{ "uniprot_canonical_ac": "O60573-1", "uniprot_ac": "O60573", "uniprot_id": "IF4E2_HUMAN", "mass": { "chemical_mass": 28362.0, "monoisotopic_mass": 28362.0 }, "refseq": { "ac": "NP_001263265", "name": "eukaryotic translation initiation factor 4E type 2 isoform C", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001263265" }, "gene_names": [ { "name": "EIF4E2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O60573", "id": "O60573" }, { "name": "4E-LP; 4EHP; EIF4EL3; h4EHP; IF4e", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001263265", "id": "NP_001263265" }, { "name": "EIF4E2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001263265", "id": "NP_001263265" }, { "name": "EIF4EL3", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O60573", "id": "O60573" } ], "protein_names": [ { "name": "Eukaryotic translation initiation factor 4E type 2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O60573" }, { "name": "Eukaryotic translation initiation factor 4E homologous protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O60573" }, { "name": "Eukaryotic translation initiation factor 4E-like 3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O60573" }, { "name": "eIF-4E type 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O60573" }, { "name": "eIF4E type 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O60573" }, { "name": "eIF4E-like cap-binding protein; eukaryotic translation initiation factor 4E-like 3; eukaryotic translation initiation factor 4E type 2; eIF-4E type 2; eIF4E-like protein 4E-LP; mRNA cap-binding protein type 3; eukaryotic translation initiation factor 4E homologous protein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001263265", "id": "NP_001263265" }, { "name": "eIF4E-like protein 4E-LP", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O60573" }, { "name": "eukaryotic translation initiation factor 4E type 2 isoform C", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001263265", "id": "NP_001263265" }, { "name": "h4EHP", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O60573" }, { "name": "mRNA cap-binding protein 4EHP", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O60573" }, { "name": "mRNA cap-binding protein type 3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O60573" } ], "function": [ { "annotation": "(Microbial infection) Upon SARS coronavirus-2/SARS-CoV-2 infection, the interaction with non-structural protein 2 (nsp2) with GIGYF2 enhances GIGYF2 binding to EIF4E2 and increases repression of translation initiation of genes involved in antiviral innate immune response such as IFNB1.", "evidence": [ { "database": "UniProtKB", "id": "O60573", "url": "https://www.uniprot.org/uniprot/O60573#function" }, { "database": "PubMed", "id": "35878012", "url": "https://glygen.org/publication/PubMed/35878012" } ] }, { "annotation": "4EHP over-expression instigates a negative feedback loop that inhibits upstream signaling to 4E-BP1 and ribosomal protein S6 kinase 1 (S6K1) whereas the 4E-BP1-binding-deficient mutant of 4EHP(W95A) was unable to trigger this feedback loop", "evidence": [ { "database": "RefSeq", "id": "NP_001263265", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001263265" }, { "database": "PubMed", "id": "15094042", "url": "https://glygen.org/publication/PubMed/15094042" } ] }, { "annotation": "Component of the 4EHP-GYF2 complex, a multiprotein complex that acts as a repressor of translation initiation (PubMed:22751931, PubMed:35878012). In association with GIGYF2, assists ribosome-associated quality control (RQC) by sequestering the mRNA cap, blocking ribosome initiation and decreasing the translational load on problematic messages. Part of a pathway that works in parallel to RQC-mediated degradation of the stalled nascent polypeptide. GIGYF2 and EIF4E2 work downstream and independently of ZNF598, which seems to work as a scaffold that can recruit them to faulty mRNA even if alternative recruitment mechanisms may exist (PubMed:32726578).", "evidence": [ { "database": "UniProtKB", "id": "O60573", "url": "https://www.uniprot.org/uniprot/O60573#function" }, { "database": "PubMed", "id": "22751931", "url": "https://glygen.org/publication/PubMed/22751931" }, { "database": "PubMed", "id": "32726578", "url": "https://glygen.org/publication/PubMed/32726578" }, { "database": "PubMed", "id": "35878012", "url": "https://glygen.org/publication/PubMed/35878012" } ] }, { "annotation": "High EIF4E2 expression is an independent prognostic risk factor for poor overall survival and recurrence-free survival in uveal melanoma.", "evidence": [ { "database": "RefSeq", "id": "NP_001263265", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001263265" }, { "database": "PubMed", "id": "33785306", "url": "https://glygen.org/publication/PubMed/33785306" } ] }, { "annotation": "ISGylation of 4EHP may play an important role in cap structure-dependent translation control in immune responses.", "evidence": [ { "database": "RefSeq", "id": "NP_001263265", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001263265" }, { "database": "PubMed", "id": "17289916", "url": "https://glygen.org/publication/PubMed/17289916" } ] }, { "annotation": "METTL16 promotes translation and lung tumorigenesis by sequestering cytoplasmic eIF4E2.", "evidence": [ { "database": "RefSeq", "id": "NP_001263265", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001263265" }, { "database": "PubMed", "id": "36840945", "url": "https://glygen.org/publication/PubMed/36840945" } ] }, { "annotation": "MicroRNA-induced translational control of antiviral immunity by the cap-binding protein 4EHP.", "evidence": [ { "database": "RefSeq", "id": "NP_001263265", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001263265" }, { "database": "PubMed", "id": "33581076", "url": "https://glygen.org/publication/PubMed/33581076" } ] }, { "annotation": "Recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation. Acts as a repressor of translation initiation (PubMed:17368478, PubMed:22751931, PubMed:25624349, PubMed:33581076, PubMed:9582349). In contrast to EIF4E, it is unable to bind eIF4G (EIF4G1, EIF4G2 or EIF4G3), suggesting that it acts by competing with EIF4E and block assembly of eIF4F at the cap (By similarity). In P-bodies, component of a complex that promotes miRNA-mediated translational repression (PubMed:28487484). Involved in virus-induced host response by mediating miRNA MIR34A-induced translational silencing which controls IFNB1 production by a negative feedback mechanism (PubMed:28487484, PubMed:33581076).", "evidence": [ { "database": "UniProtKB", "id": "O60573", "url": "https://www.uniprot.org/uniprot/O60573#function" }, { "database": "PubMed", "id": "17368478", "url": "https://glygen.org/publication/PubMed/17368478" }, { "database": "UniProtKB", "id": "Q8BMB3", "url": "https://www.uniprot.org/uniprot/Q8BMB3#function" }, { "database": "PubMed", "id": "9582349", "url": "https://glygen.org/publication/PubMed/9582349" }, { "database": "PubMed", "id": "22751931", "url": "https://glygen.org/publication/PubMed/22751931" }, { "database": "PubMed", "id": "28487484", "url": "https://glygen.org/publication/PubMed/28487484" }, { "database": "PubMed", "id": "25624349", "url": "https://glygen.org/publication/PubMed/25624349" }, { "database": "PubMed", "id": "33581076", "url": "https://glygen.org/publication/PubMed/33581076" } ] }, { "annotation": "Translational repression of NMD targets by GIGYF2 and EIF4E2. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001263265", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001263265" }, { "database": "PubMed", "id": "34665823", "url": "https://glygen.org/publication/PubMed/34665823" } ] } ], "disease": [], "snv": [], "mutagenesis": [ { "start_pos": 121, "end_pos": 121, "sequence_org": "K", "sequence_mut": "R", "comment": "Does not affect ubiquitination by ARIH1; when associated with R-130; R-134 and R-222.", "evidence": [ { "database": "UniProtKB", "id": "O60573", "url": "https://www.uniprot.org/uniprot/O60573" }, { "database": "PubMed", "id": "25624349", "url": "https://glygen.org/publication/PubMed/25624349" } ] }, { "start_pos": 124, "end_pos": 124, "sequence_org": "W", "sequence_mut": "A", "comment": "Ability to bind capped mRNA reduced to less than 10% of wild-type.", "evidence": [ { "database": "UniProtKB", "id": "O60573", "url": "https://www.uniprot.org/uniprot/O60573" }, { "database": "PubMed", "id": "9582349", "url": "https://glygen.org/publication/PubMed/9582349" } ] }, { "start_pos": 124, "end_pos": 124, "sequence_org": "W", "sequence_mut": "F", "comment": "Ability to bind capped mRNA reduced to 13% of wild-type.", "evidence": [ { "database": "UniProtKB", "id": "O60573", "url": "https://www.uniprot.org/uniprot/O60573" }, { "database": "PubMed", "id": "9582349", "url": "https://glygen.org/publication/PubMed/9582349" } ] }, { "start_pos": 124, "end_pos": 126, "sequence_org": "WED", "sequence_mut": "FAA", "comment": "Unable to bind capped mRNA.", "evidence": [ { "database": "UniProtKB", "id": "O60573", "url": "https://www.uniprot.org/uniprot/O60573" }, { "database": "PubMed", "id": "9582349", "url": "https://glygen.org/publication/PubMed/9582349" } ] }, { "start_pos": 125, "end_pos": 125, "sequence_org": "E", "sequence_mut": "A", "comment": "Ability to bind capped mRNA reduced to less than 10% of wild-type.", "evidence": [ { "database": "UniProtKB", "id": "O60573", "url": "https://www.uniprot.org/uniprot/O60573" }, { "database": "PubMed", "id": "9582349", "url": "https://glygen.org/publication/PubMed/9582349" } ] }, { "start_pos": 126, "end_pos": 126, "sequence_org": "D", "sequence_mut": "A", "comment": "Slight reduction in ability to bind capped mRNA.", "evidence": [ { "database": "UniProtKB", "id": "O60573", "url": "https://www.uniprot.org/uniprot/O60573" }, { "database": "PubMed", "id": "9582349", "url": "https://glygen.org/publication/PubMed/9582349" } ] }, { "start_pos": 130, "end_pos": 130, "sequence_org": "K", "sequence_mut": "R", "comment": "Does not affect ubiquitination by ARIH1; when associated with R-121; R-134 and R-222.", "evidence": [ { "database": "UniProtKB", "id": "O60573", "url": "https://www.uniprot.org/uniprot/O60573" }, { "database": "PubMed", "id": "25624349", "url": "https://glygen.org/publication/PubMed/25624349" } ] }, { "start_pos": 134, "end_pos": 134, "sequence_org": "K", "sequence_mut": "R", "comment": "Does not affect ubiquitination by ARIH1; when associated with R-121; R-130 and R-222.", "evidence": [ { "database": "UniProtKB", "id": "O60573", "url": "https://www.uniprot.org/uniprot/O60573" }, { "database": "PubMed", "id": "25624349", "url": "https://glygen.org/publication/PubMed/25624349" } ] }, { "start_pos": 135, "end_pos": 135, "sequence_org": "W", "sequence_mut": "A", "comment": "Unable to bind capped mRNA.", "evidence": [ { "database": "UniProtKB", "id": "O60573", "url": "https://www.uniprot.org/uniprot/O60573" }, { "database": "PubMed", "id": "9582349", "url": "https://glygen.org/publication/PubMed/9582349" } ] }, { "start_pos": 148, "end_pos": 148, "sequence_org": "W", "sequence_mut": "A", "comment": "Unable to bind capped mRNA.", "evidence": [ { "database": "UniProtKB", "id": "O60573", "url": "https://www.uniprot.org/uniprot/O60573" }, { "database": "PubMed", "id": "9582349", "url": "https://glygen.org/publication/PubMed/9582349" } ] }, { "start_pos": 183, "end_pos": 183, "sequence_org": "W", "sequence_mut": "A", "comment": "Ability to bind capped mRNA reduced to less than 10% of wild-type.", "evidence": [ { "database": "UniProtKB", "id": "O60573", "url": "https://www.uniprot.org/uniprot/O60573" }, { "database": "PubMed", "id": "9582349", "url": "https://glygen.org/publication/PubMed/9582349" } ] }, { "start_pos": 183, "end_pos": 183, "sequence_org": "W", "sequence_mut": "F", "comment": "Unable to bind capped mRNA.", "evidence": [ { "database": "UniProtKB", "id": "O60573", "url": "https://www.uniprot.org/uniprot/O60573" }, { "database": "PubMed", "id": "9582349", "url": "https://glygen.org/publication/PubMed/9582349" } ] }, { "start_pos": 222, "end_pos": 222, "sequence_org": "K", "sequence_mut": "R", "comment": "Does not affect ubiquitination by ARIH1; when associated with R-121; R-130 and R-134.", "evidence": [ { "database": "UniProtKB", "id": "O60573", "url": "https://www.uniprot.org/uniprot/O60573" }, { "database": "PubMed", "id": "25624349", "url": "https://glygen.org/publication/PubMed/25624349" } ] }, { "start_pos": 63, "end_pos": 63, "sequence_org": "W", "sequence_mut": "A", "comment": "Unable to bind capped mRNA.", "evidence": [ { "database": "UniProtKB", "id": "O60573", "url": "https://www.uniprot.org/uniprot/O60573" }, { "database": "PubMed", "id": "9582349", "url": "https://glygen.org/publication/PubMed/9582349" } ] }, { "start_pos": 95, "end_pos": 95, "sequence_org": "W", "sequence_mut": "A", "comment": "Ability to bind capped mRNA reduced to 40% of wild-type.", "evidence": [ { "database": "UniProtKB", "id": "O60573", "url": "https://www.uniprot.org/uniprot/O60573" }, { "database": "PubMed", "id": "9582349", "url": "https://glygen.org/publication/PubMed/9582349" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "89.86", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000135930", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000135930" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "90.09", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000135930", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000135930" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "89.45", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000135930", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000135930" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "77.46", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000135930", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000135930" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "94.07", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000135930", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000135930" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "97.18", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000135930", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000135930" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "94.04", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000135930", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000135930" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "89.94", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000135930", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000135930" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "91.6", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000135930", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000135930" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "85.94", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000135930", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000135930" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "93.25", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000135930", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000135930" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "93.38", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000135930", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000135930" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "92.8", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000135930", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000135930" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O60573", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60573" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O60573", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60573" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O60573", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60573" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O60573", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60573" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O60573", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60573" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O60573", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60573" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O60573", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60573" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O60573", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60573" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O60573", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60573" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O60573", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60573" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O60573", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60573" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O60573", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60573" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O60573", "url": "https://www.uniprot.org/uniprot/O60573" } ], "common_name": "Human" } ], "gene": [ { "name": "EIF4E2", "url": "https://www.uniprot.org/uniprot/O60573", "locus": { "chromosome": "2", "start_pos": 232583644, "end_pos": 232550659, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000135930", "url": "https://www.ensembl.org/id/ENSG00000135930" } ] } } ], "crossref": [ { "id": "ENSG00000135930", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000135930", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "EIF4E2", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=EIF4E2", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "9470", "url": "https://www.ncbi.nlm.nih.gov/gene/9470", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "3293", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=3293", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "B9A044", "url": "https://www.ebi.ac.uk/intact/interactors/id:B9A044*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "O60573", "url": "https://www.ebi.ac.uk/intact/interactors/id:O60573*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001040", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001040", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR019770", "url": "https://www.ebi.ac.uk/interpro/entry/IPR019770", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR023398", "url": "https://www.ebi.ac.uk/interpro/entry/IPR023398", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:9470", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:9470", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "605895", "url": "http://www.omim.org/entry/605895", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O60573", "url": "https://www.nextprot.org/entry/NX_O60573", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "CASVEQW", "url": "https://omabrowser.org/oma/group/CASVEQW/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "180043at2759", "url": "http://www.orthodb.org/?query=180043at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11960", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11960", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11960:SF17", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11960:SF17", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "2JGB", "url": "https://www.rcsb.org/structure/2JGB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2JGC", "url": "https://www.rcsb.org/structure/2JGC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5NVK", "url": "https://www.rcsb.org/structure/5NVK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5NVL", "url": "https://www.rcsb.org/structure/5NVL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5NVM", "url": "https://www.rcsb.org/structure/5NVM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5NVN", "url": "https://www.rcsb.org/structure/5NVN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5XLN", "url": "https://www.rcsb.org/structure/5XLN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF01652", "url": "http://pfam.xfam.org/family/PF01652", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O60573", "url": "https://pharos.nih.gov/targets/O60573", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O60573", "url": "http://purl.obolibrary.org/obo/PR_O60573", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001263265", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001263265", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A8I5KSA5", "url": "https://www.uniprot.org/uniprot/A0A8I5KSA5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5KSA5-1", "url": "https://www.uniprot.org/uniprot/A0A8I5KSA5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5KT16", "url": "https://www.uniprot.org/uniprot/A0A8I5KT16", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8I5KT16-1", "url": "https://www.uniprot.org/uniprot/A0A8I5KT16-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B4E1E4", "url": "https://www.uniprot.org/uniprot/B4E1E4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B4E1E4-1", "url": "https://www.uniprot.org/uniprot/B4E1E4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B8ZZ50", "url": "https://www.uniprot.org/uniprot/B8ZZ50", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B8ZZ50-1", "url": "https://www.uniprot.org/uniprot/B8ZZ50-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B8ZZL3", "url": "https://www.uniprot.org/uniprot/B8ZZL3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B8ZZL3-1", "url": "https://www.uniprot.org/uniprot/B8ZZL3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B9A023", "url": "https://www.uniprot.org/uniprot/B9A023", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B9A023-1", "url": "https://www.uniprot.org/uniprot/B9A023-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B9A044", "url": "https://www.uniprot.org/uniprot/B9A044", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B9A044-1", "url": "https://www.uniprot.org/uniprot/B9A044-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9JEL3", "url": "https://www.uniprot.org/uniprot/C9JEL3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9JEL3-1", "url": "https://www.uniprot.org/uniprot/C9JEL3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H7BZH2", "url": "https://www.uniprot.org/uniprot/H7BZH2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H7BZH2-1", "url": "https://www.uniprot.org/uniprot/H7BZH2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O60573", "url": "https://www.uniprot.org/uniprot/O60573", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O60573-1", "url": "https://www.uniprot.org/uniprot/O60573-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O60573-2", "url": "https://www.uniprot.org/uniprot/O60573-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKMPGRLGPQRLLFQNLWKPRLNVP", "length": 245, "header": "sp|O60573-1|IF4E2_HUMAN Isoform 1 of Eukaryotic translation initiation factor 4E type 2 OS=Homo sapiens OX=9606 GN=EIF4E2 PE=1 SV=1 CANONICAL=O60573-1" }, "isoforms": [ { "isoform_ac": "A0A8I5KSA5-1", "url": "", "sequence": { "sequence": "MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKAWEEFHGLVNSSGR", "length": 191, "header": "tr|A0A8I5KSA5-1|IF4E2_HUMAN Computationally mapped isoform of Eukaryotic translation initiation factor 4E type 2 OS=Homo sapiens OX=9606 GN=EIF4E2 PE=1 SV=1 CANONICAL=O60573-1" }, "locus": { "chromosome": "2", "start_pos": 232574305, "end_pos": 232550725, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000687222.1", "url": "https://www.ensembl.org/id/ENST00000687222.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000508671.1", "url": "https://www.ensembl.org/id/ENSP00000508671.1" } ] } }, { "isoform_ac": "A0A8I5KT16-1", "url": "", "sequence": { "sequence": "MVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKAWEEFHGLVNSSGR", "length": 136, "header": "tr|A0A8I5KT16-1|A0A8I5KT16_HUMAN Computationally mapped isoform of Eukaryotic translation initiation factor 4E family member 2 OS=Homo sapiens OX=9606 GN=EIF4E2 PE=1 SV=1 CANONICAL=O60573-1" }, "locus": { "chromosome": "2", "start_pos": 232574305, "end_pos": 232564277, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000690794.1", "url": "https://www.ensembl.org/id/ENST00000690794.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000509248.1", "url": "https://www.ensembl.org/id/ENSP00000509248.1" } ] } }, { "isoform_ac": "B4E1E4-1", "url": "", "sequence": { "sequence": "MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKYVLGGYGRTCP", "length": 188, "header": "tr|B4E1E4-1|B4E1E4_HUMAN Computationally mapped isoform of cDNA FLJ59146, moderately similar to Eukaryotic translation initiation factor 4E type 3 OS=Homo sapiens OX=9606 GN=EIF4E2 PE=1 SV=1 CANONICAL=O60573-1" }, "locus": { "chromosome": "2", "start_pos": 232567248, "end_pos": 232550725, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000409167.8", "url": "https://www.ensembl.org/id/ENST00000409167.8" }, { "database": "Ensembl Peptide", "id": "ENSP00000387328.3", "url": "https://www.ensembl.org/id/ENSP00000387328.3" } ] } }, { "isoform_ac": "B8ZZ50-1", "url": "", "sequence": { "sequence": "MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKAWEEFHGLVNSSGR", "length": 236, "header": "tr|B8ZZ50-1|IF4E2_HUMAN Computationally mapped isoform of Eukaryotic translation initiation factor 4E type 2 OS=Homo sapiens OX=9606 GN=EIF4E2 PE=1 SV=1 CANONICAL=O60573-1" }, "locus": { "chromosome": "2", "start_pos": 232574305, "end_pos": 232550725, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000409514.5", "url": "https://www.ensembl.org/id/ENST00000409514.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000387336.1", "url": "https://www.ensembl.org/id/ENSP00000387336.1" } ] } }, { "isoform_ac": "B8ZZL3-1", "url": "", "sequence": { "sequence": "MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKMPGRLGPQRLLFQNLWKPRLNVP", "length": 200, "header": "tr|B8ZZL3-1|IF4E2_HUMAN Computationally mapped isoform of Eukaryotic translation initiation factor 4E type 2 OS=Homo sapiens OX=9606 GN=EIF4E2 PE=1 SV=1 CANONICAL=O60573-1" }, "locus": { "chromosome": "2", "start_pos": 232569014, "end_pos": 232550725, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000409322.5", "url": "https://www.ensembl.org/id/ENST00000409322.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000386424.1", "url": "https://www.ensembl.org/id/ENSP00000386424.1" } ] } }, { "isoform_ac": "B9A023-1", "url": "", "sequence": { "sequence": "MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKDNSSFRNTKITL", "length": 189, "header": "tr|B9A023-1|IF4E2_HUMAN Computationally mapped isoform of Eukaryotic translation initiation factor 4E type 2 OS=Homo sapiens OX=9606 GN=EIF4E2 PE=1 SV=1 CANONICAL=O60573-1" }, "locus": { "chromosome": "2", "start_pos": 232580940, "end_pos": 232550725, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000409394.5", "url": "https://www.ensembl.org/id/ENST00000409394.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000386983.1", "url": "https://www.ensembl.org/id/ENSP00000386983.1" } ] } }, { "isoform_ac": "B9A044-1", "url": "", "sequence": { "sequence": "MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKYVLGGYGRTCP", "length": 233, "header": "tr|B9A044-1|IF4E2_HUMAN Computationally mapped isoform of Eukaryotic translation initiation factor 4E type 2 OS=Homo sapiens OX=9606 GN=EIF4E2 PE=1 SV=1 CANONICAL=O60573-1" }, "locus": { "chromosome": "2", "start_pos": 232567248, "end_pos": 232550725, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000409495.6", "url": "https://www.ensembl.org/id/ENST00000409495.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000386876.1", "url": "https://www.ensembl.org/id/ENSP00000386876.1" } ] } }, { "isoform_ac": "C9JEL3-1", "url": "", "sequence": { "sequence": "MSLKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHT", "length": 213, "header": "tr|C9JEL3-1|IF4E2_HUMAN Computationally mapped isoform of Eukaryotic translation initiation factor 4E type 2 OS=Homo sapiens OX=9606 GN=EIF4E2 PE=1 SV=1 CANONICAL=O60573-1" }, "locus": { "chromosome": "2", "start_pos": 232567203, "end_pos": 232551214, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000454501.1", "url": "https://www.ensembl.org/id/ENST00000454501.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000390904.1", "url": "https://www.ensembl.org/id/ENSP00000390904.1" } ] } }, { "isoform_ac": "H7BZH2-1", "url": "", "sequence": { "sequence": "RVGCSAPRKGKSSGTSLLCSQGLGGVSWPGEQQRPLIGRSPSVSHTQGTIQAFEIQKSHCESTQAGNNPFLYVCVCPKWMGGLQPVLPLLTEGTSLSRALSFCTHSWRTDSARHPPASLTL", "length": 121, "header": "tr|H7BZH2-1|IF4E2_HUMAN Computationally mapped isoform of Eukaryotic translation initiation factor 4E type 2 OS=Homo sapiens OX=9606 GN=EIF4E2 PE=1 SV=1 CANONICAL=O60573-1" }, "locus": { "chromosome": "2", "start_pos": 232581124, "end_pos": 232574074, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000444113.1", "url": "https://www.ensembl.org/id/ENST00000444113.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000389578.1", "url": "https://www.ensembl.org/id/ENSP00000389578.1" } ] } }, { "isoform_ac": "O60573-1", "url": "", "sequence": { "sequence": "MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKMPGRLGPQRLLFQNLWKPRLNVP", "length": 245, "header": "sp|O60573-1|IF4E2_HUMAN Isoform 1 of Eukaryotic translation initiation factor 4E type 2 OS=Homo sapiens OX=9606 GN=EIF4E2 PE=1 SV=1 CANONICAL=O60573-1" }, "locus": { "chromosome": "2", "start_pos": 232569014, "end_pos": 232550725, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000258416.8", "url": "https://www.ensembl.org/id/ENST00000258416.8" }, { "database": "Ensembl Peptide", "id": "ENSP00000258416.3", "url": "https://www.ensembl.org/id/ENSP00000258416.3" } ] } }, { "isoform_ac": "O60573-2", "url": "", "sequence": { "sequence": "MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTERDKNQSSSKRKAVVPGPAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWRFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKDNSSFRNTKITL", "length": 234, "header": "sp|O60573-2|IF4E2_HUMAN Isoform 2 of Eukaryotic translation initiation factor 4E type 2 OS=Homo sapiens OX=9606 GN=EIF4E2 PE=1 SV=1 CANONICAL=O60573-1" }, "locus": { "chromosome": "2", "start_pos": 232580940, "end_pos": 232550725, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000409098.5", "url": "https://www.ensembl.org/id/ENST00000409098.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000386996.1", "url": "https://www.ensembl.org/id/ENSP00000386996.1" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 13, "end_pos": 13, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O60573", "url": "https://www.uniprot.org/uniprot/O60573" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O60573", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60573" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" } ], "site_lbl": "Ser13" } ], "glycation": [], "keywords": [], "publication": [ { "title": "A PPxY motif within the VP40 protein of Ebola virus interacts physically and functionally with a ubiquitin ligase: implications for filovirus budding.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2000", "authors": "Harty RN, Brown ME, Wang G, Huibregtse J, Hayes FP", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "11095724", "url": "https://glygen.org/publication/PubMed/11095724" } ] }, { "title": "Ubiquitination of HIV-1 and MuLV Gag.", "journal": "Virology", "date": "2000", "authors": "Ott DE, Coren LV, Chertova EN, Gagliardi TD, Schubert U", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "11112487", "url": "https://glygen.org/publication/PubMed/11112487" } ] }, { "title": "Influenza B virus NS1 protein inhibits conjugation of the interferon (IFN)-induced ubiquitin-like ISG15 protein.", "journal": "The EMBO journal", "date": "2001", "authors": "Yuan W, Krug RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "11157743", "url": "https://glygen.org/publication/PubMed/11157743" } ] }, { "title": "UBP43 (USP18) specifically removes ISG15 from conjugated proteins.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Malakhov MP, Malakhova OA, Kim KI, Ritchie KJ, Zhang DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "11788588", "url": "https://glygen.org/publication/PubMed/11788588" } ] }, { "title": "Overlapping motifs (PTAP and PPEY) within the Ebola virus VP40 protein function independently as late budding domains: involvement of host proteins TSG101 and VPS-4.", "journal": "Journal of virology", "date": "2003", "authors": "Licata JM, Simpson-Holley M, Wright NT, Han Z, Paragas J, Harty RN", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "12525615", "url": "https://glygen.org/publication/PubMed/12525615" } ] }, { "title": "High-throughput immunoblotting. Ubiquitiin-like protein ISG15 modifies key regulators of signal transduction.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Malakhov MP, Kim KI, Malakhova OA, Jacobs BS, Borden EC, Zhang DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "12582176", "url": "https://glygen.org/publication/PubMed/12582176" } ] }, { "title": "Human homologue of ariadne promotes the ubiquitylation of translation initiation factor 4E homologous protein, 4EHP.", "journal": "FEBS letters", "date": "2003", "authors": "Tan NG, Ardley HC, Scott GB, Rose SA, Markham AF, Robinson PA", "evidence": [ { "database": "UniProtKB", "id": "O60573", "url": "https://www.uniprot.org/uniprot/O60573" } ], "reference": [ { "type": "PubMed", "id": "14623119", "url": "https://glygen.org/publication/PubMed/14623119" } ] }, { "title": "Characterizing the interaction of the mammalian eIF4E-related protein 4EHP with 4E-BP1.", "journal": "FEBS letters", "date": "2004", "authors": "Tee AR, Tee JA, Blenis J", "evidence": [ { "database": "RefSeq", "id": "NP_001263265", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001263265" } ], "reference": [ { "type": "PubMed", "id": "15094042", "url": "https://glygen.org/publication/PubMed/15094042" } ] }, { "title": "The UbcH8 ubiquitin E2 enzyme is also the E2 enzyme for ISG15, an IFN-alpha/beta-induced ubiquitin-like protein.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Zhao C, Beaudenon SL, Kelley ML, Waddell MB, Yuan W, Schulman BA, Huibregtse JM, Krug RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "15131269", "url": "https://glygen.org/publication/PubMed/15131269" } ] }, { "title": "Characterization of mammalian eIF4E-family members.", "journal": "Eur. J. Biochem.", "date": "2004", "authors": "Joshi B, Cameron A, Jagus R", "evidence": [ { "database": "UniProtKB", "id": "O60573", "url": "https://www.uniprot.org/uniprot/O60573" } ], "reference": [ { "type": "PubMed", "id": "15153109", "url": "https://glygen.org/publication/PubMed/15153109" } ] }, { "title": "Interferon-inducible ubiquitin E2, Ubc8, is a conjugating enzyme for protein ISGylation.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Kim KI, Giannakopoulos NV, Virgin HW, Zhang DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "15485925", "url": "https://glygen.org/publication/PubMed/15485925" } ] }, { "title": "An unconventional NLS is critical for the nuclear import of the influenza A virus nucleoprotein and ribonucleoprotein.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2005", "authors": "Cros JF, Garcia-Sastre A, Palese P", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "15702989", "url": "https://glygen.org/publication/PubMed/15702989" } ] }, { "title": "Human ISG15 conjugation targets both IFN-induced and constitutively expressed proteins functioning in diverse cellular pathways.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Zhao C, Denison C, Huibregtse JM, Gygi S, Krug RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "16009940", "url": "https://glygen.org/publication/PubMed/16009940" } ] }, { "title": "ISG15 modification of Ubc13 suppresses its ubiquitin-conjugating activity.", "journal": "Biochemical and biophysical research communications", "date": "2005", "authors": "Takeuchi T, Yokosawa H", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "16112642", "url": "https://glygen.org/publication/PubMed/16112642" } ] }, { "title": "ISG15 modification of ubiquitin E2 Ubc13 disrupts its ability to form thioester bond with ubiquitin.", "journal": "Biochemical and biophysical research communications", "date": "2005", "authors": "Zou W, Papov V, Malakhova O, Kim KI, Dao C, Li J, Zhang DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "16122702", "url": "https://glygen.org/publication/PubMed/16122702" } ] }, { "title": "Proteomic identification of proteins conjugated to ISG15 in mouse and human cells.", "journal": "Biochemical and biophysical research communications", "date": "2005", "authors": "Giannakopoulos NV, Luo JK, Papov V, Zou W, Lenschow DJ, Jacobs BS, Borden EC, Li J, Virgin HW, Zhang DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "16139798", "url": "https://glygen.org/publication/PubMed/16139798" } ] }, { "title": "The interferon-inducible ubiquitin-protein isopeptide ligase (E3) EFP also functions as an ISG15 E3 ligase.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Zou W, Zhang DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "16352599", "url": "https://glygen.org/publication/PubMed/16352599" } ] }, { "title": "Herc5, an interferon-induced HECT E3 enzyme, is required for conjugation of ISG15 in human cells.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Dastur A, Beaudenon S, Kelley M, Krug RM, Huibregtse JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "16407192", "url": "https://glygen.org/publication/PubMed/16407192" } ] }, { "title": "Link between the ubiquitin conjugation system and the ISG15 conjugation system: ISG15 conjugation to the UbcH6 ubiquitin E2 enzyme.", "journal": "Journal of biochemistry", "date": "2005", "authors": "Takeuchi T, Iwahara S, Saeki Y, Sasajima H, Yokosawa H", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "16428300", "url": "https://glygen.org/publication/PubMed/16428300" } ] }, { "title": "Negative regulation of interferon-regulatory factor 3-dependent innate antiviral response by the prolyl isomerase Pin1.", "journal": "Nature immunology", "date": "2006", "authors": "Saitoh T, Tun-Kyi A, Ryo A, Yamamoto M, Finn G, Fujita T, Akira S, Yamamoto N, Lu KP, Yamaoka S", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "16699525", "url": "https://glygen.org/publication/PubMed/16699525" } ] }, { "title": "Pin-ning down immune responses to RNA viruses.", "journal": "Nature immunology", "date": "2006", "authors": "Goutagny N, Severa M, Fitzgerald KA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "16715065", "url": "https://glygen.org/publication/PubMed/16715065" } ] }, { "title": "Cumulative mutations of ubiquitin acceptor sites in human immunodeficiency virus type 1 gag cause a late budding defect.", "journal": "Journal of virology", "date": "2006", "authors": "Gottwein E, Jager S, Habermann A, Krausslich HG", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "16775314", "url": "https://glygen.org/publication/PubMed/16775314" } ] }, { "title": "HERC5 is an IFN-induced HECT-type E3 protein ligase that mediates type I IFN-induced ISGylation of protein targets.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Wong JJ, Pung YF, Sze NS, Chin KC", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "16815975", "url": "https://glygen.org/publication/PubMed/16815975" } ] }, { "title": "Negative regulation of protein phosphatase 2Cbeta by ISG15 conjugation.", "journal": "FEBS letters", "date": "2006", "authors": "Takeuchi T, Kobayashi T, Tamura S, Yokosawa H", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "16872604", "url": "https://glygen.org/publication/PubMed/16872604" } ] }, { "title": "ISG15 enhances the innate antiviral response by inhibition of IRF-3 degradation.", "journal": "Cellular and molecular biology (Noisy-le-Grand, France)", "date": "2006", "authors": "Lu G, Reinert JT, Pitha-Rowe I, Okumura A, Kellum M, Knobeloch KP, Hassel B, Pitha PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "16914094", "url": "https://glygen.org/publication/PubMed/16914094" } ] }, { "title": "ISG15 modification of the eIF4E cognate 4EHP enhances cap structure-binding activity of 4EHP.", "journal": "Genes & development", "date": "2007", "authors": "Okumura F, Zou W, Zhang DE", "evidence": [ { "database": "UniProtKB", "id": "O60573", "url": "https://www.uniprot.org/uniprot/O60573" }, { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" }, { "database": "RefSeq", "id": "NP_001263265", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001263265" } ], "reference": [ { "type": "PubMed", "id": "17289916", "url": "https://glygen.org/publication/PubMed/17289916" } ] }, { "title": "Structures of the human eIF4E homologous protein, h4EHP, in its m7GTP-bound and unliganded forms.", "journal": "Journal of molecular biology", "date": "2007", "authors": "Rosettani P, Knapp S, Vismara MG, Rusconi L, Cameron AD", "evidence": [ { "database": "UniProtKB", "id": "O60573", "url": "https://www.uniprot.org/uniprot/O60573" } ], "reference": [ { "type": "PubMed", "id": "17368478", "url": "https://glygen.org/publication/PubMed/17368478" } ] }, { "title": "Nuclear and nucleolar targeting of influenza A virus NS1 protein: striking differences between different virus subtypes.", "journal": "Journal of virology", "date": "2007", "authors": "Melen K, Kinnunen L, Fagerlund R, Ikonen N, Twu KY, Krug RM, Julkunen I", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "17376915", "url": "https://glygen.org/publication/PubMed/17376915" } ] }, { "title": "ISG15 inhibits Nedd4 ubiquitin E3 activity and enhances the innate antiviral response.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Malakhova OA, Zhang DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "18287095", "url": "https://glygen.org/publication/PubMed/18287095" } ] }, { "title": "ISG15 inhibits Ebola VP40 VLP budding in an L-domain-dependent manner by blocking Nedd4 ligase activity.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Okumura A, Pitha PM, Harty RN", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "18305167", "url": "https://glygen.org/publication/PubMed/18305167" } ] }, { "title": "The basis for selective E1-E2 interactions in the ISG15 conjugation system.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Durfee LA, Kelley ML, Huibregtse JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "18583345", "url": "https://glygen.org/publication/PubMed/18583345" } ] }, { "title": "ISG15 Arg151 and the ISG15-conjugating enzyme UbE1L are important for innate immune control of Sindbis virus.", "journal": "Journal of virology", "date": "2009", "authors": "Giannakopoulos NV, Arutyunova E, Lai C, Lenschow DJ, Haas AL, Virgin HW", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "19073728", "url": "https://glygen.org/publication/PubMed/19073728" } ] }, { "title": "Inhibition of IRF3-dependent antiviral responses by cellular and viral proteins.", "journal": "Cell research", "date": "2009", "authors": "Tsuchida T, Kawai T, Akira S", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "19125153", "url": "https://glygen.org/publication/PubMed/19125153" } ] }, { "title": "ISG15 modification of filamin B negatively regulates the type I interferon-induced JNK signalling pathway.", "journal": "EMBO reports", "date": "2009", "authors": "Jeon YJ, Choi JS, Lee JY, Yu KR, Kim SM, Ka SH, Oh KH, Kim KI, Zhang DE, Bang OS, Chung CH", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "19270716", "url": "https://glygen.org/publication/PubMed/19270716" } ] }, { "title": "Lysine acetylation targets protein complexes and co-regulates major cellular functions.", "journal": "Science (New York, N.Y.)", "date": "2009", "authors": "Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M", "evidence": [ { "database": "UniProtKB", "id": "O60573", "url": "https://www.uniprot.org/uniprot/O60573" } ], "reference": [ { "type": "PubMed", "id": "19608861", "url": "https://glygen.org/publication/PubMed/19608861" } ] }, { "title": "Global effects of kinase inhibitors on signaling networks revealed by quantitative phosphoproteomics.", "journal": "Molecular & cellular proteomics : MCP", "date": "2009", "authors": "Pan C, Olsen JV, Daub H, Mann M", "evidence": [ { "database": "iPTMnet", "id": "O60573-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60573-1" } ], "reference": [ { "type": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" } ] }, { "title": "ISG15 conjugation system targets the viral NS1 protein in influenza A virus-infected cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Zhao C, Hsiang TY, Kuo RL, Krug RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "20133869", "url": "https://glygen.org/publication/PubMed/20133869" } ] }, { "title": "Species-specific antagonism of host ISGylation by the influenza B virus NS1 protein.", "journal": "Journal of virology", "date": "2010", "authors": "Versteeg GA, Hale BG, van Boheemen S, Wolff T, Lenschow DJ, Garcia-Sastre A", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "20219937", "url": "https://glygen.org/publication/PubMed/20219937" } ] }, { "title": "Positive regulation of interferon regulatory factor 3 activation by Herc5 via ISG15 modification.", "journal": "Molecular and cellular biology", "date": "2010", "authors": "Shi HX, Yang K, Liu X, Liu XY, Wei B, Shan YF, Zhu LH, Wang C", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "20308324", "url": "https://glygen.org/publication/PubMed/20308324" } ] }, { "title": "Herc5 attenuates influenza A virus by catalyzing ISGylation of viral NS1 protein.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2010", "authors": "Tang Y, Zhong G, Zhu L, Liu X, Shan Y, Feng H, Bu Z, Chen H, Wang C", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "20385878", "url": "https://glygen.org/publication/PubMed/20385878" } ] }, { "title": "A novel 4EHP-GIGYF2 translational repressor complex is essential for mammalian development.", "journal": "Molecular and cellular biology", "date": "2012", "authors": "Morita M, Ler LW, Fabian MR, Siddiqui N, Mullin M, Henderson VC, Alain T, Fonseca BD, Karashchuk G, Bennett CF, Kabuta T, Higashi S, Larsson O, Topisirovic I, Smith RJ, Gingras AC, Sonenberg N", "evidence": [ { "database": "UniProtKB", "id": "O60573", "url": "https://www.uniprot.org/uniprot/O60573" } ], "reference": [ { "type": "PubMed", "id": "22751931", "url": "https://glygen.org/publication/PubMed/22751931" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "O60573", "url": "https://www.uniprot.org/uniprot/O60573" }, { "database": "iPTMnet", "id": "O60573", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60573" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "Investigating the consequences of eIF4E2 (4EHP) interaction with 4E-transporter on its cellular distribution in HeLa cells.", "journal": "PLoS ONE", "date": "2013", "authors": "Kubacka D, Kamenska A, Broomhead H, Minshall N, Darzynkiewicz E, Standart N", "evidence": [ { "database": "UniProtKB", "id": "O60573", "url": "https://www.uniprot.org/uniprot/O60573" } ], "reference": [ { "type": "PubMed", "id": "23991149", "url": "https://glygen.org/publication/PubMed/23991149" } ] }, { "title": "The E3 ubiquitin ligase ARIH1 protects against genotoxic stress by initiating a 4EHP-mediated mRNA translation arrest.", "journal": "Molecular and cellular biology", "date": "2015", "authors": "von Stechow L, Typas D, Carreras Puigvert J, Oort L, Siddappa R, Pines A, Vrieling H, van de Water B, Mullenders LH, Danen EH", "evidence": [ { "database": "UniProtKB", "id": "O60573", "url": "https://www.uniprot.org/uniprot/O60573" } ], "reference": [ { "type": "PubMed", "id": "25624349", "url": "https://glygen.org/publication/PubMed/25624349" } ] }, { "title": "Cap-binding protein 4EHP effects translation silencing by microRNAs.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2017", "authors": "Chapat C, Jafarnejad SM, Matta-Camacho E, Hesketh GG, Gelbart IA, Attig J, Gkogkas CG, Alain T, Stern-Ginossar N, Fabian MR, Gingras AC, Duchaine TF, Sonenberg N", "evidence": [ { "database": "UniProtKB", "id": "O60573", "url": "https://www.uniprot.org/uniprot/O60573" } ], "reference": [ { "type": "PubMed", "id": "28487484", "url": "https://glygen.org/publication/PubMed/28487484" } ] }, { "title": "GIGYF2 and 4EHP Inhibit Translation Initiation of Defective Messenger RNAs to Assist Ribosome-Associated Quality Control.", "journal": "Molecular cell", "date": "2020", "authors": "Hickey KL, Dickson K, Cogan JZ, Replogle JM, Schoof M, D'Orazio KN, Sinha NK, Hussmann JA, Jost M, Frost A, Green R, Weissman JS, Kostova KK", "evidence": [ { "database": "UniProtKB", "id": "O60573", "url": "https://www.uniprot.org/uniprot/O60573" } ], "reference": [ { "type": "PubMed", "id": "32726578", "url": "https://glygen.org/publication/PubMed/32726578" } ] }, { "title": "microRNA-induced translational control of antiviral immunity by the cap-binding protein 4EHP.", "journal": "Molecular cell", "date": "2021", "authors": "Zhang X, Chapat C, Wang P, Choi JH, Li Q, Luo J, Wiebe S, Kim SH, Robichaud N, Karam IF, Dai D, Hackett AP, Lin R, Alain T, Yang L, Jafarnejad SM, Sonenberg N", "evidence": [ { "database": "UniProtKB", "id": "O60573", "url": "https://www.uniprot.org/uniprot/O60573" }, { "database": "RefSeq", "id": "NP_001263265", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001263265" } ], "reference": [ { "type": "PubMed", "id": "33581076", "url": "https://glygen.org/publication/PubMed/33581076" } ] }, { "title": "High EIF4E2 expression is an independent prognostic risk factor for poor overall survival and recurrence-free survival in uveal melanoma.", "journal": "Experimental eye research", "date": "2021", "authors": "Yang B, Gu A, Wu Y", "evidence": [ { "database": "RefSeq", "id": "NP_001263265", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001263265" } ], "reference": [ { "type": "PubMed", "id": "33785306", "url": "https://glygen.org/publication/PubMed/33785306" } ] }, { "title": "Translational repression of NMD targets by GIGYF2 and EIF4E2.", "journal": "PLoS genetics", "date": "2021", "authors": "Zinshteyn B, Sinha NK, Enam SU, Koleske B, Green R", "evidence": [ { "database": "RefSeq", "id": "NP_001263265", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001263265" } ], "reference": [ { "type": "PubMed", "id": "34665823", "url": "https://glygen.org/publication/PubMed/34665823" } ] }, { "title": "SARS-CoV-2 impairs interferon production via NSP2-induced repression of mRNA translation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2022-08-09", "authors": "Xu Zhang, Choi Jung-Hyun, Dai David L, Luo Jun, Ladak Reese Jalal, Li Qian, Wang Yimeng, Zhang Christine, Wiebe Shane, Liu Alex C H, Ran Xiaozhuo, Yang Jiaqi, Naeli Parisa, Garzia Aitor, Zhou Lele, Mahmood Niaz, Deng Qiyun, Elaish Mohamed, Lin Rongtuan, Mahal Lara K, Hobman Tom C, Pelletier Jerry, Alain Tommy, Vidal Silvia M, Duchaine Thomas, Mazhab-Jafari Mohammad T, Mao Xiaojuan, Jafarnejad Seyed Mehdi, Sonenberg Nahum", "evidence": [ { "database": "UniProtKB", "id": "O60573", "url": "https://www.uniprot.org/uniprot/O60573" } ], "reference": [ { "type": "PubMed", "id": "35878012", "url": "https://glygen.org/publication/PubMed/35878012" } ] }, { "title": "METTL16 promotes translation and lung tumorigenesis by sequestering cytoplasmic eIF4E2.", "journal": "Cell reports", "date": "2023-03-28", "authors": "Wang Fei, Zhang Jun, Lin Xianrong, Yang Lu, Zhou Qi, Mi Xue, Li Qiujie, Wang Shen, Li Dawei, Liu Xiao-Min, Zhou Jun", "evidence": [ { "database": "RefSeq", "id": "NP_001263265", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001263265" } ], "reference": [ { "type": "PubMed", "id": "36840945", "url": "https://glygen.org/publication/PubMed/36840945" } ] }, { "title": "Nuclear import of influenza virus RNA can be mediated by viral nucleoprotein and transport factors required for protein import.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "O'Neill RE, Jaskunas R, Blobel G, Palese P, Moroianu J", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "7559393", "url": "https://glygen.org/publication/PubMed/7559393" } ] }, { "title": "Ubiquitin is covalently attached to the p6Gag proteins of human immunodeficiency virus type 1 and simian immunodeficiency virus and to the p12Gag protein of Moloney murine leukemia virus.", "journal": "Journal of virology", "date": "1998", "authors": "Ott DE, Coren LV, Copeland TD, Kane BP, Johnson DG, Sowder RC 2nd, Yoshinaka Y, Oroszlan S, Arthur LO, Henderson LE", "evidence": [ { "database": "Reactome", "id": "R-HSA-1169408", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408" } ], "reference": [ { "type": "PubMed", "id": "9525617", "url": "https://glygen.org/publication/PubMed/9525617" } ] }, { "title": "Cloning and characterization of 4EHP, a novel mammalian eIF4E-related cap-binding protein.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Rom E, Kim HC, Gingras AC, Marcotrigiano J, Favre D, Olsen H, Burley SK, Sonenberg N", "evidence": [ { "database": "UniProtKB", "id": "O60573", "url": "https://www.uniprot.org/uniprot/O60573" } ], "reference": [ { "type": "PubMed", "id": "9582349", "url": "https://glygen.org/publication/PubMed/9582349" } ] }, { "title": "Identification of genes expressed in human CD34(+) hematopoietic stem/progenitor cells by expressed sequence tags and efficient full-length cDNA cloning.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1998", "authors": "Mao M, Fu G, Wu J S, Zhang Q H, Zhou J, Kan L X, Huang Q H, He K L, Gu B W, Han Z G, Shen Y, Gu J, Yu Y P, Xu S H, Wang Y X, Chen S J, Chen Z", "evidence": [ { "database": "UniProtKB", "id": "O60573", "url": "https://www.uniprot.org/uniprot/O60573" } ], "reference": [ { "type": "PubMed", "id": "9653160", "url": "https://glygen.org/publication/PubMed/9653160" } ] } ], "pathway": [ { "id": "hsa:9470", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:9470", "resource": "KEGG Pathway" }, { "id": "R-HSA-1169408", "name": "ISG15 antiviral mechanism", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1169408", "resource": "Reactome", "description": "ISG15 antiviral mechanism" } ], "orthologs": [ { "uniprot_canonical_ac": "Q8BMB3-1", "protein_name": "Eukaryotic translation initiation factor 4E type 2", "gene_name": "Eif4e2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MNNKFDALKDDDSGDHDQNEENSTQKDGEKEKTDRDKSQSSGKRKAVVPGPAEHPLQYNYTFWYSRRTPGRPTSSQSYEQNIKQIGTFASVEQFWKFYSHMVRPGDLTGHSDFHLFKEGIKPMWEDDANKNGGKWIIRLRKGLASRCWENLILAMLGEQFMVGEEICGAVVSVRFQEDIISIWNKTASDQATTARIRDTLRRVLNLPPNTIMEYKTHTDSIKMPGRLGPQRLLFQNLWKPRLNVP", "length": 245 }, "evidence": [ { "id": "45926047", "url": "http://www.informatics.jax.org/homology/45926047", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 6, "go_terms": [ { "name": "RNA binding", "id": "GO:0003723", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003723", "evidence": [ { "database": "UniProtKB", "id": "O60573", "url": "https://www.uniprot.org/uniprot/O60573" } ], "pmid": "" }, { "name": "translation initiation factor activity", "id": "GO:0003743", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003743", "evidence": [ { "database": "UniProtKB", "id": "O60573", "url": "https://www.uniprot.org/uniprot/O60573" } ], "pmid": "" }, { "name": "ubiquitin protein ligase binding", "id": "GO:0031625", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031625", "evidence": [ { "database": "UniProtKB", "id": "O60573", "url": "https://www.uniprot.org/uniprot/O60573" } ], "pmid": "" }, { "name": "translation factor activity, RNA binding", "id": "GO:0008135", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008135", "evidence": [ { "database": "UniProtKB", "id": "O60573", "url": "https://www.uniprot.org/uniprot/O60573" } ], "pmid": "" }, { "name": "RNA 7-methylguanosine cap binding", "id": "GO:0000340", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000340", "evidence": [ { "database": "UniProtKB", "id": "O60573", "url": "https://www.uniprot.org/uniprot/O60573" } ], "pmid": "" }, { "name": "RNA cap binding", "id": "GO:0000339", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000339", "evidence": [ { "database": "UniProtKB", "id": "O60573", "url": "https://www.uniprot.org/uniprot/O60573" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 5, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "O60573", "url": "https://www.uniprot.org/uniprot/O60573" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "O60573", "url": "https://www.uniprot.org/uniprot/O60573" } ], "pmid": "" }, { "name": "P-body", "id": "GO:0000932", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000932", "evidence": [ { "database": "UniProtKB", "id": "O60573", "url": "https://www.uniprot.org/uniprot/O60573" } ], "pmid": "" }, { "name": "eukaryotic translation initiation factor 4F complex", "id": "GO:0016281", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016281", "evidence": [ { "database": "UniProtKB", "id": "O60573", "url": "https://www.uniprot.org/uniprot/O60573" } ], "pmid": "" }, { "name": "mRNA cap binding complex", "id": "GO:0005845", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005845", "evidence": [ { "database": "UniProtKB", "id": "O60573", "url": "https://www.uniprot.org/uniprot/O60573" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "rescue of stalled ribosome", "id": "GO:0072344", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072344", "evidence": [ { "database": "UniProtKB", "id": "O60573", "url": "https://www.uniprot.org/uniprot/O60573" } ], "pmid": "" }, { "name": "negative regulation of translation", "id": "GO:0017148", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0017148", "evidence": [ { "database": "UniProtKB", "id": "O60573", "url": "https://www.uniprot.org/uniprot/O60573" } ], "pmid": "" }, { "name": "negative regulation of translational initiation", "id": "GO:0045947", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045947", "evidence": [ { "database": "UniProtKB", "id": "O60573", "url": "https://www.uniprot.org/uniprot/O60573" } ], "pmid": "" }, { "name": "miRNA-mediated gene silencing by inhibition of translation", "id": "GO:0035278", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035278", "evidence": [ { "database": "UniProtKB", "id": "O60573", "url": "https://www.uniprot.org/uniprot/O60573" } ], "pmid": "" }, { "name": "negative regulation of type I interferon-mediated signaling pathway", "id": "GO:0060339", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060339", "evidence": [ { "database": "UniProtKB", "id": "O60573", "url": "https://www.uniprot.org/uniprot/O60573" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 184, "end_pos": 186, "annotation": "n_glycosylation_sequon" }, { "start_pos": 22, "end_pos": 24, "annotation": "n_glycosylation_sequon" }, { "start_pos": 38, "end_pos": 40, "annotation": "n_glycosylation_sequon" }, { "start_pos": 59, "end_pos": 61, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "ISGylation enhances its cap structure-binding activity and translation-inhibition activity.", "evidence": [ { "database": "UniProtKB", "id": "O60573", "url": "https://www.uniprot.org/uniprot/O60573" }, { "database": "PubMed", "id": "17289916", "url": "https://glygen.org/publication/PubMed/17289916" } ] }, { "annotation": "Ubiquitinated by ARIH1 (PubMed:14623119, PubMed:25624349). The consequences of ubiquitination are however unclear: according to a report, EIF4E2 ubiquitination leads to promote EIF4E2 cap-binding and protein translation arrest (PubMed:25624349). According to another report ubiquitination leads to its subsequent degradation (PubMed:14623119).", "evidence": [ { "database": "UniProtKB", "id": "O60573", "url": "https://www.uniprot.org/uniprot/O60573" }, { "database": "PubMed", "id": "14623119", "url": "https://glygen.org/publication/PubMed/14623119" }, { "database": "PubMed", "id": "25624349", "url": "https://glygen.org/publication/PubMed/25624349" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [ 13 ], "sequon_annotation_sites": [ { "start_pos": 184, "end_pos": 186 }, { "start_pos": 22, "end_pos": 24 }, { "start_pos": 38, "end_pos": 40 }, { "start_pos": 59, "end_pos": 61 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 55 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }