{ "uniprot_canonical_ac": "O60645-1", "uniprot_ac": "O60645", "uniprot_id": "EXOC3_HUMAN", "mass": { "chemical_mass": 85567.0, "monoisotopic_mass": 85567.0 }, "refseq": { "ac": "NP_009208", "name": "exocyst complex component 3", "summary": "The protein encoded by this gene is a component of the exocyst complex, a multiple protein complex essential for targeting exocytic vesicles to specific docking sites on the plasma membrane. Though best characterized in yeast, the component proteins and functions of exocyst complex have been demonstrated to be highly conserved in higher eukaryotes. At least eight components of the exocyst complex, including this protein, are found to interact with the actin cytoskeletal remodeling and vesicle transport machinery. The complex is also essential for the biogenesis of epithelial cell surface polarity. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_009208" }, "gene_names": [ { "name": "EXOC3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O60645", "id": "O60645" }, { "name": "EXOC3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_009208", "id": "NP_009208" }, { "name": "SEC6; SEC6L1; Sec6p", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_009208", "id": "NP_009208" }, { "name": "SEC6L1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O60645", "id": "O60645" }, { "name": "SEC6", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O60645", "id": "O60645" } ], "protein_names": [ { "name": "Exocyst complex component 3", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O60645" }, { "name": "Exocyst complex component Sec6", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O60645" }, { "name": "Sec 6 homolog; exocyst complex component Sec6; SEC6-like 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_009208", "id": "NP_009208" }, { "name": "exocyst complex component 3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_009208", "id": "NP_009208" } ], "function": [ { "annotation": "Component of the exocyst complex involved in the docking of exocytic vesicles with fusion sites on the plasma membrane.", "evidence": [ { "database": "UniProtKB", "id": "O60645", "url": "https://www.uniprot.org/uniprot/O60645#function" } ] }, { "annotation": "Sec6 increased the phosphorylation of p38 MAPK through the activation of MAPK kinase 3/6 (MKK3/6). Moreover, Sec6 knockdown suppressed the phosphorylation of HSP27 at Ser(78) and Ser(82) sites via suppression of activated MK2.", "evidence": [ { "database": "RefSeq", "id": "NP_009208", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_009208" }, { "database": "PubMed", "id": "29729335", "url": "https://glygen.org/publication/PubMed/29729335" } ] }, { "annotation": "Sec6 regulate Bcl-2 and Mcl-1 expressions but not Bcl-xl in malignant peripheral nerve sheath tumor cells.", "evidence": [ { "database": "RefSeq", "id": "NP_009208", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_009208" }, { "database": "PubMed", "id": "26892009", "url": "https://glygen.org/publication/PubMed/26892009" } ] }, { "annotation": "Structural Study of the Exocyst Subunit Human Sec6.", "evidence": [ { "database": "RefSeq", "id": "NP_009208", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_009208" }, { "database": "PubMed", "id": "38007759", "url": "https://glygen.org/publication/PubMed/38007759" } ] }, { "annotation": "The protein encoded by this gene is a component of the exocyst complex, a multiple protein complex essential for targeting exocytic vesicles to specific docking sites on the plasma membrane. Though best characterized in yeast, the component proteins and functions of exocyst complex have been demonstrated to be highly conserved in higher eukaryotes. At least eight components of the exocyst complex, including this protein, are found to interact with the actin cytoskeletal remodeling and vesicle transport machinery. The complex is also essential for the biogenesis of epithelial cell surface polarity. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_009208", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_009208" } ] }, { "annotation": "The study explores the role of the exocyst complex component Sec6/8 in genomic stability.", "evidence": [ { "database": "RefSeq", "id": "NP_009208", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_009208" }, { "database": "PubMed", "id": "26283729", "url": "https://glygen.org/publication/PubMed/26283729" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "O60645", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O60645" } ], "glycoeffect": [], "start_pos": 277, "end_pos": 277, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "R", "sequence_mut": "C", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "5", "chr_pos": "453834", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "R277", "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] }, { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] }, { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "82", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000180104", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000180104" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "85.64", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000180104", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000180104" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "90.3", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000180104", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000180104" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "94.86", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000180104", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000180104" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "94.73", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000180104", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000180104" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "90.85", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000180104", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000180104" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "86.8", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000180104", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000180104" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "90.8", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000180104", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000180104" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "94.06", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000180104", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000180104" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "83.27", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000180104", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000180104" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "87.16", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000180104", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000180104" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "95.51", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000180104", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000180104" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "94.02", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000180104", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000180104" } ] } ], "expression_disease": [ { "significant": "No", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O60645", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60645" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O60645", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60645" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O60645", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60645" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O60645", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60645" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O60645", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60645" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O60645", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60645" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O60645", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60645" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O60645", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60645" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O60645", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60645" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O60645", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60645" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O60645", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60645" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O60645", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60645" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O60645", "url": "https://www.uniprot.org/uniprot/O60645" } ], "common_name": "Human" } ], "gene": [ { "name": "EXOC3", "url": "https://www.uniprot.org/uniprot/O60645", "locus": { "chromosome": "5", "start_pos": 471937, "end_pos": 443175, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000180104", "url": "https://www.ensembl.org/id/ENSG00000180104" } ] } } ], "crossref": [ { "id": "ENSG00000180104", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000180104", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "O60645", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O60645", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "EXOC3", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=EXOC3", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "11336", "url": "https://www.ncbi.nlm.nih.gov/gene/11336", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "30378", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=30378", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O60645", "url": "https://www.ebi.ac.uk/intact/interactors/id:O60645*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR010326", "url": "https://www.ebi.ac.uk/interpro/entry/IPR010326", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR042532", "url": "https://www.ebi.ac.uk/interpro/entry/IPR042532", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:11336", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:11336", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "608186", "url": "http://www.omim.org/entry/608186", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O60645", "url": "https://www.nextprot.org/entry/NX_O60645", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "MNIGPKT", "url": "https://omabrowser.org/oma/group/MNIGPKT/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5490183at2759", "url": "http://www.orthodb.org/?query=5490183at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR21292", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR21292", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR21292:SF13", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR21292:SF13", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF06046", "url": "http://pfam.xfam.org/family/PF06046", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O60645", "url": "https://pharos.nih.gov/targets/O60645", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O60645", "url": "http://purl.obolibrary.org/obo/PR_O60645", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-1445148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1445148", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-264876", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-264876", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5620916", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620916", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_009208", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_009208", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "D6RB59", "url": "https://www.uniprot.org/uniprot/D6RB59", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D6RB59-1", "url": "https://www.uniprot.org/uniprot/D6RB59-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D6RBR9", "url": "https://www.uniprot.org/uniprot/D6RBR9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D6RBR9-1", "url": "https://www.uniprot.org/uniprot/D6RBR9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0Y995", "url": "https://www.uniprot.org/uniprot/H0Y995", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0Y995-1", "url": "https://www.uniprot.org/uniprot/H0Y995-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O60645", "url": "https://www.uniprot.org/uniprot/O60645", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O60645-1", "url": "https://www.uniprot.org/uniprot/O60645-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKETDREAVATAVQRVAGMLQRPDQLDKVEQYRRREARKKASVEARLKAAIQSQLDGVRTGLSQLHNALNDVKDIQQSLADVSKDWRQSINTIESLKDVKDAVVQHSQLAAAVENLKNIFSVPEIVRETQDLIEQGALLQAHRKLMDLECSRDGLMYEQYRMDSGNTRDMTLIHGYFGSTQGLSDELAKQLWMVLQRSLVTVRRDPTLLVSVVRIIEREEKIDRRILDRKKQTGFVPPGRPKNWKEKMFTILERTVTTRIEGTQADTRESDKMWLVRHLEIIRKYVLDDLIVAKNLMVQCFPPHYEIFKNLLNMYHQALSTRMQDLASEDLEANEIVSLLTWVLNTYTSTEMMRNVELAPEVDVGTLEPLLSPHVVSELLDTYMSTLTSNIIAWLRKALETDKKDWVKETEPEADQDGYYQTTLPAIVFQMFEQNLQVAAQISEDLKTKVLVLCLQQMNSFLSRYKDEAQLYKEEHLRNRQHPHCYVQYMIAIINNCQTFKESIVSLKRKYLKNEVEEGVSPSQPSMDGILDAIAKEGCSGLLEEVFLDLEQHLNELMTKKWLLGSNAVDIICVTVEDYFNDFAKIKKPYKKRMTAEAHRRVVVEYLRAVMQKRISFRSPEERKEGAEKMVREAEQLRFLFRKLASGFGEDVDGYCDTIVAVAEVIKLTDPSLLYLEVSTLVSKYPDIRDDHIGALLAVRGDASRDMKQTIMETLEQGPAQASPSYVPLFKDIVVPSLNVAKLLK", "length": 745, "header": "sp|O60645-1|EXOC3_HUMAN Isoform 1 of Exocyst complex component 3 OS=Homo sapiens OX=9606 GN=EXOC3 PE=1 SV=3 CANONICAL=O60645-1" }, "isoforms": [ { "isoform_ac": "D6RB59-1", "url": "", "sequence": { "sequence": "MKETDREAVATAVQRVAGMLQRPDQLDKVEQYRRREARKKASVEARLKAAIQSQLDGVRTGLSQLHNALNDVKDIQQSLADVSKDWRQSINTIESLKDVKDAVVQHSQLAAAVENLKNIFSVPEIVRETQDLIEQGALLQAHRKLMDLECSRDGLMYEQYRMDSGNTRDMTLIHGYFGSTQGLSDELAKQLWMVLQRSLVTVRRDPTLLVSVVRIIEREEKIDRRILDRKKQTGFVPPGRPKNWKEKMFTILERTVTTRIEGTQADTRESDKMWLVRHLEIIRKYVLDDLIVAKNLMVQCFPPHYEIFKNLLNMYHQALSTRMQDLASEDLEANEIVSLLTWVLNTYTRYKDEAQLYKEEHLRNRQHPHCYVQYMIAIINNCQTFKESIVSLKRKYLKNEVEEGVSPSQPSMDGILDAIAKEGCSGLLEEVFLDLEVGLALSSCRFLGRSPVLPHCPLGHRL", "length": 462, "header": "tr|D6RB59-1|EXOC3_HUMAN Computationally mapped isoform of Exocyst complex component 3 OS=Homo sapiens OX=9606 GN=EXOC3 PE=1 SV=1 CANONICAL=O60645-1" }, "locus": { "chromosome": "5", "start_pos": 462385, "end_pos": 446206, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000515601.6", "url": "https://www.ensembl.org/id/ENST00000515601.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000424404.1", "url": "https://www.ensembl.org/id/ENSP00000424404.1" } ] } }, { "isoform_ac": "D6RBR9-1", "url": "", "sequence": { "sequence": "MKETDREAVATAVQRVAGMLQRPDQLDKVEQYRRREARKKASVEARLKAAIQSQLDGVRTGLSQLHNA", "length": 68, "header": "tr|D6RBR9-1|D6RBR9_HUMAN Computationally mapped isoform of Exocyst complex component 3 OS=Homo sapiens OX=9606 GN=EXOC3 PE=1 SV=8 CANONICAL=O60645-1" }, "locus": { "chromosome": "5", "start_pos": 447592, "end_pos": 446206, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000508022.1", "url": "https://www.ensembl.org/id/ENST00000508022.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000422596.1", "url": "https://www.ensembl.org/id/ENSP00000422596.1" } ] } }, { "isoform_ac": "H0Y995-1", "url": "", "sequence": { "sequence": "XLIEQGALLQAHRKLMDLECSRDGLMYEQYRMDSGNTRDMTLIHGYFGSTQGLSDELAKQLWMVLQRSLVTVRRDPTLLVSVVRIIEREEKIDRRILDRKKQTGFVPPGRPKNWKEKMFTILERTVTTRIEGTQADTRESDKMWLVRHLEIIRKYVLDDLIVAKNLMVQCFPPHYEIFKNLLNMYHQALSTRMQDLASEDLEANEIVSLLTWVLNTYTSTEMMRNVELAPEVDVGTLEPLLSPHVVSELLDTYMSTLTSNIIAWLRKALETDKKDWVKETEPEADQDGYYQTTLPAIVFQMFEQNLQVAAQISEDLKTKVLVLCLQQMNSFLSRYKDEAQLYKEEHLRNRQHPHCYVQYMIAIINNCQTFKESIVSLKRKYLKNEVEEGVSPSQPSMDGILDAIAKEGCSGLLEEVFLDLEQHLNELMTKKWLLGSNAVDIICVTVEDYFNDFAKIKKPYKKVRRWDLVPSSP", "length": 473, "header": "tr|H0Y995-1|H0Y995_HUMAN Computationally mapped isoform of Exocyst complex component 3 OS=Homo sapiens OX=9606 GN=EXOC3 PE=1 SV=1 CANONICAL=O60645-1" }, "locus": { "chromosome": "5", "start_pos": 464446, "end_pos": 453397, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000503889.2", "url": "https://www.ensembl.org/id/ENST00000503889.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000423435.1", "url": "https://www.ensembl.org/id/ENSP00000423435.1" } ] } }, { "isoform_ac": "O60645-1", "url": "", "sequence": { "sequence": "MKETDREAVATAVQRVAGMLQRPDQLDKVEQYRRREARKKASVEARLKAAIQSQLDGVRTGLSQLHNALNDVKDIQQSLADVSKDWRQSINTIESLKDVKDAVVQHSQLAAAVENLKNIFSVPEIVRETQDLIEQGALLQAHRKLMDLECSRDGLMYEQYRMDSGNTRDMTLIHGYFGSTQGLSDELAKQLWMVLQRSLVTVRRDPTLLVSVVRIIEREEKIDRRILDRKKQTGFVPPGRPKNWKEKMFTILERTVTTRIEGTQADTRESDKMWLVRHLEIIRKYVLDDLIVAKNLMVQCFPPHYEIFKNLLNMYHQALSTRMQDLASEDLEANEIVSLLTWVLNTYTSTEMMRNVELAPEVDVGTLEPLLSPHVVSELLDTYMSTLTSNIIAWLRKALETDKKDWVKETEPEADQDGYYQTTLPAIVFQMFEQNLQVAAQISEDLKTKVLVLCLQQMNSFLSRYKDEAQLYKEEHLRNRQHPHCYVQYMIAIINNCQTFKESIVSLKRKYLKNEVEEGVSPSQPSMDGILDAIAKEGCSGLLEEVFLDLEQHLNELMTKKWLLGSNAVDIICVTVEDYFNDFAKIKKPYKKRMTAEAHRRVVVEYLRAVMQKRISFRSPEERKEGAEKMVREAEQLRFLFRKLASGFGEDVDGYCDTIVAVAEVIKLTDPSLLYLEVSTLVSKYPDIRDDHIGALLAVRGDASRDMKQTIMETLEQGPAQASPSYVPLFKDIVVPSLNVAKLLK", "length": 745, "header": "sp|O60645-1|EXOC3_HUMAN Isoform 1 of Exocyst complex component 3 OS=Homo sapiens OX=9606 GN=EXOC3 PE=1 SV=3 CANONICAL=O60645-1" }, "locus": { "chromosome": "5", "start_pos": 466895, "end_pos": 446206, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000512944.6", "url": "https://www.ensembl.org/id/ENST00000512944.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000425587.1", "url": "https://www.ensembl.org/id/ENSP00000425587.1" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 201, "end_pos": 201, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O60645", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60645" }, { "database": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" } ], "site_lbl": "Thr201" }, { "start_pos": 338, "end_pos": 338, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O60645", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60645" }, { "database": "PubMed", "id": "35494241", "url": "" } ], "site_lbl": "Ser338" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Role of metal ions in the T- to R-allosteric transition in the insulin hexamer.", "journal": "Biochemistry", "date": "1999", "authors": "Kadima W", "evidence": [ { "database": "Reactome", "id": "R-HSA-264876", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-264876" } ], "reference": [ { "type": "PubMed", "id": "10521251", "url": "https://glygen.org/publication/PubMed/10521251" } ] }, { "title": "Missense polymorphism in the human carboxypeptidase E gene alters enzymatic activity.", "journal": "Human mutation", "date": "2001", "authors": "Chen H, Jawahar S, Qian Y, Duong Q, Chan G, Parker A, Meyer JM, Moore KJ, Chayen S, Gross DJ, Glaser B, Permutt MA, Fricker LD", "evidence": [ { "database": "Reactome", "id": "R-HSA-264876", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-264876" } ], "reference": [ { "type": "PubMed", "id": "11462236", "url": "https://glygen.org/publication/PubMed/11462236" } ] }, { "title": "The Sec6/8 complex in mammalian cells: characterization of mammalian Sec3, subunit interactions, and expression of subunits in polarized cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "Matern HT, Yeaman C, Nelson WJ, Scheller RH", "evidence": [ { "database": "Reactome", "id": "R-HSA-264876", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-264876" } ], "reference": [ { "type": "PubMed", "id": "11493706", "url": "https://glygen.org/publication/PubMed/11493706" } ] }, { "title": "Manipulation of oxidative protein folding and PDI redox state in mammalian cells.", "journal": "The EMBO journal", "date": "2001", "authors": "Mezghrani A, Fassio A, Benham A, Simmen T, Braakman I, Sitia R", "evidence": [ { "database": "Reactome", "id": "R-HSA-264876", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-264876" } ], "reference": [ { "type": "PubMed", "id": "11707400", "url": "https://glygen.org/publication/PubMed/11707400" } ] }, { "title": "Cloning and characterization of a novel mammalian zinc transporter, zinc transporter 5, abundantly expressed in pancreatic beta cells.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Kambe T, Narita H, Yamaguchi-Iwai Y, Hirose J, Amano T, Sugiura N, Sasaki R, Mori K, Iwanaga T, Nagao M", "evidence": [ { "database": "Reactome", "id": "R-HSA-264876", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-264876" } ], "reference": [ { "type": "PubMed", "id": "11904301", "url": "https://glygen.org/publication/PubMed/11904301" } ] }, { "title": "A Rab8-specific GDP/GTP exchange factor is involved in actin remodeling and polarized membrane transport.", "journal": "Molecular biology of the cell", "date": "2002", "authors": "Hattula K, Furuhjelm J, Arffman A, Peranen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620916", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620916" } ], "reference": [ { "type": "PubMed", "id": "12221131", "url": "https://glygen.org/publication/PubMed/12221131" } ] }, { "title": "Small-intestinal dysfunction accompanies the complex endocrinopathy of human proprotein convertase 1 deficiency.", "journal": "The Journal of clinical investigation", "date": "2003", "authors": "Jackson RS, Creemers JW, Farooqi IS, Raffin-Sanson ML, Varro A, Dockray GJ, Holst JJ, Brubaker PL, Corvol P, Polonsky KS, Ostrega D, Becker KL, Bertagna X, Hutton JC, White A, Dattani MT, Hussain K, Middleton SJ, Nicole TM, Milla PJ, Lindley KJ, O'Rahilly S", "evidence": [ { "database": "Reactome", "id": "R-HSA-264876", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-264876" } ], "reference": [ { "type": "PubMed", "id": "14617756", "url": "https://glygen.org/publication/PubMed/14617756" } ] }, { "title": "Overview of mammalian zinc transporters.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2004", "authors": "Kambe T, Yamaguchi-Iwai Y, Sasaki R, Nagao M", "evidence": [ { "database": "Reactome", "id": "R-HSA-264876", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-264876" } ], "reference": [ { "type": "PubMed", "id": "14704853", "url": "https://glygen.org/publication/PubMed/14704853" } ] }, { "title": "The exocyst localizes to the primary cilium in MDCK cells.", "journal": "Biochemical and biophysical research communications", "date": "2004", "authors": "Rogers KK, Wilson PD, Snyder RW, Zhang X, Guo W, Burrow CR, Lipschutz JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620916", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620916" } ], "reference": [ { "type": "PubMed", "id": "15158452", "url": "https://glygen.org/publication/PubMed/15158452" } ] }, { "title": "Proinsulin processing by the subtilisin-related proprotein convertases furin, PC2, and PC3.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1992", "authors": "Smeekens SP, Montag AG, Thomas G, Albiges-Rizo C, Carroll R, Benig M, Phillips LA, Martin S, Ohagi S, Gardner P, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-264876", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-264876" } ], "reference": [ { "type": "PubMed", "id": "1528899", "url": "https://glygen.org/publication/PubMed/1528899" } ] }, { "title": "Rhodopsin C terminus, the site of mutations causing retinal disease, regulates trafficking by binding to ADP-ribosylation factor 4 (ARF4).", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Deretic D, Williams AH, Ransom N, Morel V, Hargrave PA, Arendt A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620916", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620916" } ], "reference": [ { "type": "PubMed", "id": "15728366", "url": "https://glygen.org/publication/PubMed/15728366" } ] }, { "title": "Mammalian exocyst complex is required for the docking step of insulin vesicle exocytosis.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Tsuboi T, Ravier MA, Xie H, Ewart MA, Gould GW, Baldwin SA, Rutter GA", "evidence": [ { "database": "Reactome", "id": "R-HSA-264876", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-264876" } ], "reference": [ { "type": "PubMed", "id": "15878854", "url": "https://glygen.org/publication/PubMed/15878854" } ] }, { "title": "Insulin-stimulated phosphorylation of the Akt substrate AS160 is impaired in skeletal muscle of type 2 diabetic subjects.", "journal": "Diabetes", "date": "2005", "authors": "Karlsson HK, Zierath JR, Kane S, Krook A, Lienhard GE, Wallberg-Henriksson H", "evidence": [ { "database": "Reactome", "id": "R-HSA-1445148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1445148" } ], "reference": [ { "type": "PubMed", "id": "15919790", "url": "https://glygen.org/publication/PubMed/15919790" } ] }, { "title": "AS160, the Akt substrate regulating GLUT4 translocation, has a functional Rab GTPase-activating protein domain.", "journal": "The Biochemical journal", "date": "2005", "authors": "Miinea CP, Sano H, Kane S, Sano E, Fukuda M, Peranen J, Lane WS, Lienhard GE", "evidence": [ { "database": "Reactome", "id": "R-HSA-1445148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1445148" } ], "reference": [ { "type": "PubMed", "id": "15971998", "url": "https://glygen.org/publication/PubMed/15971998" } ] }, { "title": "Regulation of ASAP1 by phospholipids is dependent on the interface between the PH and Arf GAP domains.", "journal": "Cellular signalling", "date": "2005", "authors": "Che MM, Boja ES, Yoon HY, Gruschus J, Jaffe H, Stauffer S, Schuck P, Fales HM, Randazzo PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620916", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620916" } ], "reference": [ { "type": "PubMed", "id": "16038802", "url": "https://glygen.org/publication/PubMed/16038802" } ] }, { "title": "Vertebrate Smoothened functions at the primary cilium.", "journal": "Nature", "date": "2005", "authors": "Corbit KC, Aanstad P, Singla V, Norman AR, Stainier DY, Reiter JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620916", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620916" } ], "reference": [ { "type": "PubMed", "id": "16136078", "url": "https://glygen.org/publication/PubMed/16136078" } ] }, { "title": "Sec15 interacts with Rab11 via a novel domain and affects Rab11 localization in vivo.", "journal": "Nature structural & molecular biology", "date": "2005", "authors": "Wu S, Mehta SQ, Pichaud F, Bellen HJ, Quiocho FA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620916", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620916" } ], "reference": [ { "type": "PubMed", "id": "16155582", "url": "https://glygen.org/publication/PubMed/16155582" } ] }, { "title": "Zinc-ligand interactions modulate assembly and stability of the insulin hexamer -- a review.", "journal": "Biometals : an international journal on the role of metal ions in biology, biochemistry, and medicine", "date": "2005", "authors": "Dunn MF", "evidence": [ { "database": "Reactome", "id": "R-HSA-264876", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-264876" } ], "reference": [ { "type": "PubMed", "id": "16158220", "url": "https://glygen.org/publication/PubMed/16158220" } ] }, { "title": "ZnT-8, a pancreatic beta-cell-specific zinc transporter.", "journal": "Biometals : an international journal on the role of metal ions in biology, biochemistry, and medicine", "date": "2005", "authors": "Chimienti F, Favier A, Seve M", "evidence": [ { "database": "Reactome", "id": "R-HSA-264876", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-264876" } ], "reference": [ { "type": "PubMed", "id": "16158222", "url": "https://glygen.org/publication/PubMed/16158222" } ] }, { "title": "Generating disulfides enzymatically: reaction products and electron acceptors of the endoplasmic reticulum thiol oxidase Ero1p.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Gross E, Sevier CS, Heldman N, Vitu E, Bentzur M, Kaiser CA, Thorpe C, Fass D", "evidence": [ { "database": "Reactome", "id": "R-HSA-264876", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-264876" } ], "reference": [ { "type": "PubMed", "id": "16407158", "url": "https://glygen.org/publication/PubMed/16407158" } ] }, { "title": "A BAR domain in the N terminus of the Arf GAP ASAP1 affects membrane structure and trafficking of epidermal growth factor receptor.", "journal": "Current biology : CB", "date": "2006", "authors": "Nie Z, Hirsch DS, Luo R, Jian X, Stauffer S, Cremesti A, Andrade J, Lebowitz J, Marino M, Ahvazi B, Hinshaw JE, Randazzo PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620916", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620916" } ], "reference": [ { "type": "PubMed", "id": "16431365", "url": "https://glygen.org/publication/PubMed/16431365" } ] }, { "title": "Polycystin-2 traffics to cilia independently of polycystin-1 by using an N-terminal RVxP motif.", "journal": "Journal of cell science", "date": "2006", "authors": "Geng L, Okuhara D, Yu Z, Tian X, Cai Y, Shibazaki S, Somlo S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620916", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620916" } ], "reference": [ { "type": "PubMed", "id": "16537653", "url": "https://glygen.org/publication/PubMed/16537653" } ] }, { "title": "Insulin vesicle release: walk, kiss, pause ... then run.", "journal": "Physiology (Bethesda, Md.)", "date": "2006", "authors": "Rutter GA, Hill EV", "evidence": [ { "database": "Reactome", "id": "R-HSA-264876", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-264876" } ], "reference": [ { "type": "PubMed", "id": "16714477", "url": "https://glygen.org/publication/PubMed/16714477" } ] }, { "title": "Ciliary targeting of olfactory CNG channels requires the CNGB1b subunit and the kinesin-2 motor protein, KIF17.", "journal": "Current biology : CB", "date": "2006", "authors": "Jenkins PM, Hurd TW, Zhang L, McEwen DP, Brown RL, Margolis B, Verhey KJ, Martens JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620916", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620916" } ], "reference": [ { "type": "PubMed", "id": "16782012", "url": "https://glygen.org/publication/PubMed/16782012" } ] }, { "title": "A role for 14-3-3 in insulin-stimulated GLUT4 translocation through its interaction with the RabGAP AS160.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Ramm G, Larance M, Guilhaus M, James DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-1445148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1445148" } ], "reference": [ { "type": "PubMed", "id": "16880201", "url": "https://glygen.org/publication/PubMed/16880201" } ] }, { "title": "In vivo expression and functional characterization of the zinc transporter ZnT8 in glucose-induced insulin secretion.", "journal": "Journal of cell science", "date": "2006", "authors": "Chimienti F, Devergnas S, Pattou F, Schuit F, Garcia-Cuenca R, Vandewalle B, Kerr-Conte J, Van Lommel L, Grunwald D, Favier A, Seve M", "evidence": [ { "database": "Reactome", "id": "R-HSA-264876", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-264876" } ], "reference": [ { "type": "PubMed", "id": "16984975", "url": "https://glygen.org/publication/PubMed/16984975" } ] }, { "title": "Structural basis for Rab11-mediated recruitment of FIP3 to recycling endosomes.", "journal": "Journal of molecular biology", "date": "2006", "authors": "Eathiraj S, Mishra A, Prekeris R, Lambright DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620916", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620916" } ], "reference": [ { "type": "PubMed", "id": "17007872", "url": "https://glygen.org/publication/PubMed/17007872" } ] }, { "title": "Structural basis for Rab11-dependent membrane recruitment of a family of Rab11-interacting protein 3 (FIP3)/Arfophilin-1.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Shiba T, Koga H, Shin HW, Kawasaki M, Kato R, Nakayama K, Wakatsuki S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620916", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620916" } ], "reference": [ { "type": "PubMed", "id": "17030804", "url": "https://glygen.org/publication/PubMed/17030804" } ] }, { "title": "Resistance exercise and insulin regulate AS160 and interaction with 14-3-3 in human skeletal muscle.", "journal": "Diabetes", "date": "2007", "authors": "Howlett KF, Sakamoto K, Garnham A, Cameron-Smith D, Hargreaves M", "evidence": [ { "database": "Reactome", "id": "R-HSA-1445148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1445148" } ], "reference": [ { "type": "PubMed", "id": "17369524", "url": "https://glygen.org/publication/PubMed/17369524" } ] }, { "title": "A core complex of BBS proteins cooperates with the GTPase Rab8 to promote ciliary membrane biogenesis.", "journal": "Cell", "date": "2007", "authors": "Nachury MV, Loktev AV, Zhang Q, Westlake CJ, Peranen J, Merdes A, Slusarski DC, Scheller RH, Bazan JF, Sheffield VC, Jackson PK", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620916", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620916" } ], "reference": [ { "type": "PubMed", "id": "17574030", "url": "https://glygen.org/publication/PubMed/17574030" } ] }, { "title": "Molecular characterization of Rab11-FIP3 binding to ARF GTPases.", "journal": "European journal of cell biology", "date": "2007", "authors": "Schonteich E, Pilli M, Simon GC, Matern HT, Junutula JR, Sentz D, Holmes RK, Prekeris R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620916", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620916" } ], "reference": [ { "type": "PubMed", "id": "17628206", "url": "https://glygen.org/publication/PubMed/17628206" } ] }, { "title": "Functional dissection of Rab GTPases involved in primary cilium formation.", "journal": "The Journal of cell biology", "date": "2007", "authors": "Yoshimura S, Egerer J, Fuchs E, Haas AK, Barr FA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620916", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620916" } ], "reference": [ { "type": "PubMed", "id": "17646400", "url": "https://glygen.org/publication/PubMed/17646400" } ] }, { "title": "Dissecting the role of the ARF guanine nucleotide exchange factor GBF1 in Golgi biogenesis and protein trafficking.", "journal": "Journal of cell science", "date": "2007", "authors": "Szul T, Grabski R, Lyons S, Morohashi Y, Shestopal S, Lowe M, Sztul E", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620916", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620916" } ], "reference": [ { "type": "PubMed", "id": "17956946", "url": "https://glygen.org/publication/PubMed/17956946" } ] }, { "title": "Complementary regulation of TBC1D1 and AS160 by growth factors, insulin and AMPK activators.", "journal": "The Biochemical journal", "date": "2008", "authors": "Chen S, Murphy J, Toth R, Campbell DG, Morrice NA, Mackintosh C", "evidence": [ { "database": "Reactome", "id": "R-HSA-1445148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1445148" } ], "reference": [ { "type": "PubMed", "id": "17995453", "url": "https://glygen.org/publication/PubMed/17995453" } ] }, { "title": "Final stages of cytokinesis and midbody ring formation are controlled by BRUCE.", "journal": "Cell", "date": "2008", "authors": "Pohl C, Jentsch S", "evidence": [ { "database": "UniProtKB", "id": "O60645", "url": "https://www.uniprot.org/uniprot/O60645" } ], "reference": [ { "type": "PubMed", "id": "18329369", "url": "https://glygen.org/publication/PubMed/18329369" } ] }, { "title": "Arf GTPase-activating protein ASAP1 interacts with Rab11 effector FIP3 and regulates pericentrosomal localization of transferrin receptor-positive recycling endosome.", "journal": "Molecular biology of the cell", "date": "2008", "authors": "Inoue H, Ha VL, Prekeris R, Randazzo PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620916", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620916" } ], "reference": [ { "type": "PubMed", "id": "18685082", "url": "https://glygen.org/publication/PubMed/18685082" } ] }, { "title": "Distinct roles of RalA and RalB in the progression of cytokinesis are supported by distinct RalGEFs.", "journal": "EMBO J.", "date": "2008", "authors": "Cascone I, Selimoglu R, Ozdemir C, Del Nery E, Yeaman C, White M, Camonis J", "evidence": [ { "database": "UniProtKB", "id": "O60645", "url": "https://www.uniprot.org/uniprot/O60645" } ], "reference": [ { "type": "PubMed", "id": "18756269", "url": "https://glygen.org/publication/PubMed/18756269" } ] }, { "title": "Reduced phosphorylation of AS160 contributes to glucocorticoid-mediated inhibition of glucose uptake in human and murine adipocytes.", "journal": "Molecular and cellular endocrinology", "date": "2009", "authors": "Ngo S, Barry JB, Nisbet JC, Prins JB, Whitehead JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-1445148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1445148" } ], "reference": [ { "type": "PubMed", "id": "19013499", "url": "https://glygen.org/publication/PubMed/19013499" } ] }, { "title": "Autoinhibition of Arf GTPase-activating protein activity by the BAR domain in ASAP1.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Jian X, Brown P, Schuck P, Gruschus JM, Balbo A, Hinshaw JE, Randazzo PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620916", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620916" } ], "reference": [ { "type": "PubMed", "id": "19017632", "url": "https://glygen.org/publication/PubMed/19017632" } ] }, { "title": "Ciliary targeting motif VxPx directs assembly of a trafficking module through Arf4.", "journal": "The EMBO journal", "date": "2009", "authors": "Mazelova J, Astuto-Gribble L, Inoue H, Tam BM, Schonteich E, Prekeris R, Moritz OL, Randazzo PA, Deretic D", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620916", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620916" } ], "reference": [ { "type": "PubMed", "id": "19153612", "url": "https://glygen.org/publication/PubMed/19153612" } ] }, { "title": "Potential role of TBC1D4 in enhanced post-exercise insulin action in human skeletal muscle.", "journal": "Diabetologia", "date": "2009", "authors": "Treebak JT, Frosig C, Pehmoller C, Chen S, Maarbjerg SJ, Brandt N, MacKintosh C, Zierath JR, Hardie DG, Kiens B, Richter EA, Pilegaard H, Wojtaszewski JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-1445148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1445148" } ], "reference": [ { "type": "PubMed", "id": "19252894", "url": "https://glygen.org/publication/PubMed/19252894" } ] }, { "title": "The exocyst protein Sec10 is necessary for primary ciliogenesis and cystogenesis in vitro.", "journal": "Molecular biology of the cell", "date": "2009", "authors": "Zuo X, Guo W, Lipschutz JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620916", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620916" } ], "reference": [ { "type": "PubMed", "id": "19297529", "url": "https://glygen.org/publication/PubMed/19297529" } ] }, { "title": "Syntaxin 3 and SNAP-25 pairing, regulated by omega-3 docosahexaenoic acid, controls the delivery of rhodopsin for the biogenesis of cilia-derived sensory organelles, the rod outer segments.", "journal": "Journal of cell science", "date": "2009", "authors": "Mazelova J, Ransom N, Astuto-Gribble L, Wilson MC, Deretic D", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620916", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620916" } ], "reference": [ { "type": "PubMed", "id": "19454479", "url": "https://glygen.org/publication/PubMed/19454479" } ] }, { "title": "Lysine acetylation targets protein complexes and co-regulates major cellular functions.", "journal": "Science (New York, N.Y.)", "date": "2009", "authors": "Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M", "evidence": [ { "database": "UniProtKB", "id": "O60645", "url": "https://www.uniprot.org/uniprot/O60645" } ], "reference": [ { "type": "PubMed", "id": "19608861", "url": "https://glygen.org/publication/PubMed/19608861" } ] }, { "title": "Phosphorylation dynamics during early differentiation of human embryonic stem cells.", "journal": "Cell stem cell", "date": "2009", "authors": "Van Hoof D, Munoz J, Braam SR, Pinkse MW, Linding R, Heck AJ, Mummery CL, Krijgsveld J", "evidence": [ { "database": "iPTMnet", "id": "O60645", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60645" } ], "reference": [ { "type": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" } ] }, { "title": "Structural characteristics of BAR domain superfamily to sculpt the membrane.", "journal": "Seminars in cell & developmental biology", "date": "2010", "authors": "Masuda M, Mochizuki N", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620916", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620916" } ], "reference": [ { "type": "PubMed", "id": "20083215", "url": "https://glygen.org/publication/PubMed/20083215" } ] }, { "title": "ERO1-beta, a pancreas-specific disulfide oxidase, promotes insulin biogenesis and glucose homeostasis.", "journal": "The Journal of cell biology", "date": "2010", "authors": "Zito E, Chin KT, Blais J, Harding HP, Ron D", "evidence": [ { "database": "Reactome", "id": "R-HSA-264876", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-264876" } ], "reference": [ { "type": "PubMed", "id": "20308425", "url": "https://glygen.org/publication/PubMed/20308425" } ] }, { "title": "Coordination of Rab8 and Rab11 in primary ciliogenesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Knodler A, Feng S, Zhang J, Zhang X, Das A, Peranen J, Guo W", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620916", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620916" } ], "reference": [ { "type": "PubMed", "id": "20308558", "url": "https://glygen.org/publication/PubMed/20308558" } ] }, { "title": "Interaction of retinitis pigmentosa GTPase regulator (RPGR) with RAB8A GTPase: implications for cilia dysfunction and photoreceptor degeneration.", "journal": "Human molecular genetics", "date": "2010", "authors": "Murga-Zamalloa CA, Atkins SJ, Peranen J, Swaroop A, Khanna H", "evidence": [ { "database": "Reactome", "id": "R-HSA-1445148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1445148" } ], "reference": [ { "type": "PubMed", "id": "20631154", "url": "https://glygen.org/publication/PubMed/20631154" } ] }, { "title": "Contraction regulates site-specific phosphorylation of TBC1D1 in skeletal muscle.", "journal": "The Biochemical journal", "date": "2010", "authors": "Vichaiwong K, Purohit S, An D, Toyoda T, Jessen N, Hirshman MF, Goodyear LJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1445148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1445148" } ], "reference": [ { "type": "PubMed", "id": "20701589", "url": "https://glygen.org/publication/PubMed/20701589" } ] }, { "title": "Systematic mapping and functional analysis of a family of human epididymal secretory sperm-located proteins.", "journal": "Mol. Cell. Proteomics", "date": "2010", "authors": "Li J, Liu F, Wang H, Liu X, Liu J, Li N, Wan F, Wang W, Zhang C, Jin S, Liu J, Zhu P, Liu Y", "evidence": [ { "database": "UniProtKB", "id": "O60645", "url": "https://www.uniprot.org/uniprot/O60645" } ], "reference": [ { "type": "PubMed", "id": "20736409", "url": "https://glygen.org/publication/PubMed/20736409" } ] }, { "title": "Exercise-induced TBC1D1 Ser237 phosphorylation and 14-3-3 protein binding capacity in human skeletal muscle.", "journal": "The Journal of physiology", "date": "2010", "authors": "Frosig C, Pehmoller C, Birk JB, Richter EA, Wojtaszewski JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-1445148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1445148" } ], "reference": [ { "type": "PubMed", "id": "20837646", "url": "https://glygen.org/publication/PubMed/20837646" } ] }, { "title": "Family-wide characterization of the DENN domain Rab GDP-GTP exchange factors.", "journal": "The Journal of cell biology", "date": "2010", "authors": "Yoshimura S, Gerondopoulos A, Linford A, Rigden DJ, Barr FA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1445148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1445148" } ], "reference": [ { "type": "PubMed", "id": "20937701", "url": "https://glygen.org/publication/PubMed/20937701" } ] }, { "title": "The endoplasmic reticulum sulfhydryl oxidase Ero1beta drives efficient oxidative protein folding with loose regulation.", "journal": "The Biochemical journal", "date": "2011", "authors": "Wang L, Zhu L, Wang CC", "evidence": [ { "database": "Reactome", "id": "R-HSA-264876", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-264876" } ], "reference": [ { "type": "PubMed", "id": "21091435", "url": "https://glygen.org/publication/PubMed/21091435" } ] }, { "title": "Oxidative protein folding by an endoplasmic reticulum-localized peroxiredoxin.", "journal": "Molecular cell", "date": "2010", "authors": "Zito E, Melo EP, Yang Y, Wahlander A, Neubert TA, Ron D", "evidence": [ { "database": "Reactome", "id": "R-HSA-264876", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-264876" } ], "reference": [ { "type": "PubMed", "id": "21145486", "url": "https://glygen.org/publication/PubMed/21145486" } ] }, { "title": "Primary cilia membrane assembly is initiated by Rab11 and transport protein particle II (TRAPPII) complex-dependent trafficking of Rabin8 to the centrosome.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2011", "authors": "Westlake CJ, Baye LM, Nachury MV, Wright KJ, Ervin KE, Phu L, Chalouni C, Beck JS, Kirkpatrick DS, Slusarski DC, Sheffield VC, Scheller RH, Jackson PK", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620916", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620916" } ], "reference": [ { "type": "PubMed", "id": "21273506", "url": "https://glygen.org/publication/PubMed/21273506" } ] }, { "title": "Protein disulfide isomerase isomerizes non-native disulfide bonds in human proinsulin independent of its peptide-binding activity.", "journal": "Protein science : a publication of the Protein Society", "date": "2011", "authors": "Winter J, Gleiter S, Klappa P, Lilie H", "evidence": [ { "database": "Reactome", "id": "R-HSA-264876", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-264876" } ], "reference": [ { "type": "PubMed", "id": "21308844", "url": "https://glygen.org/publication/PubMed/21308844" } ] }, { "title": "Crystal structures of human TBC1D1 and TBC1D4 (AS160) RabGTPase-activating protein (RabGAP) domains reveal critical elements for GLUT4 translocation.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Park SY, Jin W, Woo JR, Shoelson SE", "evidence": [ { "database": "Reactome", "id": "R-HSA-1445148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1445148" } ], "reference": [ { "type": "PubMed", "id": "21454505", "url": "https://glygen.org/publication/PubMed/21454505" } ] }, { "title": "AS160 phosphotyrosine-binding domain constructs inhibit insulin-stimulated GLUT4 vesicle fusion with the plasma membrane.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Koumanov F, Richardson JD, Murrow BA, Holman GD", "evidence": [ { "database": "Reactome", "id": "R-HSA-1445148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1445148" } ], "reference": [ { "type": "PubMed", "id": "21454690", "url": "https://glygen.org/publication/PubMed/21454690" } ] }, { "title": "Rabs and the exocyst in ciliogenesis, tubulogenesis and beyond.", "journal": "Trends in cell biology", "date": "2011", "authors": "Das A, Guo W", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620916", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620916" } ], "reference": [ { "type": "PubMed", "id": "21550243", "url": "https://glygen.org/publication/PubMed/21550243" } ] }, { "title": "Mapping the NPHP-JBTS-MKS protein network reveals ciliopathy disease genes and pathways.", "journal": "Cell", "date": "2011", "authors": "Sang L, Miller JJ, Corbit KC, Giles RH, Brauer MJ, Otto EA, Baye LM, Wen X, Scales SJ, Kwong M, Huntzicker EG, Sfakianos MK, Sandoval W, Bazan JF, Kulkarni P, Garcia-Gonzalo FR, Seol AD, O'Toole JF, Held S, Reutter HM, Lane WS, Rafiq MA, Noor A, Ansar M, Devi AR, Sheffield VC, Slusarski DC, Vincent JB, Doherty DA, Hildebrandt F, Reiter JF, Jackson PK", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620916", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620916" } ], "reference": [ { "type": "PubMed", "id": "21565611", "url": "https://glygen.org/publication/PubMed/21565611" } ] }, { "title": "Zinc and zinc transporter regulation in pancreatic islets and the potential role of zinc in islet transplantation.", "journal": "The review of diabetic studies : RDS", "date": "2010", "authors": "Bosco MD, Mohanasundaram DM, Drogemuller CJ, Lang CJ, Zalewski PD, Coates PT", "evidence": [ { "database": "Reactome", "id": "R-HSA-264876", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-264876" } ], "reference": [ { "type": "PubMed", "id": "21713314", "url": "https://glygen.org/publication/PubMed/21713314" } ] }, { "title": "A conserved signal and GTPase complex are required for the ciliary transport of polycystin-1.", "journal": "Molecular biology of the cell", "date": "2011", "authors": "Ward HH, Brown-Glaberman U, Wang J, Morita Y, Alper SL, Bedrick EJ, Gattone VH 2nd, Deretic D, Wandinger-Ness A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620916", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620916" } ], "reference": [ { "type": "PubMed", "id": "21775626", "url": "https://glygen.org/publication/PubMed/21775626" } ] }, { "title": "C2 domain-containing phosphoprotein CDP138 regulates GLUT4 insertion into the plasma membrane.", "journal": "Cell metabolism", "date": "2011", "authors": "Xie X, Gong Z, Mansuy-Aubert V, Zhou QL, Tatulian SA, Sehrt D, Gnad F, Brill LM, Motamedchaboki K, Chen Y, Czech MP, Mann M, Kruger M, Jiang ZY", "evidence": [ { "database": "Reactome", "id": "R-HSA-1445148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1445148" } ], "reference": [ { "type": "PubMed", "id": "21907143", "url": "https://glygen.org/publication/PubMed/21907143" } ] }, { "title": "The emerging role of Arf/Arl small GTPases in cilia and ciliopathies.", "journal": "Journal of cellular biochemistry", "date": "2012", "authors": "Li Y, Ling K, Hu J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620916", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620916" } ], "reference": [ { "type": "PubMed", "id": "22389062", "url": "https://glygen.org/publication/PubMed/22389062" } ] }, { "title": "Exorcising the exocyst complex.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2012", "authors": "Heider MR, Munson M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620916", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620916" } ], "reference": [ { "type": "PubMed", "id": "22420621", "url": "https://glygen.org/publication/PubMed/22420621" } ] }, { "title": "A Rab8 guanine nucleotide exchange factor-effector interaction network regulates primary ciliogenesis.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Feng S, Knodler A, Ren J, Zhang J, Zhang X, Hong Y, Huang S, Peranen J, Guo W", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620916", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620916" } ], "reference": [ { "type": "PubMed", "id": "22433857", "url": "https://glygen.org/publication/PubMed/22433857" } ] }, { "title": "The Arf GAP ASAP1 provides a platform to regulate Arf4- and Rab11-Rab8-mediated ciliary receptor targeting.", "journal": "The EMBO journal", "date": "2012", "authors": "Wang J, Morita Y, Mazelova J, Deretic D", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620916", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620916" } ], "reference": [ { "type": "PubMed", "id": "22983554", "url": "https://glygen.org/publication/PubMed/22983554" } ] }, { "title": "Trafficking in and to the primary cilium.", "journal": "Cilia", "date": "2012", "authors": "Hsiao YC, Tuz K, Ferland RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620916", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620916" } ], "reference": [ { "type": "PubMed", "id": "23351793", "url": "https://glygen.org/publication/PubMed/23351793" } ] }, { "title": "Crosstalk of Arf and Rab GTPases en route to cilia.", "journal": "Small GTPases", "date": "2013", "authors": "Deretic D", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620916", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620916" } ], "reference": [ { "type": "PubMed", "id": "23567335", "url": "https://glygen.org/publication/PubMed/23567335" } ] }, { "title": "Intraflagellar transport complex structure and cargo interactions.", "journal": "Cilia", "date": "2013", "authors": "Bhogaraju S, Engel BD, Lorentzen E", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620916", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620916" } ], "reference": [ { "type": "PubMed", "id": "23945166", "url": "https://glygen.org/publication/PubMed/23945166" } ] }, { "title": "The roles of evolutionarily conserved functional modules in cilia-related trafficking.", "journal": "Nature cell biology", "date": "2013", "authors": "Sung CH, Leroux MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620916", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620916" } ], "reference": [ { "type": "PubMed", "id": "24296415", "url": "https://glygen.org/publication/PubMed/24296415" } ] }, { "title": "Oxidative protein folding: from thiol-disulfide exchange reactions to the redox poise of the endoplasmic reticulum.", "journal": "Free radical biology & medicine", "date": "2015", "authors": "Hudson DA, Gannon SA, Thorpe C", "evidence": [ { "database": "Reactome", "id": "R-HSA-264876", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-264876" } ], "reference": [ { "type": "PubMed", "id": "25091901", "url": "https://glygen.org/publication/PubMed/25091901" } ] }, { "title": "Identification of the ral and rac1 gene products, low molecular mass GTP-binding proteins from human platelets.", "journal": "The Journal of biological chemistry", "date": "1989", "authors": "Polakis PG, Weber RF, Nevins B, Didsbury JR, Evans T, Snyderman R", "evidence": [ { "database": "Reactome", "id": "R-HSA-1445148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1445148" } ], "reference": [ { "type": "PubMed", "id": "2550440", "url": "https://glygen.org/publication/PubMed/2550440" } ] }, { "title": "Role of the Exocyst Complex Component Sec6/8 in Genomic Stability.", "journal": "Molecular and cellular biology", "date": "2015", "authors": "Torres MJ, Pandita RK, Kulak O, Kumar R, Formstecher E, Horikoshi N, Mujoo K, Hunt CR, Zhao Y, Lum L, Zaman A, Yeaman C, White MA, Pandita TK", "evidence": [ { "database": "RefSeq", "id": "NP_009208", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_009208" } ], "reference": [ { "type": "PubMed", "id": "26283729", "url": "https://glygen.org/publication/PubMed/26283729" } ] }, { "title": "Comparison of solution structural flexibility and zinc binding domains for insulin, proinsulin, and miniproinsulin.", "journal": "Biochemistry", "date": "1989", "authors": "Kaarsholm NC, Ko HC, Dunn MF", "evidence": [ { "database": "Reactome", "id": "R-HSA-264876", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-264876" } ], "reference": [ { "type": "PubMed", "id": "2669954", "url": "https://glygen.org/publication/PubMed/2669954" } ] }, { "title": "Sec6/8 regulates Bcl-2 and Mcl-1, but not Bcl-xl, in malignant peripheral nerve sheath tumor cells.", "journal": "Apoptosis : an international journal on programmed cell death", "date": "2016", "authors": "Tanaka T, Kikuchi N, Goto K, Iino M", "evidence": [ { "database": "RefSeq", "id": "NP_009208", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_009208" } ], "reference": [ { "type": "PubMed", "id": "26892009", "url": "https://glygen.org/publication/PubMed/26892009" } ] }, { "title": "The insulin-secretory-granule carboxypeptidase H. Purification and demonstration of involvement in proinsulin processing.", "journal": "The Biochemical journal", "date": "1987", "authors": "Davidson HW, Hutton JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-264876", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-264876" } ], "reference": [ { "type": "PubMed", "id": "2822027", "url": "https://glygen.org/publication/PubMed/2822027" } ] }, { "title": "Sec6 enhances cell migration and suppresses apoptosis by elevating the phosphorylation of p38 MAPK, MK2, and HSP27.", "journal": "Cellular signalling", "date": "2018", "authors": "Tanaka T, Iino M, Goto K", "evidence": [ { "database": "RefSeq", "id": "NP_009208", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_009208" } ], "reference": [ { "type": "PubMed", "id": "29729335", "url": "https://glygen.org/publication/PubMed/29729335" } ] }, { "title": "PDIA1/P4HB is required for efficient proinsulin maturation and ss cell health in response to diet induced obesity.", "journal": "eLife", "date": "2019", "authors": "Jang I, Pottekat A, Poothong J, Yong J, Lagunas-Acosta J, Charbono A, Chen Z, Scheuner DL, Liu M, Itkin-Ansari P, Arvan P, Kaufman RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-264876", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-264876" } ], "reference": [ { "type": "PubMed", "id": "31184304", "url": "https://glygen.org/publication/PubMed/31184304" } ] }, { "title": "Zinc transporters and their functional integration in mammalian cells.", "journal": "The Journal of biological chemistry", "date": "2021", "authors": "Kambe T, Taylor KM, Fu D", "evidence": [ { "database": "Reactome", "id": "R-HSA-264876", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-264876" } ], "reference": [ { "type": "PubMed", "id": "33485965", "url": "https://glygen.org/publication/PubMed/33485965" } ] }, { "title": "Structural Study of the Exocyst Subunit Human Sec6.", "journal": "Studies in health technology and informatics", "date": "2023-11-23", "authors": "Guo Jiatian, Mei Kunrong", "evidence": [ { "database": "RefSeq", "id": "NP_009208", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_009208" } ], "reference": [ { "type": "PubMed", "id": "38007759", "url": "https://glygen.org/publication/PubMed/38007759" } ] }, { "title": "Direct identification of prohormone conversion site in insulin-secreting cells.", "journal": "Cell", "date": "1985", "authors": "Orci L, Ravazzola M, Amherdt M, Madsen O, Vassalli JD, Perrelet A", "evidence": [ { "database": "Reactome", "id": "R-HSA-264876", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-264876" } ], "reference": [ { "type": "PubMed", "id": "3896518", "url": "https://glygen.org/publication/PubMed/3896518" } ] }, { "title": "Differences between the catalytic properties of recombinant human PC2 and endogenous rat PC2.", "journal": "The Biochemical journal", "date": "1995", "authors": "Bailyes EM, Shennan KI, Usac EF, Arden SD, Guest PC, Docherty K, Hutton JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-264876", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-264876" } ], "reference": [ { "type": "PubMed", "id": "7626024", "url": "https://glygen.org/publication/PubMed/7626024" } ] }, { "title": "Characterization of a guanine nucleotide dissociation stimulator for a ras-related GTPase.", "journal": "The EMBO journal", "date": "1993", "authors": "Albright CF, Giddings BW, Liu J, Vito M, Weinberg RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1445148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1445148" } ], "reference": [ { "type": "PubMed", "id": "8094051", "url": "https://glygen.org/publication/PubMed/8094051" } ] }, { "title": "Characterization of human platelet GTPase activating protein for the Ral GTP-binding protein.", "journal": "Biochimica et biophysica acta", "date": "1996", "authors": "Bhullar RP, Seneviratne HD", "evidence": [ { "database": "Reactome", "id": "R-HSA-1445148", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1445148" } ], "reference": [ { "type": "PubMed", "id": "8664345", "url": "https://glygen.org/publication/PubMed/8664345" } ] }, { "title": "Prohormone convertases (PC1/3 and PC2) in rat and human pancreas and islet cell tumors: subcellular immunohistochemical analysis.", "journal": "Pathology international", "date": "1996", "authors": "Itoh Y, Tanaka S, Takekoshi S, Itoh J, Osamura RY", "evidence": [ { "database": "Reactome", "id": "R-HSA-264876", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-264876" } ], "reference": [ { "type": "PubMed", "id": "8916141", "url": "https://glygen.org/publication/PubMed/8916141" } ] }, { "title": "Proinsulin conversion in GH3 cells after coexpression of human proinsulin with the endoproteases PC2 and/or PC3.", "journal": "Diabetes", "date": "1997", "authors": "Kaufmann JE, Irminger JC, Mungall J, Halban PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-264876", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-264876" } ], "reference": [ { "type": "PubMed", "id": "9166668", "url": "https://glygen.org/publication/PubMed/9166668" } ] }, { "title": "Obesity and impaired prohormone processing associated with mutations in the human prohormone convertase 1 gene.", "journal": "Nature genetics", "date": "1997", "authors": "Jackson RS, Creemers JW, Ohagi S, Raffin-Sanson ML, Sanders L, Montague CT, Hutton JC, O'Rahilly S", "evidence": [ { "database": "Reactome", "id": "R-HSA-264876", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-264876" } ], "reference": [ { "type": "PubMed", "id": "9207799", "url": "https://glygen.org/publication/PubMed/9207799" } ] }, { "title": "The role of assembly in insulin's biosynthesis.", "journal": "Current opinion in structural biology", "date": "1998", "authors": "Dodson G, Steiner D", "evidence": [ { "database": "Reactome", "id": "R-HSA-264876", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-264876" } ], "reference": [ { "type": "PubMed", "id": "9631292", "url": "https://glygen.org/publication/PubMed/9631292" } ] }, { "title": "ASAP1, a phospholipid-dependent arf GTPase-activating protein that associates with and is phosphorylated by Src.", "journal": "Molecular and cellular biology", "date": "1998", "authors": "Brown MT, Andrade J, Radhakrishna H, Donaldson JG, Cooper JA, Randazzo PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5620916", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620916" } ], "reference": [ { "type": "PubMed", "id": "9819391", "url": "https://glygen.org/publication/PubMed/9819391" } ] } ], "pathway": [ { "id": "hsa:11336", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:11336", "resource": "KEGG Pathway" }, { "id": "R-HSA-1445148", "name": "Translocation of SLC2A4 (GLUT4) to the plasma membrane", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1445148", "resource": "Reactome", "description": "Translocation of SLC2A4 (GLUT4) to the plasma membrane" }, { "id": "R-HSA-264876", "name": "Insulin processing", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-264876", "resource": "Reactome", "description": "Insulin processing" }, { "id": "R-HSA-5620916", "name": "VxPx cargo-targeting to cilium", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5620916", "resource": "Reactome", "description": "VxPx cargo-targeting to cilium" } ], "orthologs": [ { "uniprot_canonical_ac": "P32844-1", "protein_name": "Exocyst complex component SEC6", "gene_name": "SEC6", "tax_id": 559292, "organism": "Saccharomyces cerevisiae S288C", "sequence": { "sequence": "MSSDPLQQVCDLIKGDLSLERVRDIKEQLLKEKSVVEYQLNKESDKYYGEVEESLKLLNLSKNSVTSIKQQINEVNKLGNDNRFAINRYDILFRATKLYETVNTTSSIYDRIYNFVALMEHIERLLVAELAEDALETGCPHLLEIHFLLTSARDFQEQVVVMAKEATEDAQRTVMKLFSRLSGIISKFDKLLDGLTYDIVEMARAEQISLAIRLFKIYDLEEREDLRIEAIRNIIKKKEIEIEKSSIKKLPNSKNTARLQDETPKVIEYPTNKGLYQEIMSGTISTRTAPRGYKHFLINGINNSISEMFGEMREKYVGDQKFDVLDNMDWIFNELIIVKEHIANCCPPHWNIFEVYFDQYYKELHSLITDLVESEPETIIILDILAFDKTFQDTLKQDFGFTKSEVKSVIGDKEKETLFKDYLNLIVVKMTEWIGNLEKAEFDVFLERSTPPHSDSDGLLFLDGTKTCFQMFTQQVEVAAGTNQAKILVGVVERFSDLLTKRQKNWISKISEEIKKQINYNHKYDIDPESITPEDECPGGLVEYLIAVSNDQMKAADYAVAISSKYGKLVSKVYEKQITNHLEGTLDGFAEVAQCSSLGLITLMFDDLRKPYQEIFSKTWYMGSQAQQIADTLDEYLLDIKPQMNSVLFVNFIDNVIGETIIKFLTALSFEHSFKNKNNKFLEAMKRDFEIFYQLFVKVLDGNESKDTLITQNFTVMEFFMDLSCEPIDSILDIWQKYLEVYWDSRIDLLVGILKCRKDVSSSERKKIVQQATEMLHEYRRNMEANGVDREPTLMRRFVLEFEKQ", "length": 805 }, "evidence": [ { "id": "O60645", "url": "https://omabrowser.org/oma/group/O60645/", "database": "OMA" } ], "common_name": "Yeast" }, { "uniprot_canonical_ac": "Q62825-1", "protein_name": "Exocyst complex component 3", "gene_name": "Exoc3", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MCKDSACFSTMKETDLEAVATAVQRVAGMLQRPDQLDKVEQYRRREARKKASVEARLKAAIQSQLDGVRTGLSQLHNALNDVKDIQQSLADVSKDWRQSINTIESLKDVKDAVVQHSQLAAAVENLKNIFSVPEIVRETQDLIEQGALLQAHRKLMDLECSRDGLMCEQYRMDSGNKRDMTLIHGYFGSTQGLSDELAKQLWMVLQRSLVTVRRDPTLLVSVVRIIEREEKIDRRILDRKKQTGFVPPGRPKNWKEKMFAVLDRTVTTRIEGTQADTRESDKMWLVRHLEIIRKYVLDDLVIAKNLLVQCFPPHYDIFKNLLSMYHQALSIRMQDLASEDLEANEIVSLLTWVLNTYTSAEMMGNVELAPEVDVNALEPLLSPNVVSELLDTYMSTLTSNIIAWLRKALETDKKDWSKETEPEADQDGYYQTTLPAIVFQMFEQNLQVAAQISEDLKTKVLVLCLQQMNSFLSRYKEEAQLYKEEHLRNRQHPHCYVQYMVAIINNCQTFKESIISLKRKYLKPETEESLCQSQPSMDGILDAIAKEGCSSLLEEVFLDLEQHLNELMTKKWMLGSNAVDIICVTVEDYFNDFAKIKKPYKKRMTAEAHRRVVVEYLRAVMQKRISFRSAEERKEGAEKMVREAEQLRFLFRKLASGFGEDADGHCDTIVAVAEVIKLTDPSLLYLEVSTLVSKYPDIRDDHIGALLALRGDASRDMKQTIMETLEQGPMQASPNYVPIFQEIVVPSLNVAKLLK", "length": 755 }, "evidence": [ { "id": "45929850", "url": "http://www.informatics.jax.org/homology/45929850", "database": "MGI" }, { "id": "O60645", "url": "https://omabrowser.org/oma/group/O60645/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q6KAR6-1", "protein_name": "Exocyst complex component 3", "gene_name": "Exoc3", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MCKDSACFLTMKETDLEAVATAVQRVAGMLQRPDQLDKVEQYRRREARKKASVEARLKAAIQSQLDGVRTGLSQLHNALNDVKDIQQSLADVSKDWRQSINTIESLKDVKDAVVQHSQLAAAVENLKNIFSVPEIVRETQDLIEQGALLQAHRKLMDLECSRDGLMCEQYRMDSGNKRDMTLIHGYFGSTQGLSDELAKQLWMVLQRSLVTVRRDPTLLVSVVRIIEREEKIDRRILDRKKQTGFVPPGRPKNWKEKMFAILDRTVTTRIEGTQADTRESDKMWLVRHLEIIRKYVLDDLIVAKNLMVQCFPPHYEIFKNLLSMYHQALSTRMQDLASEDLEANEIVSLLTWVLNTYTSAEMMGNVELAPEVDVSALEPLLSPNIVSELLDTYMSTLTSNIIAWLRKALETDKKDWSKETEPEADQDGYYQTTLPAIVFQMFEQNLQVAAQISEDLKTKVLVLCLQQMNSFLSRYKDEAQLYKEEHLRNRQHPHCYVQYMIAIINNCQTFKESIISLKRKYLKTEAEEGLCLSQPSMDGILDAIAKEGCSSLLEEVFLDLEQHLNELMTKKWLLGSNAVDIICVTVEDYFNDFAKIKKPYKKRMTAEAHRRVVVEYLRAVMQKRISFRSAEERKEGAEKMVREAEQLRFLFRKLASGFGEDADGHCDTIVAVAEVIKLTDPSLLYLEVSTLVSKYPDIRDDHIGALLALRGDASRDMKQTIMETLEQGPMQASPNYVPIFKEIVVPSLNVAKLLK", "length": 755 }, "evidence": [ { "id": "45929850", "url": "http://www.informatics.jax.org/homology/45929850", "database": "MGI" }, { "id": "O60645", "url": "https://omabrowser.org/oma/group/O60645/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9V8K2-1", "protein_name": "Exocyst complex component 3", "gene_name": "Sec6", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MDLQQLEEQARQAALKDIQNMLQRPGQLEKVEQYRHRIARKKASVEALLKTGMQGQLDGVRVGLKQLETCMQDVREVRRRMDEVERLLRGVPEVYDALEVVREENTKHSQYATAMENLKHIFNVDASVQKTMALIEDDKLLNAHQCLADLENSRDDLLYELHKQPKQHASDKITLKRHFEKVDTVSQELEKKLRLILSRTLNTLRKKPTIIVTALRIIEREEKNDQFALQQQKVTGFLPPGRPKAWRRMIMDVLQQSVITRIEGSKLEERADNKMWLVRDLEILRQIILEDLRVVKSLCVPCFPPHYDIFGEYVKFYHEGLSSYLDNIVRSGLEGNEYVSMMAWVTHTYPGVELMSHPDLNVDVHRQIGTLLRPEHLKALEDEYLQNMQRNFQEWMTKAAETEKQEWFTETVPDQDEEYYHTSAPVIIFQMIDQHLQVTNTIHQELTFKALVMSIQQVEIFGQTYLKNVIELKEHHFRNRDQIKYFTHYIITIVNNSQQMVELAQQMKQLYWPKSRTEHYEDFERLLATFQRIRAHAASYLLEEAFLDMECHFNDLFTAKWLASNIAVDTICVTLDDYFQDYNHLRPNNFEMVINEAQKLLAKRYIRALLSKRLSKPRAECDAITRKIKTEAKRFKLFFEKIAPKISLSDSPLDLISTLSALLSSDIELLVLDLHTLLGSYPSLNEDHLVRLFYIRNDVKAAEVREKVQDAMKSKKAMVSIAKQDCIFKEIVFSDKLW", "length": 738 }, "evidence": [ { "id": "O60645", "url": "https://omabrowser.org/oma/group/O60645/", "database": "OMA" } ], "common_name": "Fruit fly" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 7, "go_terms": [ { "name": "exocytosis", "id": "GO:0006887", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006887", "evidence": [ { "database": "UniProtKB", "id": "O60645", "url": "https://www.uniprot.org/uniprot/O60645" } ], "pmid": "" }, { "name": "exocyst localization", "id": "GO:0051601", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051601", "evidence": [ { "database": "UniProtKB", "id": "O60645", "url": "https://www.uniprot.org/uniprot/O60645" } ], "pmid": "" }, { "name": "protein transport", "id": "GO:0015031", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015031", "evidence": [ { "database": "UniProtKB", "id": "O60645", "url": "https://www.uniprot.org/uniprot/O60645" } ], "pmid": "" }, { "name": "mitotic cytokinesis", "id": "GO:0000281", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000281", "evidence": [ { "database": "UniProtKB", "id": "O60645", "url": "https://www.uniprot.org/uniprot/O60645" } ], "pmid": "" }, { "name": "membrane fission", "id": "GO:0090148", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090148", "evidence": [ { "database": "UniProtKB", "id": "O60645", "url": "https://www.uniprot.org/uniprot/O60645" } ], "pmid": "" }, { "name": "vesicle docking involved in exocytosis", "id": "GO:0006904", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006904", "evidence": [ { "database": "UniProtKB", "id": "O60645", "url": "https://www.uniprot.org/uniprot/O60645" } ], "pmid": "" }, { "name": "vesicle tethering involved in exocytosis", "id": "GO:0090522", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090522", "evidence": [ { "database": "UniProtKB", "id": "O60645", "url": "https://www.uniprot.org/uniprot/O60645" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 8, "go_terms": [ { "name": "exocyst", "id": "GO:0000145", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000145", "evidence": [ { "database": "UniProtKB", "id": "O60645", "url": "https://www.uniprot.org/uniprot/O60645" } ], "pmid": "" }, { "name": "Golgi apparatus", "id": "GO:0005794", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005794", "evidence": [ { "database": "UniProtKB", "id": "O60645", "url": "https://www.uniprot.org/uniprot/O60645" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "O60645", "url": "https://www.uniprot.org/uniprot/O60645" } ], "pmid": "" }, { "name": "growth cone", "id": "GO:0030426", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030426", "evidence": [ { "database": "UniProtKB", "id": "O60645", "url": "https://www.uniprot.org/uniprot/O60645" } ], "pmid": "" }, { "name": "perinuclear region of cytoplasm", "id": "GO:0048471", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048471", "evidence": [ { "database": "UniProtKB", "id": "O60645", "url": "https://www.uniprot.org/uniprot/O60645" } ], "pmid": "" }, { "name": "secretory granule membrane", "id": "GO:0030667", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030667", "evidence": [ { "database": "UniProtKB", "id": "O60645", "url": "https://www.uniprot.org/uniprot/O60645" } ], "pmid": "" }, { "name": "midbody", "id": "GO:0030496", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030496", "evidence": [ { "database": "UniProtKB", "id": "O60645", "url": "https://www.uniprot.org/uniprot/O60645" } ], "pmid": "" }, { "name": "presynaptic membrane", "id": "GO:0042734", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042734", "evidence": [ { "database": "UniProtKB", "id": "O60645", "url": "https://www.uniprot.org/uniprot/O60645" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "cadherin binding", "id": "GO:0045296", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045296", "evidence": [ { "database": "UniProtKB", "id": "O60645", "url": "https://www.uniprot.org/uniprot/O60645" } ], "pmid": "" }, { "name": "SNARE binding", "id": "GO:0000149", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000149", "evidence": [ { "database": "UniProtKB", "id": "O60645", "url": "https://www.uniprot.org/uniprot/O60645" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [ 277 ], "glycation_sites": [], "phosphorylation_sites": [ 201, 338 ], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 91 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }