, Carithers RL Jr, Thummel KE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "9024171", "url": "https://glygen.org/publication/PubMed/9024171" } ] }, { "title": "Hydrolysis and transfer reactions catalyzed by gamma-glutamyl transpeptidase; evidence for separate substrate sites and for high affinity of L-cystine.", "journal": "Biochemical and biophysical research communications", "date": "1976", "authors": "Thompson GA, Meister A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9753281", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281" } ], "reference": [ { "type": "PubMed", "id": "9080", "url": "https://glygen.org/publication/PubMed/9080" } ] }, { "title": "Molecular cloning and characterization of a novel putative carboxylesterase, present in human intestine and liver.", "journal": "Biochemical and biophysical research communications", "date": "1997", "authors": "Schwer H, Langmann T, Daig R, Becker A, Aslanidis C, Schmitz G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "9144407", "url": "https://glygen.org/publication/PubMed/9144407" } ] }, { "title": "Identification of separate acyl- CoA:glycine and acyl-CoA:L-glutamine N-acyltransferase activities in mitochondrial fractions from liver of rhesus monkey and man.", "journal": "The Journal of biological chemistry", "date": "1976", "authors": "Webster LT, Siddiqui UA, Lucas SV, Strong JM, Mieyal JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "931988", "url": "https://glygen.org/publication/PubMed/931988" } ] }, { "title": "Identification of multispecific organic anion transporter 2 expressed predominantly in the liver.", "journal": "FEBS letters", "date": "1998", "authors": "Sekine T, Cha SH, Tsuda M, Apiwattanakul N, Nakajima N, Kanai Y, Endou H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "9650585", "url": "https://glygen.org/publication/PubMed/9650585" } ] }, { "title": "The nuclear receptors peroxisome proliferator-activated receptor alpha and Rev-erbalpha mediate the species-specific regulation of apolipoprotein A-I expression by fibrates.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Vu-Dac N, Chopin-Delannoy S, Gervois P, Bonnelye E, Martin G, Fruchart JC, Laudet V, Staels B", "evidence": [ { "database": "Reactome", "id": "R-HSA-1989781", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781" } ], "reference": [ { "type": "PubMed", "id": "9748239", "url": "https://glygen.org/publication/PubMed/9748239" } ] }, { "title": "Protein binding of salicylate in uremic and normal plasma.", "journal": "Clinical pharmacology and therapeutics", "date": "1976", "authors": "Borga O, Cederlof IO, Ringberger VA, Norlin A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9749641", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641" } ], "reference": [ { "type": "PubMed", "id": "975718", "url": "https://glygen.org/publication/PubMed/975718" } ] } ], "pathway": [ { "id": "hsa:54600", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:54600", "resource": "KEGG Pathway" }, { "id": "R-HSA-156588", "name": "Glucuronidation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-156588", "resource": "Reactome", "description": "Glucuronidation" }, { "id": "R-HSA-1989781", "name": "PPARA activates gene expression", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989781", "resource": "Reactome", "description": "PPARA activates gene expression" }, { "id": "R-HSA-9749641", "name": "Aspirin ADME", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9749641", "resource": "Reactome", "description": "Aspirin ADME" }, { "id": "R-HSA-9753281", "name": "Paracetamol ADME", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9753281", "resource": "Reactome", "description": "Paracetamol ADME" } ], "orthologs": [ { "uniprot_canonical_ac": "D3Z748-1", "protein_name": "UDP-glucuronosyltransferase", "gene_name": "Ugt1a8", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAPAVFPASLPLRVCLLLAFGLAQAGRLLVVPMDGSHWFSMKMIVEKLSHRGHEVVVVIPEVSWHLGKSQNFTVKTYSVSYTLEDLSHHFNFFAHKQWENREVGMFSLLKHSGKGFFQVLFSHCRSLFNDKKLVEYLKQRSFDAVFLDPFDVCGLTIAKYFSLPSVVFSGGIFCHYLDEGAQCPSPPSYVPRILSKFADTMTFKERVWNYFSYMKERAFCPYFFKTAIEIASEVLQTPVTMTDLFSSVSIWMFRTDFVLEFPRPVMPNMVYIGGINCHPGKPLSKEFEAYVNASGEHGIVVFSLGSMVSEIPEKKAMEIAEALGRIPQTVLWRYTGTRPSNLAKNTILVKWLPQNDLLGHPKTRAFITHSGSHGIYEGICNGVPMVMMPLFGDQMDNAKRMETRGAGVTLNVLEMTADDLENALKTVINNKSYKENIMRLSSLHKDRPIEPLDLAVFWVEYVMRHKGAPHLRPAAHDLTWYQYHSLDVIGFLLAIVLTVVFIVFKCCAYGCRKCFGGKGRVKKSHKSKTH", "length": 530 }, "evidence": [ { "id": "O60656", "url": "https://omabrowser.org/oma/group/O60656/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P08430-1", "protein_name": "UDP-glucuronosyltransferase 1-6", "gene_name": "Ugt1a6", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MACLLPAARLPAGFLFLVLWGSVLGDKLLVVPQDGSHWLSMKEIVEHLSERGHDIVVLVPEVNLLLGESKYYRRKSFPVPYNLEELRTRYRSFGNNHFAASSPLMAPLREYRNNMIVIDMCFFSCQSLLKDSATLSFLRENQFDALFTDPAMPCGVILAEYLKLPSIYLFRGFPCSLEHIGQSPSPVSYVPRFYTKFSDHMTFPQRLANFIANILENYLYHCLYSKYEILASDLLKRDVSLPALHQNSLWLLRYDFVFEYPRPVMPNMIFIGGTNCKKKGNLSQEFEAYVNASGEHGIVVFSLGSMVSEIPEKKAMEIAEALGRIPQTLLWRYTGTRPSNLAKNTILVKWLPQNDLLGHPKARAFITHSGSHGIYEGICNGVPMVMMPLFGDQMDNAKRMETRGAGVTLNVLEMTADDLENALKTVINNKSYKENIMRLSSLHKDRPIEPLDLAVFWVEYVMRHKGAPHLRPAAHDLTWYQYHSLDVIGFLLAIVLTVVFIVYKSCAYGCRKCFGGKGRVKKSHKSKTH", "length": 529 }, "evidence": [ { "id": "45922850", "url": "http://www.informatics.jax.org/homology/45922850", "database": "MGI" }, { "id": "45922852", "url": "http://www.informatics.jax.org/homology/45922852", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q62452-1", "protein_name": "UDP-glucuronosyltransferase 1A9", "gene_name": "Ugt1a9", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAPVAFPTSFFLCLLLASGLAQAGRLLVVPMDGSHWFTMQMVVEKLIHRGHEVVVVIPEVSWQLGKSLNCTVKTYSISHTLEDLDREFKYLSYTQWKTPEHSIRSFLTGSARGFFELTFSHCRSLFNDKKLVEYLKQRFFDAVFLDPFDVCGLIVAKYFSLPSVIFARGVFCDYLEEGAQCPSLPSYVPRLFSKYTDTMTFKERVWNHLIYIEEHAFCSYFLRTAVEVASEILQTPVTMTDLFSPVSIWLLRTDFVLEFPRPVMPNMVFIGGINCLQKKSLSKEFEAYVNASGEHGIVVFSLGSMVSEIPEKKAMEIAEALGRIPQTVLWRYTGTRPSNLAKNTILVKWLPQNDLLGHPKTRAFITHSGSHGIYEGICNGVPMVMMPLFGDQMDNAKRMETRGAGVTLNVLEMTADDLENALKTVINNKSYKENIMRLSSLHKDRPIEPLDLAVFWVEYVMRHKGAPHLRPAAHDLTWYQYHSLDVIGFLLAIVLTVVFIVFKCCAYGCRKCFGGKGRVKKSHKSKTH", "length": 528 }, "evidence": [ { "id": "45922853", "url": "http://www.informatics.jax.org/homology/45922853", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q6ZQM8-1", "protein_name": "UDP-glucuronosyltransferase 1A7", "gene_name": "Ugt1a7", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAPADFPASLPLCVCLLLASGLAQAGRLLVVPMDGSHWFTMQTVVEKLLHKGHEVVVVVPEVSWQLTKPLNFVVKTYAVSHTQEDLNREFKIFIDAQWKSQQEGGILPLLDSPAKGFFELLFSHCRSLFNDKKLVEYLKQTSFDAVFLDPFDVCGLTVAKYFSLPSVVFSRGIFCHYLEDAAQCPSPPSYIPRMLLKFTDTMTFKERTRNLLAYMGERAFCHKFFKSAADIASEVLQTPVTMTDLFSPVSIWLLRTDFVLEFPRPVMPNVIYIGGINCHQGKPLSKEFEAYVNASGEHGIVVFSLGSMVSEIPEKKAMEIAEALGRIPQTVLWRYTGTRPSNLAKNTILVKWLPQNDLLGHPKTRAFITHSGSHGIYEGICNGVPMVMMPLFGDQMDNAKRMETRGAGVTLNVLEMTADDLENALKTVINNKSYKENIMRLSSLHKDRPIEPLDLAVFWVEYVMRHKGAPHLRPAAHDLTWYQYHSLDVIGFLLAIVLTVVFIVFKCCAYGCRKCFGGKGRVKKSHKSKTH", "length": 531 }, "evidence": [ { "id": "45922850", "url": "http://www.informatics.jax.org/homology/45922850", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9HAW7-1", "protein_name": "UDP-glucuronosyltransferase 1A7", "gene_name": "UGT1A7", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MARAGWTGLLPLYVCLLLTCGFAKAGKLLVVPMDGSHWFTMQSVVEKLILRGHEVVVVMPEVSWQLGRSLNCTVKTYSTSYTLEDQDREFMVFADARWTAPLRSAFSLLTSSSNGIFDLFFSNCRSLFNDRKLVEYLKESCFDAVFLDPFDACGLIVAKYFSLPSVVFARGIFCHYLEEGAQCPAPLSYVPRLLLGFSDAMTFKERVWNHIMHLEEHLFCPYFFKNVLEIASEILQTPVTAYDLYSHTSIWLLRTDFVLEYPKPVMPNMIFIGGINCHQGKPVPMEFEAYINASGEHGIVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQNDLLGHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDLENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH", "length": 530 }, "evidence": [ { "id": "45922850", "url": "http://www.informatics.jax.org/homology/45922850", "database": "MGI" }, { "id": "45922853", "url": "http://www.informatics.jax.org/homology/45922853", "database": "MGI" }, { "id": "45922852", "url": "http://www.informatics.jax.org/homology/45922852", "database": "MGI" }, { "id": "45936771", "url": "http://www.informatics.jax.org/homology/45936771", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q9HAW8-1", "protein_name": "UDP-glucuronosyltransferase 1A10", "gene_name": "UGT1A10", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MARAGWTSPVPLCVCLLLTCGFAEAGKLLVVPMDGSHWFTMQSVVEKLILRGHEVVVVMPEVSWQLERSLNCTVKTYSTSYTLEDQNREFMVFAHAQWKAQAQSIFSLLMSSSSGFLDLFFSHCRSLFNDRKLVEYLKESSFDAVFLDPFDTCGLIVAKYFSLPSVVFTRGIFCHHLEEGAQCPAPLSYVPNDLLGFSDAMTFKERVWNHIVHLEDHLFCQYLFRNALEIASEILQTPVTAYDLYSHTSIWLLRTDFVLDYPKPVMPNMIFIGGINCHQGKPLPMEFEAYINASGEHGIVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQNDLLGHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDLENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH", "length": 530 }, "evidence": [ { "id": "45922850", "url": "http://www.informatics.jax.org/homology/45922850", "database": "MGI" }, { "id": "45922853", "url": "http://www.informatics.jax.org/homology/45922853", "database": "MGI" }, { "id": "45922852", "url": "http://www.informatics.jax.org/homology/45922852", "database": "MGI" }, { "id": "45936771", "url": "http://www.informatics.jax.org/homology/45936771", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q9HAW9-1", "protein_name": "UDP-glucuronosyltransferase 1A8", "gene_name": "UGT1A8", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MARTGWTSPIPLCVSLLLTCGFAEAGKLLVVPMDGSHWFTMQSVVEKLILRGHEVVVVMPEVSWQLGKSLNCTVKTYSTSYTLEDLDREFMDFADAQWKAQVRSLFSLFLSSSNGFFNLFFSHCRSLFNDRKLVEYLKESSFDAVFLDPFDACGLIVAKYFSLPSVVFARGIACHYLEEGAQCPAPLSYVPRILLGFSDAMTFKERVRNHIMHLEEHLFCQYFSKNALEIASEILQTPVTAYDLYSHTSIWLLRTDFVLDYPKPVMPNMIFIGGINCHQGKPLPMEFEAYINASGEHGIVVFSLGSMVSEIPEKKAMAIADALGKIPQTVLWRYTGTRPSNLANNTILVKWLPQNDLLGHPMTRAFITHAGSHGVYESICNGVPMVMMPLFGDQMDNAKRMETKGAGVTLNVLEMTSEDLENALKAVINDKSYKENIMRLSSLHKDRPVEPLDLAVFWVEFVMRHKGAPHLRPAAHDLTWYQYHSLDVIGFLLAVVLTVAFITFKCCAYGYRKCLGKKGRVKKAHKSKTH", "length": 530 }, "evidence": [ { "id": "45922850", "url": "http://www.informatics.jax.org/homology/45922850", "database": "MGI" }, { "id": "45922853", "url": "http://www.informatics.jax.org/homology/45922853", "database": "MGI" }, { "id": "45922852", "url": "http://www.informatics.jax.org/homology/45922852", "database": "MGI" }, { "id": "45936771", "url": "http://www.informatics.jax.org/homology/45936771", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 10, "go_terms": [ { "name": "negative regulation of fatty acid metabolic process", "id": "GO:0045922", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045922", "evidence": [ { "database": "UniProtKB", "id": "O60656", "url": "https://www.uniprot.org/uniprot/O60656" } ], "pmid": "" }, { "name": "liver development", "id": "GO:0001889", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001889", "evidence": [ { "database": "UniProtKB", "id": "O60656", "url": "https://www.uniprot.org/uniprot/O60656" } ], "pmid": "" }, { "name": "cellular glucuronidation", "id": "GO:0052695", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0052695", "evidence": [ { "database": "UniProtKB", "id": "O60656", "url": "https://www.uniprot.org/uniprot/O60656" } ], "pmid": "" }, { "name": "retinoic acid metabolic process", "id": "GO:0042573", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042573", "evidence": [ { "database": "UniProtKB", "id": "O60656", "url": "https://www.uniprot.org/uniprot/O60656" } ], "pmid": "" }, { "name": "xenobiotic metabolic process", "id": "GO:0006805", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006805", "evidence": [ { "database": "UniProtKB", "id": "O60656", "url": "https://www.uniprot.org/uniprot/O60656" } ], "pmid": "" }, { "name": "flavone metabolic process", "id": "GO:0051552", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051552", "evidence": [ { "database": "UniProtKB", "id": "O60656", "url": "https://www.uniprot.org/uniprot/O60656" } ], "pmid": "" }, { "name": "flavonoid glucuronidation", "id": "GO:0052696", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0052696", "evidence": [ { "database": "UniProtKB", "id": "O60656", "url": "https://www.uniprot.org/uniprot/O60656" } ], "pmid": "" }, { "name": "xenobiotic glucuronidation", "id": "GO:0052697", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0052697", "evidence": [ { "database": "UniProtKB", "id": "O60656", "url": "https://www.uniprot.org/uniprot/O60656" } ], "pmid": "" }, { "name": "negative regulation of glucuronosyltransferase activity", "id": "GO:1904224", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904224", "evidence": [ { "database": "UniProtKB", "id": "O60656", "url": "https://www.uniprot.org/uniprot/O60656" } ], "pmid": "" }, { "name": "negative regulation of cellular glucuronidation", "id": "GO:2001030", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2001030", "evidence": [ { "database": "UniProtKB", "id": "O60656", "url": "https://www.uniprot.org/uniprot/O60656" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 6, "go_terms": [ { "name": "enzyme inhibitor activity", "id": "GO:0004857", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004857", "evidence": [ { "database": "UniProtKB", "id": "O60656", "url": "https://www.uniprot.org/uniprot/O60656" } ], "pmid": "" }, { "name": "enzyme binding", "id": "GO:0019899", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019899", "evidence": [ { "database": "UniProtKB", "id": "O60656", "url": "https://www.uniprot.org/uniprot/O60656" } ], "pmid": "" }, { "name": "protein homodimerization activity", "id": "GO:0042803", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042803", "evidence": [ { "database": "UniProtKB", "id": "O60656", "url": "https://www.uniprot.org/uniprot/O60656" } ], "pmid": "" }, { "name": "protein heterodimerization activity", "id": "GO:0046982", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046982", "evidence": [ { "database": "UniProtKB", "id": "O60656", "url": "https://www.uniprot.org/uniprot/O60656" } ], "pmid": "" }, { "name": "glucuronosyltransferase activity", "id": "GO:0015020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015020", "evidence": [ { "database": "UniProtKB", "id": "O60656", "url": "https://www.uniprot.org/uniprot/O60656" } ], "pmid": "" }, { "name": "retinoic acid binding", "id": "GO:0001972", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001972", "evidence": [ { "database": "UniProtKB", "id": "O60656", "url": "https://www.uniprot.org/uniprot/O60656" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 2, "go_terms": [ { "name": "endoplasmic reticulum", "id": "GO:0005783", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "evidence": [ { "database": "UniProtKB", "id": "O60656", "url": "https://www.uniprot.org/uniprot/O60656" } ], "pmid": "" }, { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "O60656", "url": "https://www.uniprot.org/uniprot/O60656" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 292, "end_pos": 294, "annotation": "n_glycosylation_sequon" }, { "start_pos": 344, "end_pos": 346, "annotation": "n_glycosylation_sequon" }, { "start_pos": 71, "end_pos": 73, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "21032", "name": "", "equation": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P08541-1", "P19488-1", "Q64638-1", "Q64550-1", "P08430-1", "P20720-1", "Q62789-1", "Q64633-1", "Q64634-1", "Q64637-1", "P08542-1", "P09875-1", "P36510-1", "P36511-1", "A0A0G2K727-1", "A0A0G2JW02-1", "F1LTB8-1", "F1M3E3-1", "P54855-1", "P16662-1", "Q3SY77-1", "O75310-1", "P19224-1", "Q6NUS8-1", "Q6UWM9-1", "P36537-1", "P06133-1", "Q9BY64-1", "Q9HAW7-1", "Q9HAW9-1", "Q9HAW8-1", "P35503-1", "P35504-1", "O60656-1", "O75795-1", "P22310-1", "P22309-1", "P0DTE5-1", "P0DTE4-5", "Q8JZZ0-1", "P70691-1", "Q3UP75-1", "Q8BWQ1-1", "P17717-1", "Q62452-1", "Q63886-1", "Q8R084-1", "Q8VCN3-1", "Q8BJL9-1", "Q8K154-1", "Q6PDD0-1", "Q80X89-1", "Q3UEP4-1", "Q64435-1", "Q6ZQM8-1", "D3Z748-1", "K9J7B2-1", "B2RT14-1", "Q9VDA5-1", "Q9VGT4-1", "Q9VGT5-1", "Q9VGS7-1", "Q9VJ46-1", "Q8SYL7-1", "Q9VJ45-1", "Q9W2J3-1", "Q9VJ81-1", "Q9VGT2-1", "Q9VGT8-1", "Q9W2J4-1", "Q9V9X9-1", "Q9VJ47-1", "Q9VGT0-1" ], "evidence": [ { "id": "21032", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/21032" } ] }, { "id": "53004", "name": "", "equation": "2-hydroxy-17beta-estradiol + UDP-alpha-D-glucuronate = 2-hydroxy-17beta-estradiol 3-O-(beta-D-glucuronate) + H(+) + UDP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q64550-1", "Q62789-1", "Q64634-1", "P16662-1", "Q9HAW9-1", "O60656-1", "P22309-1", "Q62452-1", "Q63886-1" ], "evidence": [ { "id": "53004", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/53004" } ] }, { "id": "53040", "name": "", "equation": "4-hydroxy-17beta-estradiol + UDP-alpha-D-glucuronate = 17beta-estradiol 4-O-(beta-D-glucuronate) + H(+) + UDP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q62789-1", "Q64634-1", "P16662-1", "Q9HAW9-1", "O60656-1", "Q62452-1" ], "evidence": [ { "id": "53040", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/53040" } ] }, { "id": "53048", "name": "", "equation": "2-hydroxyestrone + UDP-alpha-D-glucuronate = 2-hydroxyestrone 3-O-(beta-D-glucuronate) + H(+) + UDP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q64550-1", "Q64634-1", "Q9HAW9-1", "O60656-1", "P22309-1", "Q62452-1", "Q63886-1" ], "evidence": [ { "id": "53048", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/53048" } ] }, { "id": "53060", "name": "", "equation": "4-hydroxyestrone + UDP-alpha-D-glucuronate = estrone 4-O-(beta-D-glucuronate) + H(+) + UDP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q62789-1", "Q64634-1", "O60656-1", "P16662-1", "Q9HAW9-1", "Q62452-1" ], "evidence": [ { "id": "53060", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/53060" } ] }, { "id": "63612", "name": "", "equation": "prunetin + UDP-alpha-D-glucuronate = prunetin-5-O-beta-D-glucuronide + UDP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q64633-1", "Q64634-1", "Q9HAW7-1", "Q9HAW9-1", "O60656-1", "Q62452-1", "Q6ZQM8-1" ], "evidence": [ { "id": "63612", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/63612" } ] }, { "id": "63696", "name": "", "equation": "SN-38 + UDP-alpha-D-glucuronate = H(+) + SN-38 O-beta-D-glucuronide + UDP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q64550-1", "Q64633-1", "Q9HAW7-1", "O60656-1", "P22309-1", "Q62452-1", "Q63886-1", "Q6ZQM8-1" ], "evidence": [ { "id": "63696", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/63696" } ] }, { "id": "63704", "name": "", "equation": "mycophenolate + UDP-alpha-D-glucuronate = H(+) + mycophenolate 7-O-beta-D-glucuronide + UDP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q64633-1", "Q64634-1", "Q9HAW7-1", "Q9HAW9-1", "O60656-1", "Q62452-1", "Q6ZQM8-1" ], "evidence": [ { "id": "63704", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/63704" } ] }, { "id": "63724", "name": "", "equation": "candesartan + UDP-alpha-D-glucuronate = candesartan O-beta-D-glucuronoside + UDP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q62789-1", "Q64633-1", "Q64634-1", "P16662-1", "Q9HAW7-1", "Q9HAW9-1", "Q9HAW8-1", "O60656-1", "Q62452-1", "Q6ZQM8-1" ], "evidence": [ { "id": "63724", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/63724" } ] }, { "id": "R-HSA-158546", "name": "UGTs glucuronate APAP to APAP-GlcA", "equation": "", "summary": "The liver, and to a lesser extent the kidney and intestine, are the major organs implicated in the elimination of acetaminophen (APAP, aka paracetamol) (McGill & Jaeschke 2013). Glucuronidation is the main route of APAP elimination, accounting for 45-55% of APAP metabolism, and is mediated by UGT1A1, UGT1A6, UGT1A9, UGT2B15 in the liver and UGT1A10 in the gut (Mutlib et al. 2006, Court et al. 2001, Navarro et al. 2011). Glucuronidation renders APAP more water-soluble, facilitating its elimination from the body.", "cellular_location": "cytosol, endoplasmic reticulum membrane", "input_participant_list": [ "R-ALL-158601" ], "output_participant_list": [ "R-ALL-158604" ], "enzyme_list": [ "O60656-1", "P19224-1", "P22309-1", "P54855-1", "Q9HAW8-1" ], "evidence": [ { "id": "R-HSA-158546", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-158546" } ] }, { "id": "R-HSA-174916", "name": "Formation of N-glucuronides", "equation": "", "summary": "Typical N-centred substrates were chosen as examples for these isozymes.", "cellular_location": "endoplasmic reticulum lumen, endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P22310-1", "P35503-1", "O60656-1" ], "evidence": [ { "id": "R-HSA-174916", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174916" } ] }, { "id": "R-HSA-174931", "name": "UGTs transfer GlcA from UDP-GlcA to O-centre substrates", "equation": "", "summary": "Typical O-centred substrates were chosen as examples for these isozymes. Many UDP-glucuronosyltransferases (UGTs) can transfer the glucuronyl moiety (GlcA) from UDP-GlcA to the O-centre functional group of many substrates, including salicylate (ST), to form 4-O-glucuronides (Casarett & Doull 1995, Babu et al. 1996; Kuehl et al, 2006).", "cellular_location": "endoplasmic reticulum lumen, endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P16662-1", "Q3SY77-1", "Q6UWM9-1", "Q9BY64-1", "P0DTE5-1", "P06133-1", "P22310-1", "P35503-1", "Q9HAW7-1", "Q9HAW9-1", "O60656-1", "O75310-1", "O75795-1", "P19224-1", "P22309-1", "P35504-1", "P36537-1", "P54855-1", "Q6NUS8-1", "P0DTE4-5" ], "evidence": [ { "id": "R-HSA-174931", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-174931" } ] }, { "id": "R-HSA-1989758", "name": "Expression of UGT1A9", "equation": "", "summary": "The UGT1A9 gene is transcribed to yield mRNA and the mRNA is translated to yield protein.", "cellular_location": "endoplasmic reticulum membrane, nucleoplasm", "input_participant_list": [ "R-HSA-5649935" ], "output_participant_list": [ "R-HSA-400210" ], "enzyme_list": [ "Q15788-1", "Q92793-1", "Q96RS0-1", "Q86X55-3", "Q3L8U1-1", "Q9BYK8-1", "O60656-1" ], "evidence": [ { "id": "R-HSA-1989758", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1989758" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-158601", "participant_name": "UDP-GlcA [cytosol]", "crossref": [ { "id": "C00167", "database": "COMPOUND", "url": "" }, { "id": "58052", "database": "ChEBI", "url": "" }, { "id": "000008215691", "database": "ZINC", "url": "" }, { "id": "C00167", "database": "COMPOUND", "url": "" }, { "id": "58052", "database": "ChEBI", "url": "" }, { "id": "000008215691", "database": "ZINC", "url": "" }, { "id": "000008215691", "database": "ZINC", "url": "" }, { "id": "C00167", "database": "COMPOUND", "url": "" }, { "id": "58052", "database": "ChEBI", "url": "" }, { "id": "58052", "database": "ChEBI", "url": "" }, { "id": "000008215691", "database": "ZINC", "url": "" }, { "id": "C00167", "database": "COMPOUND", "url": "" }, { "id": "000008215691", "database": "ZINC", "url": "" }, { "id": "C00167", "database": "COMPOUND", "url": "" }, { "id": "58052", "database": "ChEBI", "url": "" }, { "id": "58052", "database": "ChEBI", "url": "" }, { "id": "000008215691", "database": "ZINC", "url": "" }, { "id": "C00167", "database": "COMPOUND", "url": "" } ] }, { "participant_id": "R-ALL-158604", "participant_name": "APAP-GlcA [endoplasmic reticulum lumen]", "crossref": [ { "id": "132962", "database": "ChEBI", "url": "" }, { "id": "000005197198", "database": "ZINC", "url": "" }, { "id": "132962", "database": "ChEBI", "url": "" }, { "id": "000005197198", "database": "ZINC", "url": "" }, { "id": "132962", "database": "ChEBI", "url": "" }, { "id": "000005197198", "database": "ZINC", "url": "" }, { "id": "000005197198", "database": "ZINC", "url": "" }, { "id": "132962", "database": "ChEBI", "url": "" }, { "id": "132962", "database": "ChEBI", "url": "" }, { "id": "000005197198", "database": "ZINC", "url": "" }, { "id": "132962", "database": "ChEBI", "url": "" }, { "id": "000005197198", "database": "ZINC", "url": "" } ] }, { "participant_id": "R-HSA-400210", "participant_name": "UGT1A9 [endoplasmic reticulum membrane]", "crossref": [ { "id": "O60656", "database": "Pharos - Targets", "url": "" }, { "id": "ENSP00000346768", "database": "Ensembl", "url": "" }, { "id": "ENSG00000241119-UGT1A9", "database": "HPA", "url": "" }, { "id": "O60656", "database": "ZINC target", "url": "" }, { "id": "ENSG00000241119", "database": "Ensembl", "url": "" }, { "id": "HMDBP00484", "database": "HMDB Protein", "url": "" }, { "id": "O60656", "database": "UniProt", "url": "" }, { "id": "ENST00000354728", "database": "Ensembl", "url": "" }, { "id": "NP_066307.1", "database": "RefSeq", "url": "" }, { "id": "ENSG00000241119", "database": "OpenTargets", "url": "" }, { "id": "O60656", "database": "GeneCards", "url": "" }, { "id": "O60656", "database": "PRO", "url": "" } ] }, { "participant_id": "R-HSA-5649935", "participant_name": "UGT1A9 gene [nucleoplasm]", "crossref": [ { "id": "ENSG00000241119", "database": "ENSEMBL", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "A0A0G2JW02", "gene_name": "Ugt2a3", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "A0A0G2JW02", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2JW02" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "A0A0G2JW02", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2JW02" } ] } ] }, { "uniprot_ac": "A0A0G2K727", "gene_name": "ENSRNOG00000065137", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "A0A0G2K727", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K727" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "A0A0G2K727", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A0G2K727" } ] } ] }, { "uniprot_ac": "B2RT14", "gene_name": "Ugt1a5", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "B2RT14", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2RT14" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "B2RT14", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/B2RT14" } ] } ] }, { "uniprot_ac": "D3Z748", "gene_name": "Ugt1a8", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "D3Z748", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3Z748" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "D3Z748", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3Z748" } ] } ] }, { "uniprot_ac": "F1LTB8", "gene_name": "RGD1559459", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "F1LTB8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1LTB8" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "F1LTB8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1LTB8" } ] } ] }, { "uniprot_ac": "F1M3E3", "gene_name": "AC114845.1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "F1M3E3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M3E3" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "F1M3E3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F1M3E3" } ] } ] }, { "uniprot_ac": "K9J7B2", "gene_name": "Ugt1a6b", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "K9J7B2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/K9J7B2" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "K9J7B2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/K9J7B2" } ] } ] }, { "uniprot_ac": "O60656", "gene_name": "UGT1A9", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "O60656", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60656" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "O60656", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60656" } ] } ] }, { "uniprot_ac": "O75310", "gene_name": "UGT2B11", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "O75310", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75310" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "O75310", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75310" } ] } ] }, { "uniprot_ac": "O75795", "gene_name": "UGT2B17", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "O75795", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75795" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "O75795", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75795" } ] } ] }, { "uniprot_ac": "P06133", "gene_name": "UGT2B4", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P06133", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06133" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P06133", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P06133" } ] } ] }, { "uniprot_ac": "P08430", "gene_name": "Ugt1a6", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P08430", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08430" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P08430", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08430" } ] } ] }, { "uniprot_ac": "P08541", "gene_name": "Ugt2b", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P08541", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08541" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P08541", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08541" } ] } ] }, { "uniprot_ac": "P08542", "gene_name": "Ugt2b17", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P08542", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08542" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P08542", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P08542" } ] } ] }, { "uniprot_ac": "P09875", "gene_name": "Ugt2b1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P09875", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09875" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P09875", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P09875" } ] } ] }, { "uniprot_ac": "P0DTE4", "gene_name": "UGT2A1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P0DTE4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0DTE4" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P0DTE4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0DTE4" } ] } ] }, { "uniprot_ac": "P0DTE5", "gene_name": "UGT2A2", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P0DTE5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0DTE5" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P0DTE5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0DTE5" } ] } ] }, { "uniprot_ac": "P16662", "gene_name": "UGT2B7", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P16662", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16662" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P16662", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P16662" } ] } ] }, { "uniprot_ac": "P17717", "gene_name": "Ugt2b17", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P17717", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17717" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P17717", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17717" } ] } ] }, { "uniprot_ac": "P19224", "gene_name": "UGT1A6", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P19224", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19224" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P19224", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19224" } ] } ] }, { "uniprot_ac": "P19488", "gene_name": "Ugt2b37", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P19488", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19488" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P19488", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P19488" } ] } ] }, { "uniprot_ac": "P20720", "gene_name": "Ugt1a2", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P20720", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20720" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P20720", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20720" } ] } ] }, { "uniprot_ac": "P22309", "gene_name": "UGT1A1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P22309", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22309" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P22309", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22309" } ] } ] }, { "uniprot_ac": "P22310", "gene_name": "UGT1A4", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P22310", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22310" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P22310", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P22310" } ] } ] }, { "uniprot_ac": "P35503", "gene_name": "UGT1A3", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P35503", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35503" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P35503", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35503" } ] } ] }, { "uniprot_ac": "P35504", "gene_name": "UGT1A5", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P35504", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35504" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P35504", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P35504" } ] } ] }, { "uniprot_ac": "P36510", "gene_name": "Ugt2a1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P36510", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36510" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P36510", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36510" } ] } ] }, { "uniprot_ac": "P36511", "gene_name": "Ugt2b15", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P36511", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36511" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P36511", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36511" } ] } ] }, { "uniprot_ac": "P36537", "gene_name": "UGT2B10", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P36537", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36537" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P36537", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36537" } ] } ] }, { "uniprot_ac": "P54855", "gene_name": "UGT2B15", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P54855", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54855" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P54855", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P54855" } ] } ] }, { "uniprot_ac": "P70691", "gene_name": "Ugt1a2", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "P70691", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70691" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "P70691", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P70691" } ] } ] }, { "uniprot_ac": "Q15788", "gene_name": "NCOA1", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "Q15788", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q15788" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "Q15788", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q15788" } ] } ] }, { "uniprot_ac": "Q3L8U1", "gene_name": "CHD9", "activity": [ { "ec_number": "3.6.4.12", "activity": "ATP + H2O = ADP + H(+) + phosphate.", "evidence": [ { "id": "Q3L8U1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3L8U1" } ] }, { "ec_number": "3.6.4.12", "activity": "", "evidence": [ { "id": "Q3L8U1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3L8U1" } ] } ] }, { "uniprot_ac": "Q3SY77", "gene_name": "UGT3A2", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q3SY77", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3SY77" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q3SY77", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3SY77" } ] } ] }, { "uniprot_ac": "Q3UEP4", "gene_name": "Ugt2b36", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q3UEP4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UEP4" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q3UEP4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UEP4" } ] } ] }, { "uniprot_ac": "Q3UP75", "gene_name": "Ugt3a1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q3UP75", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UP75" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q3UP75", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UP75" } ] } ] }, { "uniprot_ac": "Q62452", "gene_name": "Ugt1a9", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q62452", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62452" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q62452", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62452" } ] } ] }, { "uniprot_ac": "Q62789", "gene_name": "Ugt2b7", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q62789", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62789" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q62789", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q62789" } ] } ] }, { "uniprot_ac": "Q63886", "gene_name": "Ugt1a1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q63886", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63886" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q63886", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q63886" } ] } ] }, { "uniprot_ac": "Q64435", "gene_name": "Ugt1a6", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q64435", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64435" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q64435", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64435" } ] } ] }, { "uniprot_ac": "Q64550", "gene_name": "Ugt1a1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q64550", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64550" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q64550", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64550" } ] } ] }, { "uniprot_ac": "Q64633", "gene_name": "Ugt1a7", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q64633", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64633" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q64633", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64633" } ] } ] }, { "uniprot_ac": "Q64634", "gene_name": "Ugt1a8", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q64634", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64634" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q64634", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64634" } ] } ] }, { "uniprot_ac": "Q64637", "gene_name": "Ugt1a3", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q64637", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64637" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q64637", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64637" } ] } ] }, { "uniprot_ac": "Q64638", "gene_name": "Ugt1a5", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q64638", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64638" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q64638", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q64638" } ] } ] }, { "uniprot_ac": "Q6NUS8", "gene_name": "UGT3A1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q6NUS8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6NUS8" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q6NUS8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6NUS8" } ] } ] }, { "uniprot_ac": "Q6PDD0", "gene_name": "Ugt2a2", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q6PDD0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6PDD0" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q6PDD0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6PDD0" } ] } ] }, { "uniprot_ac": "Q6UWM9", "gene_name": "UGT2A3", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q6UWM9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6UWM9" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q6UWM9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6UWM9" } ] } ] }, { "uniprot_ac": "Q6ZQM8", "gene_name": "Ugt1a7", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q6ZQM8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6ZQM8" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q6ZQM8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6ZQM8" } ] } ] }, { "uniprot_ac": "Q80X89", "gene_name": "Ugt2a1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q80X89", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80X89" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q80X89", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80X89" } ] } ] }, { "uniprot_ac": "Q86X55", "gene_name": "CARM1", "activity": [ { "ec_number": "2.1.1.319", "activity": "L-arginyl-[protein] + 2 S-adenosyl-L-methionine = 2 H(+) + N(omega),N(omega)-dimethyl-L-arginyl-[protein] + 2 S-adenosyl-L-homocysteine.", "evidence": [ { "id": "Q86X55", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86X55" } ] }, { "ec_number": "2.1.1.319", "activity": "", "evidence": [ { "id": "Q86X55", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86X55" } ] } ] }, { "uniprot_ac": "Q8BJL9", "gene_name": "Ugt2b35", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q8BJL9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BJL9" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q8BJL9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BJL9" } ] } ] }, { "uniprot_ac": "Q8BWQ1", "gene_name": "Ugt2a3", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q8BWQ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BWQ1" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q8BWQ1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BWQ1" } ] } ] }, { "uniprot_ac": "Q8JZZ0", "gene_name": "Ugt3a2", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q8JZZ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8JZZ0" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q8JZZ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8JZZ0" } ] } ] }, { "uniprot_ac": "Q8K154", "gene_name": "Ugt2b34", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q8K154", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K154" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q8K154", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K154" } ] } ] }, { "uniprot_ac": "Q8R084", "gene_name": "Ugt2b1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q8R084", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R084" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q8R084", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8R084" } ] } ] }, { "uniprot_ac": "Q8SYL7", "gene_name": "Ugt50B3", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q8SYL7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8SYL7" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q8SYL7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8SYL7" } ] } ] }, { "uniprot_ac": "Q8VCN3", "gene_name": "Ugt2b37", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q8VCN3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VCN3" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q8VCN3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VCN3" } ] } ] }, { "uniprot_ac": "Q92793", "gene_name": "CREBBP", "activity": [ { "ec_number": "2.3.1.48", "activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].", "evidence": [ { "id": "Q92793", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92793" } ] }, { "ec_number": "2.3.1.48", "activity": "", "evidence": [ { "id": "Q92793", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92793" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q92793", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92793" } ] } ] }, { "uniprot_ac": "Q96RS0", "gene_name": "TGS1", "activity": [ { "ec_number": "2.1.1.-", "activity": "", "evidence": [ { "id": "Q96RS0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96RS0" } ] } ] }, { "uniprot_ac": "Q9BY64", "gene_name": "UGT2B28", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9BY64", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BY64" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9BY64", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BY64" } ] } ] }, { "uniprot_ac": "Q9BYK8", "gene_name": "HELZ2", "activity": [ { "ec_number": "3.1.13.1", "activity": "Exonucleolytic cleavage in the 3'- to 5'-direction to yield nucleoside 5'-phosphates.", "evidence": [ { "id": "Q9BYK8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BYK8" } ] }, { "ec_number": "3.6.4.13", "activity": "ATP + H2O = ADP + H(+) + phosphate.", "evidence": [ { "id": "Q9BYK8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BYK8" } ] }, { "ec_number": "3.1.13.1", "activity": "", "evidence": [ { "id": "Q9BYK8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BYK8" } ] } ] }, { "uniprot_ac": "Q9HAW7", "gene_name": "UGT1A7", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9HAW7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HAW7" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9HAW7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HAW7" } ] } ] }, { "uniprot_ac": "Q9HAW8", "gene_name": "UGT1A10", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9HAW8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HAW8" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9HAW8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HAW8" } ] } ] }, { "uniprot_ac": "Q9HAW9", "gene_name": "UGT1A8", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9HAW9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HAW9" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9HAW9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HAW9" } ] } ] }, { "uniprot_ac": "Q9V9X9", "gene_name": "Ugt35D1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9V9X9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9V9X9" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9V9X9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9V9X9" } ] } ] }, { "uniprot_ac": "Q9VDA5", "gene_name": "Ugt49B2", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9VDA5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VDA5" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9VDA5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VDA5" } ] } ] }, { "uniprot_ac": "Q9VGS7", "gene_name": "Ugt303A1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9VGS7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VGS7" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9VGS7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VGS7" } ] } ] }, { "uniprot_ac": "Q9VGT0", "gene_name": "Ugt35B1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9VGT0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VGT0" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9VGT0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VGT0" } ] } ] }, { "uniprot_ac": "Q9VGT2", "gene_name": "Ugt35E1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9VGT2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VGT2" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9VGT2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VGT2" } ] } ] }, { "uniprot_ac": "Q9VGT4", "gene_name": "Ugt302E1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9VGT4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VGT4" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9VGT4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VGT4" } ] } ] }, { "uniprot_ac": "Q9VGT5", "gene_name": "Ugt302K1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9VGT5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VGT5" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9VGT5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VGT5" } ] } ] }, { "uniprot_ac": "Q9VGT8", "gene_name": "Ugt35C1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9VGT8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VGT8" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9VGT8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VGT8" } ] } ] }, { "uniprot_ac": "Q9VJ45", "gene_name": "Ugt36E1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9VJ45", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VJ45" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9VJ45", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VJ45" } ] } ] }, { "uniprot_ac": "Q9VJ46", "gene_name": "Ugt36D1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9VJ46", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VJ46" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9VJ46", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VJ46" } ] } ] }, { "uniprot_ac": "Q9VJ47", "gene_name": "Ugt36F1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9VJ47", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VJ47" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9VJ47", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VJ47" } ] } ] }, { "uniprot_ac": "Q9VJ81", "gene_name": "Ugt301D1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9VJ81", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VJ81" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9VJ81", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VJ81" } ] } ] }, { "uniprot_ac": "Q9W2J3", "gene_name": "Ugt49C1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9W2J3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W2J3" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9W2J3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W2J3" } ] } ] }, { "uniprot_ac": "Q9W2J4", "gene_name": "Ugt49B1", "activity": [ { "ec_number": "2.4.1.17", "activity": "glucuronate acceptor + UDP-alpha-D-glucuronate = acceptor beta-D-glucuronoside + H(+) + UDP.", "evidence": [ { "id": "Q9W2J4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W2J4" } ] }, { "ec_number": "2.4.1.17", "activity": "", "evidence": [ { "id": "Q9W2J4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W2J4" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [ 71, 292, 344 ], "o_linked_sites": [], "snv_sites": [ 71, 73, 246, 294, 340, 343, 344, 346, 438, 477, 483 ], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 292, "end_pos": 294 }, { "start_pos": 344, "end_pos": 346 }, { "start_pos": 71, "end_pos": 73 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 2 }, { "field": "n_linked_glycan_sites", "count": 4 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 3 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 2 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 13 }, { "field": "total_sites", "count": 11 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 10 }, { "field": "total_sites", "count": 8 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 117 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }