{ "uniprot_canonical_ac": "O60513-1", "uniprot_ac": "O60513", "uniprot_id": "B4GT4_HUMAN", "mass": { "chemical_mass": 40041.0, "monoisotopic_mass": 40041.0 }, "refseq": { "ac": "NP_003769", "name": "beta-1,4-galactosyltransferase 4", "summary": "This gene is one of seven beta-1,4-galactosyltransferase (beta4GalT) genes. They encode type II membrane-bound glycoproteins that appear to have exclusive specificity for the donor substrate UDP-galactose; all transfer galactose in a beta1,4 linkage to similar acceptor sugars: GlcNAc, Glc, and Xyl. Each beta4GalT has a distinct function in the biosynthesis of different glycoconjugates and saccharide structures. As type II membrane proteins, they have an N-terminal hydrophobic signal sequence that directs the protein to the Golgi apparatus and which then remains uncleaved to function as a transmembrane anchor. By sequence similarity, the beta4GalTs form four groups: beta4GalT1 and beta4GalT2, beta4GalT3 and beta4GalT4, beta4GalT5 and beta4GalT6, and beta4GalT7. The enzyme encoded by this gene appears to mainly play a role in glycolipid biosynthesis. Two alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003769" }, "gene_names": [ { "name": "B4GALT4", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O60513", "id": "O60513" }, { "name": "B4GALT4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003769", "id": "NP_003769" }, { "name": "B4Gal-T4; beta4Gal-T4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003769", "id": "NP_003769" }, { "name": "PRO1109", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O60513", "id": "O60513" } ], "protein_names": [ { "name": "Beta-1,4-galactosyltransferase 4", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O60513" }, { "name": "2.4.1.-", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O60513" }, { "name": "2.4.1.275", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O60513" }, { "name": "2.4.1.90", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O60513" }, { "name": "Beta-1,4-GalTase 4", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O60513" }, { "name": "Beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O60513" }, { "name": "Beta4Gal-T4", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O60513" }, { "name": "Lactotriaosylceramide beta-1,4-galactosyltransferase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O60513" }, { "name": "N-acetyllactosamine synthase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O60513" }, { "name": "Nal synthase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O60513" }, { "name": "UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 4", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O60513" }, { "name": "UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 4", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O60513" }, { "name": "b4Gal-T4", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O60513" }, { "name": "beta-1,4-galactosyltransferase 4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003769", "id": "NP_003769" }, { "name": "beta-N-acetylglucosaminyl-glycolipid beta-1,4-galactosyltransferase 4; UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase 4; beta-1,4-GalTase 4; UDP-Gal:beta-GlcNAc beta-1,4-galactosyltransferase 4; UDP-galactose:beta-N-acetylglucosamine beta-1,4-galactosyltransferase 4; nal synthase; UDP-Gal:betaGlcNAc beta 1,4- galactosyltransferase, polypeptide 4; N-acetyllactosamine synthase; lactotriaosylceramide beta-1,4-galactosyltransferase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003769", "id": "NP_003769" } ], "function": [ { "annotation": "Expression of the beta4GalT4 gene is controlled by Sp1, and Sp1 plays a key role in the activation of the beta4GalT4 gene in colon cancer cells.", "evidence": [ { "database": "RefSeq", "id": "NP_003769", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003769" }, { "database": "PubMed", "id": "28228616", "url": "https://glygen.org/publication/PubMed/28228616" } ] }, { "annotation": "Galactose (Gal) transferase involved in the synthesis of terminal N-acetyllactosamine (LacNac) unit present on glycan chains of glycoproteins and glycosphingolipids (PubMed:9792633, PubMed:17690104, PubMed:12511560, PubMed:32827291). Catalyzes the transfer of Gal residue via a beta1->4 linkage from UDP-Gal to the non-reducing terminal N-acetyl glucosamine 6-O-sulfate (6-O-sulfoGlcNAc) in the linearly growing chain of both N- and O-linked keratan sulfate proteoglycans. Cooperates with B3GNT7 N-acetyl glucosamine transferase and CHST6 and CHST1 sulfotransferases to construct and elongate mono-and disulfated disaccharide units [->3Galbeta1->4(6-sulfoGlcNAcbeta)1->] and [->3(6-sulfoGalbeta)1->4(6-sulfoGlcNAcbeta)1->] within keratan sulfate polymer (PubMed:17690104). Transfers Gal residue via a beta1->4 linkage to terminal 6-O-sulfoGlcNAc within the LacNac unit of core 2 O-glycans forming 6-sulfo-sialyl-Lewis X (sLex). May contribute to the generation of sLex epitope on mucin-type glycoproteins that serve as ligands for SELL/L-selectin, a major regulator of leukocyte migration (PubMed:12511560). In the biosynthesis pathway of neolacto-series glycosphingolipids, transfers Gal residue via a beta1->4 linkage to terminal GlcNAc of a lactotriaosylceramide (Lc3Cer) acceptor to form a neolactotetraosylceramide (PubMed:9792633).", "evidence": [ { "database": "UniProtKB", "id": "O60513", "url": "https://www.uniprot.org/uniprot/O60513#function" }, { "database": "PubMed", "id": "9792633", "url": "https://glygen.org/publication/PubMed/9792633" }, { "database": "PubMed", "id": "17690104", "url": "https://glygen.org/publication/PubMed/17690104" }, { "database": "PubMed", "id": "12511560", "url": "https://glygen.org/publication/PubMed/12511560" } ] }, { "annotation": "N-glycosylation of the human beta1,4-galactosyltransferase 4 is crucial for its activity and Golgi localization.", "evidence": [ { "database": "RefSeq", "id": "NP_003769", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003769" }, { "database": "PubMed", "id": "32827291", "url": "https://glygen.org/publication/PubMed/32827291" } ] }, { "annotation": "Responsible for the synthesis of complex-type N-linked oligosaccharides in many glycoproteins as well as the carbohydrate moieties of glycolipids.", "evidence": [ { "database": "UniProtKB", "id": "C9J3R8", "url": "https://www.uniprot.org/uniprot/C9J3R8#function" }, { "database": "UniProtKB", "id": "RU368121", "url": "https://www.uniprot.org/uniprot/RU368121#function" } ] }, { "annotation": "The critical role of B4GALT4 in promoting microtubule spindle assembly in HCC through the regulation of PLK1 and RHAMM expression.", "evidence": [ { "database": "RefSeq", "id": "NP_003769", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003769" }, { "database": "PubMed", "id": "34270095", "url": "https://glygen.org/publication/PubMed/34270095" } ] }, { "annotation": "This gene is one of seven beta-1,4-galactosyltransferase (beta4GalT) genes. They encode type II membrane-bound glycoproteins that appear to have exclusive specificity for the donor substrate UDP-galactose; all transfer galactose in a beta1,4 linkage to similar acceptor sugars: GlcNAc, Glc, and Xyl. Each beta4GalT has a distinct function in the biosynthesis of different glycoconjugates and saccharide structures. As type II membrane proteins, they have an N-terminal hydrophobic signal sequence that directs the protein to the Golgi apparatus and which then remains uncleaved to function as a transmembrane anchor. By sequence similarity, the beta4GalTs form four groups: beta4GalT1 and beta4GalT2, beta4GalT3 and beta4GalT4, beta4GalT5 and beta4GalT6, and beta4GalT7. The enzyme encoded by this gene appears to mainly play a role in glycolipid biosynthesis. Two alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_003769", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003769" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs1268054787", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1268054787" }, { "id": "rs1268054787", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1268054787" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 220, "end_pos": 220, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NST->KST).", "chr_id": "3", "chr_pos": "119224072", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N220", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1032269159", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1032269159" }, { "id": "rs1032269159", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1032269159#frequency_tab" }, { "id": "rs1032269159", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1032269159" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 254, "end_pos": 254, "sequence_org": "W", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NYW->NYS).", "chr_id": "3", "chr_pos": "119218686", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "W254", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1234640030", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1234640030" }, { "id": "rs1234640030", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1234640030" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 335, "end_pos": 335, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->KIT).", "chr_id": "3", "chr_pos": "119212579", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N335", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs772093606", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772093606" }, { "id": "rs772093606", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs772093606" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 335, "end_pos": 335, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->SIT).", "chr_id": "3", "chr_pos": "119212580", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N335", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O60513", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O60513" }, { "id": "rs1413926933", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1413926933" }, { "id": "rs1413926933", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1413926933" }, { "id": "rs1413926933", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1413926933" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 69, "end_pos": 69, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "M", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (T->M).", "chr_id": "3", "chr_pos": "119229894", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "T69", "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] } ], "mutagenesis": [ { "start_pos": 222, "end_pos": 222, "sequence_org": "T", "sequence_mut": "A", "comment": "Has no impact on localization to the Golgi apparatus. Decreases N-glycosylation. Impairs the catalytic activity. Impairs keratan sulfate biosynthesis; when associated with A-337.", "evidence": [ { "database": "UniProtKB", "id": "O60513", "url": "https://www.uniprot.org/uniprot/O60513" }, { "database": "PubMed", "id": "32827291", "url": "https://glygen.org/publication/PubMed/32827291" } ] }, { "start_pos": 337, "end_pos": 337, "sequence_org": "T", "sequence_mut": "A", "comment": "Impairs localization to the Golgi apparatus. Abolishes N-glycosylation. Impairs the interaction with SLC35A/UGT1. Impairs the catalytic activity. Impairs keratan sulfate biosynthesis; when associated with A-222.", "evidence": [ { "database": "UniProtKB", "id": "O60513", "url": "https://www.uniprot.org/uniprot/O60513" }, { "database": "PubMed", "id": "32827291", "url": "https://glygen.org/publication/PubMed/32827291" } ] }, { "start_pos": 6, "end_pos": 6, "sequence_org": "T", "sequence_mut": "A", "comment": "Has no impact on N-glycosylation.", "evidence": [ { "database": "UniProtKB", "id": "O60513", "url": "https://www.uniprot.org/uniprot/O60513" }, { "database": "PubMed", "id": "32827291", "url": "https://glygen.org/publication/PubMed/32827291" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "81.63", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000121578", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000121578" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "82.21", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000121578", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000121578" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "87.6", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000121578", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000121578" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "95.32", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000121578", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000121578" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "85.13", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000121578", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000121578" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "93.67", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000121578", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000121578" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "87.59", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000121578", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000121578" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "86.11", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000121578", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000121578" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "83.74", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000121578", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000121578" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "77.51", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000121578", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000121578" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "85.54", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000121578", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000121578" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "86.5", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000121578", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000121578" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "82.26", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000121578", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000121578" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O60513", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60513" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O60513", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60513" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O60513", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60513" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O60513", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60513" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O60513", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60513" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O60513", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60513" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O60513", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60513" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O60513", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60513" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O60513", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60513" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O60513", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60513" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O60513", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60513" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O60513", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60513" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O60513", "url": "https://www.uniprot.org/uniprot/O60513" } ], "common_name": "Human" } ], "gene": [ { "name": "B4GALT4", "url": "https://www.uniprot.org/uniprot/O60513", "locus": { "chromosome": "3", "start_pos": 119211732, "end_pos": 119240946, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000121578", "url": "https://www.ensembl.org/id/ENSG00000121578" } ] } } ], "crossref": [ { "id": "ENSG00000121578", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000121578", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "O60513", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O60513", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "2.4.1.275", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.4.1.275&UniProtAcc=O60513", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "GT7", "url": "http://www.cazy.org/GT7.html", "database": "CAZy", "categories": [ "Protein Classification" ] }, { "id": "cd00899", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00899", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "B4GALT4", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=B4GALT4", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "8702", "url": "https://www.ncbi.nlm.nih.gov/gene/8702", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "927", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=927", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O60513", "url": "https://www.ebi.ac.uk/intact/interactors/id:O60513*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR003859", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003859", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR027791", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027791", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR027995", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027995", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029044", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029044", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:8702", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:8702", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "604015", "url": "http://www.omim.org/entry/604015", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O60513", "url": "https://www.nextprot.org/entry/NX_O60513", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "QVWRKDG", "url": "https://omabrowser.org/oma/group/QVWRKDG/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "306273at2759", "url": "http://www.orthodb.org/?query=306273at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR19300", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR19300", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR19300:SF9", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR19300:SF9", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF02709", "url": "http://pfam.xfam.org/family/PF02709", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF13733", "url": "http://pfam.xfam.org/family/PF13733", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O60513", "url": "https://pharos.nih.gov/targets/O60513", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR:000050789", "url": "https://proconsortium.org/app/entry/PR:000050789", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR_O60513", "url": "http://purl.obolibrary.org/obo/PR_O60513", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-2022854", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022854", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-975577", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975577", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_003769", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003769", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "17745", "url": "https://www.rhea-db.org/rhea/17745", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "31499", "url": "https://www.rhea-db.org/rhea/31499", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "67872", "url": "https://www.rhea-db.org/rhea/67872", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "67948", "url": "https://www.rhea-db.org/rhea/67948", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "O60513", "url": "DISABLED", "database": "UniCarbKB", "categories": [ "Glycoproteomics" ] }, { "id": "C9J3R8", "url": "https://www.uniprot.org/uniprot/C9J3R8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9J3R8-1", "url": "https://www.uniprot.org/uniprot/C9J3R8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9J4S5", "url": "https://www.uniprot.org/uniprot/C9J4S5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9J4S5-1", "url": "https://www.uniprot.org/uniprot/C9J4S5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9J5S0", "url": "https://www.uniprot.org/uniprot/C9J5S0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9J5S0-1", "url": "https://www.uniprot.org/uniprot/C9J5S0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9J644", "url": "https://www.uniprot.org/uniprot/C9J644", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9J644-1", "url": "https://www.uniprot.org/uniprot/C9J644-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9JA31", "url": "https://www.uniprot.org/uniprot/C9JA31", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9JA31-1", "url": "https://www.uniprot.org/uniprot/C9JA31-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9JE00", "url": "https://www.uniprot.org/uniprot/C9JE00", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9JE00-1", "url": "https://www.uniprot.org/uniprot/C9JE00-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9JY35", "url": "https://www.uniprot.org/uniprot/C9JY35", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9JY35-1", "url": "https://www.uniprot.org/uniprot/C9JY35-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9JY38", "url": "https://www.uniprot.org/uniprot/C9JY38", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9JY38-1", "url": "https://www.uniprot.org/uniprot/C9JY38-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E7ETS9", "url": "https://www.uniprot.org/uniprot/E7ETS9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E7ETS9-1", "url": "https://www.uniprot.org/uniprot/E7ETS9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O60513", "url": "https://www.uniprot.org/uniprot/O60513", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O60513-1", "url": "https://www.uniprot.org/uniprot/O60513-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MGFNLTFHLSYKFRLLLLLTLCLTVVGWATSNYFVGAIQEIPKAKEFMANFHKTLILGKGKTLTNEASTKKVELDNCPSVSPYLRGQSKLIFKPDLTLEEVQAENPKVSRGRYRPQECKALQRVAILVPHRNREKHLMYLLEHLHPFLQRQQLDYGIYVIHQAEGKKFNRAKLLNVGYLEALKEENWDCFIFHDVDLVPENDFNLYKCEEHPKHLVVGRNSTGYRLRYSGYFGGVTALSREQFFKVNGFSNNYWGWGGEDDDLRLRVELQRMKISRPLPEVGKYTMVFHTRDKGNEVNAERMKLLHQVSRVWRTDGLSSCSYKLVSVEHNPLYINITVDFWFGA", "length": 344, "header": "sp|O60513-1|B4GT4_HUMAN Isoform 1 of Beta-1,4-galactosyltransferase 4 OS=Homo sapiens OX=9606 GN=B4GALT4 PE=1 SV=1 CANONICAL=O60513-1" }, "isoforms": [ { "isoform_ac": "C9J3R8-1", "url": "", "sequence": { "sequence": "MGFNLTFHLSYKFRLLLLLTLCLTVVGWATSNYFVGAIQEIPKAKEFMANFHKTLILGKGKTLTNEASTKKVELDNCPSVSPYLRGQSKLIFKPDLTLEEVQAENPKVSRGRYRPQECKALQRVAILVPHRNREKHLMYLLEHLHPFLQRQQLDYGIYVIHQAEGKKFNRAKLLNVGYLEALKEENWDCFIFHDVDLVPENDFNLYKCEEHPKHLVVGRNSTGYRLRYSGYFGGVTALSREQFFKVNGFSNNYWGWGGEDDDLRLRVELQRMKISRPLPEVGKYTMVFHTRDKGNEVNAER", "length": 301, "header": "tr|C9J3R8-1|C9J3R8_HUMAN Computationally mapped isoform of Beta-1,4-galactosyltransferase OS=Homo sapiens OX=9606 GN=B4GALT4 PE=1 SV=1 CANONICAL=O60513-1" }, "locus": { "chromosome": "3", "start_pos": 119230099, "end_pos": 119216239, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000467604.5", "url": "https://www.ensembl.org/id/ENST00000467604.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000417226.1", "url": "https://www.ensembl.org/id/ENSP00000417226.1" } ] } }, { "isoform_ac": "C9J4S5-1", "url": "", "sequence": { "sequence": "MGFNLTFHLSYKFRLLLLLTLCLTVVGWATSNYFVGAIQEIPKAKEFMANFHKTLILGKGKTLTNEASTKKVELDNCPSVSPYLRGQSKLIFKPDLTLEEVQAENPKVSRGRYRPQECKALQRVAILVPHRNREKH", "length": 136, "header": "tr|C9J4S5-1|B4GT4_HUMAN Computationally mapped isoform of Beta-1,4-galactosyltransferase 4 OS=Homo sapiens OX=9606 GN=B4GALT4 PE=1 SV=1 CANONICAL=O60513-1" }, "locus": { "chromosome": "3", "start_pos": 119230099, "end_pos": 119226887, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000475803.5", "url": "https://www.ensembl.org/id/ENST00000475803.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000417188.1", "url": "https://www.ensembl.org/id/ENSP00000417188.1" } ] } }, { "isoform_ac": "C9J5S0-1", "url": "", "sequence": { "sequence": "MGFNLTFHLSYKFRLLLLLTLCLTVVGWATSNYFVGAIQEIPKAKEFMANFHKTLILGKGKTLTNEASTKKVELDNCPSVSPYLRGQSKLIFKPDLTLEEVQAENPKVSRGRYRPQEC", "length": 118, "header": "tr|C9J5S0-1|B4GT4_HUMAN Computationally mapped isoform of Beta-1,4-galactosyltransferase 4 OS=Homo sapiens OX=9606 GN=B4GALT4 PE=1 SV=1 CANONICAL=O60513-1" }, "locus": { "chromosome": "3", "start_pos": 119230099, "end_pos": 119226941, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000479150.5", "url": "https://www.ensembl.org/id/ENST00000479150.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000417958.1", "url": "https://www.ensembl.org/id/ENSP00000417958.1" } ] } }, { "isoform_ac": "C9J644-1", "url": "", "sequence": { "sequence": "MGFNLTFHLSYKFRLLLLLTLCLTVVGWATSNYFVGAIQEI", "length": 41, "header": "tr|C9J644-1|C9J644_HUMAN Computationally mapped isoform of Beta-1,4-galactosyltransferase 4 OS=Homo sapiens OX=9606 GN=B4GALT4 PE=4 SV=8 CANONICAL=O60513-1" }, "locus": { "chromosome": "3", "start_pos": 119230099, "end_pos": 119229977, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000493932.5", "url": "https://www.ensembl.org/id/ENST00000493932.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000418436.1", "url": "https://www.ensembl.org/id/ENSP00000418436.1" } ] } }, { "isoform_ac": "C9JA31-1", "url": "", "sequence": { "sequence": "MANFHKTLILGKGKTLTNEASTKKVELDNCPSVSPYLRGQSKLIFKPDLTLEEVQEIRLLNV", "length": 62, "header": "tr|C9JA31-1|C9JA31_HUMAN Computationally mapped isoform of Beta-1,4-galactosyltransferase 4 OS=Homo sapiens OX=9606 GN=B4GALT4 PE=1 SV=1 CANONICAL=O60513-1" }, "locus": { "chromosome": "3", "start_pos": 119229958, "end_pos": 119212173, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000471675.1", "url": "https://www.ensembl.org/id/ENST00000471675.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000417527.1", "url": "https://www.ensembl.org/id/ENSP00000417527.1" } ] } }, { "isoform_ac": "C9JE00-1", "url": "", "sequence": { "sequence": "MGFNLTFHLSYKFRLLLLLTLCLTVVGWATSNYFVGAIQEIPKAKEFMANFHKT", "length": 54, "header": "tr|C9JE00-1|B4GT4_HUMAN Computationally mapped isoform of Beta-1,4-galactosyltransferase 4 OS=Homo sapiens OX=9606 GN=B4GALT4 PE=1 SV=8 CANONICAL=O60513-1" }, "locus": { "chromosome": "3", "start_pos": 119230099, "end_pos": 119229938, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000470111.5", "url": "https://www.ensembl.org/id/ENST00000470111.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000420535.1", "url": "https://www.ensembl.org/id/ENSP00000420535.1" } ] } }, { "isoform_ac": "C9JY35-1", "url": "", "sequence": { "sequence": "MYLLEHLHPFLQRQQLDYGIYVIHQ", "length": 25, "header": "tr|C9JY35-1|C9JY35_HUMAN Computationally mapped isoform of Beta-1,4-galactosyltransferase 4 OS=Homo sapiens OX=9606 GN=B4GALT4 PE=1 SV=1 CANONICAL=O60513-1" }, "locus": { "chromosome": "3", "start_pos": 119226883, "end_pos": 119226809, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000491906.5", "url": "https://www.ensembl.org/id/ENST00000491906.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000419919.1", "url": "https://www.ensembl.org/id/ENSP00000419919.1" } ] } }, { "isoform_ac": "C9JY38-1", "url": "", "sequence": { "sequence": "MGFNLTFHLSYKFRLLLLLTL", "length": 21, "header": "tr|C9JY38-1|C9JY38_HUMAN Computationally mapped isoform of Beta-1,4-galactosyltransferase 4 OS=Homo sapiens OX=9606 GN=B4GALT4 PE=4 SV=1 CANONICAL=O60513-1" }, "locus": { "chromosome": "3", "start_pos": 119230099, "end_pos": 119230037, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000473887.5", "url": "https://www.ensembl.org/id/ENST00000473887.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000419916.1", "url": "https://www.ensembl.org/id/ENSP00000419916.1" } ] } }, { "isoform_ac": "E7ETS9-1", "url": "", "sequence": { "sequence": "MGFNLTFHLSYKFRLLLLLTLCLTVVGWATSNYFVGAIQEIPKAKEFMANFHKTLILGKGKTLTNEASTKKVELDNCPSVSPYLRGQSKLIFKPDLTLEEVQAENPKVSRGRYRPQECKALQRVAILVPHRNREKHLMYLLEHLHPFLQRQQLDYGIYVIHQAEGKKFNRAKLLNVGYLEALKEENWDCFIFHDVDLVPENDFNLYKCEEHPKHLVVGRNSTGYRLRYSGYFGGVTALSREQFFKG", "length": 246, "header": "tr|E7ETS9-1|B4GT4_HUMAN Computationally mapped isoform of Beta-1,4-galactosyltransferase 4 OS=Homo sapiens OX=9606 GN=B4GALT4 PE=1 SV=1 CANONICAL=O60513-1" }, "locus": { "chromosome": "3", "start_pos": 119230099, "end_pos": 119216342, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000480814.5", "url": "https://www.ensembl.org/id/ENST00000480814.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000420665.1", "url": "https://www.ensembl.org/id/ENSP00000420665.1" } ] } }, { "isoform_ac": "O60513-1", "url": "", "sequence": { "sequence": "MGFNLTFHLSYKFRLLLLLTLCLTVVGWATSNYFVGAIQEIPKAKEFMANFHKTLILGKGKTLTNEASTKKVELDNCPSVSPYLRGQSKLIFKPDLTLEEVQAENPKVSRGRYRPQECKALQRVAILVPHRNREKHLMYLLEHLHPFLQRQQLDYGIYVIHQAEGKKFNRAKLLNVGYLEALKEENWDCFIFHDVDLVPENDFNLYKCEEHPKHLVVGRNSTGYRLRYSGYFGGVTALSREQFFKVNGFSNNYWGWGGEDDDLRLRVELQRMKISRPLPEVGKYTMVFHTRDKGNEVNAERMKLLHQVSRVWRTDGLSSCSYKLVSVEHNPLYINITVDFWFGA", "length": 344, "header": "sp|O60513-1|B4GT4_HUMAN Isoform 1 of Beta-1,4-galactosyltransferase 4 OS=Homo sapiens OX=9606 GN=B4GALT4 PE=1 SV=1 CANONICAL=O60513-1" }, "locus": { "chromosome": "3", "start_pos": 119230099, "end_pos": 119212552, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000359213.7", "url": "https://www.ensembl.org/id/ENST00000359213.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000352144.3", "url": "https://www.ensembl.org/id/ENSP00000352144.3" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 220, "start_aa": "Asn", "end_pos": 220, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn220", "evidence": [ { "id": "O60513", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60513#ptm_processing" }, { "id": "32827291", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32827291" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 335, "start_aa": "Asn", "end_pos": 335, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn335", "evidence": [ { "id": "O60513", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60513#ptm_processing" }, { "id": "32827291", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32827291" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "TLTNEASTK", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 62, "start_aa": "Thr", "end_pos": 70, "end_aa": "Lys", "evidence": [ { "id": "O60513", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 69, "start_aa": "Thr", "end_pos": 69, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr69", "evidence": [ { "id": "O60513", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme", "glycosyltransferase-activity", "glycoprotein", "glycoprotein_reported_with_glycan", "glycoprotein_reported" ], "publication": [ { "title": "Precision mapping of the human O-GalNAc glycoproteome through SimpleCell technology", "journal": "EMBO J", "date": "2013", "authors": "Steentoft C., Vakhrushev S.Y., Joshi H.J., Kong Y., Vester-Christensen M.B., Schjoldager K.T., Lavrsen K., Dabelsteen S., Pedersen N.B., Marcos-Silva L., Gupta R., Bennett E.P., Mandel U., Brunak S., Wandall H.H., Levery S.B., Clausen H.", "evidence": [ { "database": "UniCarbKB", "id": "O60513", "url": "" } ], "reference": [ { "type": "DOI", "id": "10.1038/emboj.2013.79", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "title": "Molecular cloning of a novel alpha2,3-sialyltransferase (ST3Gal VI) that sialylates type II lactosamine structures on glycoproteins and glycolipids.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Okajima T, Fukumoto S, Miyazaki H, Ishida H, Kiso M, Furukawa K, Urano T, Furukawa K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022854", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022854" } ], "reference": [ { "type": "PubMed", "id": "10206952", "url": "https://glygen.org/publication/PubMed/10206952" } ] }, { "title": "Characterization of UDP-N-acetylglucosamine:alpha-6-d-mannoside beta-1,6-N-acetylglucosaminyltransferase V from a human hepatoma cell line Hep3B.", "journal": "Archives of biochemistry and biophysics", "date": "1999", "authors": "Park C, Jin UH, Lee YC, Cho TJ, Kim CH", "evidence": [ { "database": "Reactome", "id": "R-HSA-975577", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975577" } ], "reference": [ { "type": "PubMed", "id": "10395745", "url": "https://glygen.org/publication/PubMed/10395745" } ] }, { "title": "Cloning and characterization of a mammalian N-acetylglucosamine-6-sulfotransferase that is highly restricted to intestinal tissue.", "journal": "Biochemical and biophysical research communications", "date": "1999", "authors": "Lee JK, Bhakta S, Rosen SD, Hemmerich S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022854", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022854" } ], "reference": [ { "type": "PubMed", "id": "10491328", "url": "https://glygen.org/publication/PubMed/10491328" } ] }, { "title": "Molecular cloning and expression of Galbeta1,3GalNAc alpha2, 3-sialyltransferase from human fetal liver.", "journal": "European journal of biochemistry", "date": "1999", "authors": "Shang J, Qiu R, Wang J, Liu J, Zhou R, Ding H, Yang S, Zhang S, Jin C", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022854", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022854" } ], "reference": [ { "type": "PubMed", "id": "10504389", "url": "https://glygen.org/publication/PubMed/10504389" } ] }, { "title": "Cloning and characterization of the human UDP-N-acetylglucosamine: alpha-1,3-D-mannoside beta-1,4-N-acetylglucosaminyltransferase IV-homologue (hGnT-IV-H) gene.", "journal": "Journal of human genetics", "date": "1999", "authors": "Furukawa T, Youssef EM, Yatsuoka T, Yokoyama T, Makino N, Inoue H, Fukushige S, Hoshi M, Hayashi Y, Sunamura M, Horii A", "evidence": [ { "database": "Reactome", "id": "R-HSA-975577", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975577" } ], "reference": [ { "type": "PubMed", "id": "10570912", "url": "https://glygen.org/publication/PubMed/10570912" } ] }, { "title": "Identification and characterization of large galactosyltransferase gene families: galactosyltransferases for all functions.", "journal": "Biochim. Biophys. Acta", "date": "1999", "authors": "Amado M, Almeida R, Schwientek T, Clausen H", "evidence": [ { "database": "UniProtKB", "id": "O60513", "url": "https://www.uniprot.org/uniprot/O60513" } ], "reference": [ { "type": "PubMed", "id": "10580128", "url": "https://glygen.org/publication/PubMed/10580128" } ] }, { "title": "Suppression of tumor growth and metastasis in Mgat5-deficient mice.", "journal": "Nature medicine", "date": "2000", "authors": "Granovsky M, Fata J, Pawling J, Muller WJ, Khokha R, Dennis JW", "evidence": [ { "database": "Reactome", "id": "R-HSA-975577", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975577" } ], "reference": [ { "type": "PubMed", "id": "10700233", "url": "https://glygen.org/publication/PubMed/10700233" } ] }, { "title": "Differential biosynthesis of polysialic acid on neural cell adhesion molecule (NCAM) and oligosaccharide acceptors by three distinct alpha 2,8-sialyltransferases, ST8Sia IV (PST), ST8Sia II (STX), and ST8Sia III.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Angata K, Suzuki M, McAuliffe J, Ding Y, Hindsgaul O, Fukuda M", "evidence": [ { "database": "Reactome", "id": "R-HSA-975577", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975577" } ], "reference": [ { "type": "PubMed", "id": "10766765", "url": "https://glygen.org/publication/PubMed/10766765" } ] }, { "title": "Keratan sulfate: structure, biosynthesis, and function.", "journal": "Glycobiology", "date": "2000", "authors": "Funderburgh JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022854", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022854" } ], "reference": [ { "type": "PubMed", "id": "11030741", "url": "https://glygen.org/publication/PubMed/11030741" } ] }, { "title": "Identification and characterization of three novel beta 1,3-N-acetylglucosaminyltransferases structurally related to the beta 1,3-galactosyltransferase family.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Shiraishi N, Natsume A, Togayachi A, Endo T, Akashima T, Yamada Y, Imai N, Nakagawa S, Koizumi S, Sekine S, Narimatsu H, Sasaki K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022854", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022854" } ], "reference": [ { "type": "PubMed", "id": "11042166", "url": "https://glygen.org/publication/PubMed/11042166" } ] }, { "title": "Functional expression and genomic structure of human N-acetylglucosamine-6-O-sulfotransferase that transfers sulfate to beta-N-acetylglucosamine at the nonreducing end of an N-acetyllactosamine sequence.", "journal": "Biochimica et biophysica acta", "date": "2000", "authors": "Sakaguchi H, Kitagawa H, Sugahara K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022854", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022854" } ], "reference": [ { "type": "PubMed", "id": "11042394", "url": "https://glygen.org/publication/PubMed/11042394" } ] }, { "title": "Molecular cloning and characterization of UDP-GlcNAc:lactosylceramide beta 1,3-N-acetylglucosaminyltransferase (beta 3Gn-T5), an essential enzyme for the expression of HNK-1 and Lewis X epitopes on glycolipids.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Togayachi A, Akashima T, Ookubo R, Kudo T, Nishihara S, Iwasaki H, Natsume A, Mio H, Inokuchi J, Irimura T, Sasaki K, Narimatsu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022854", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022854" } ], "reference": [ { "type": "PubMed", "id": "11283017", "url": "https://glygen.org/publication/PubMed/11283017" } ] }, { "title": "Achievements and challenges of sialic acid research.", "journal": "Glycoconjugate journal", "date": "2000", "authors": "Schauer R", "evidence": [ { "database": "Reactome", "id": "R-HSA-975577", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975577" } ], "reference": [ { "type": "PubMed", "id": "11421344", "url": "https://glygen.org/publication/PubMed/11421344" } ] }, { "title": "The sialyl-alpha2,6-lactosaminyl-structure: biosynthesis and functional role.", "journal": "Glycoconjugate journal", "date": "2000", "authors": "Dall'Olio F", "evidence": [ { "database": "Reactome", "id": "R-HSA-975577", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975577" } ], "reference": [ { "type": "PubMed", "id": "11425186", "url": "https://glygen.org/publication/PubMed/11425186" } ] }, { "title": "The human sialyltransferase family.", "journal": "Biochimie", "date": "2001", "authors": "Harduin-Lepers A, Vallejo-Ruiz V, Krzewinski-Recchi MA, Samyn-Petit B, Julien S, Delannoy P", "evidence": [ { "database": "Reactome", "id": "R-HSA-975577", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975577" } ], "reference": [ { "type": "PubMed", "id": "11530204", "url": "https://glygen.org/publication/PubMed/11530204" } ] }, { "title": "Galactosylation of N-linked oligosaccharides by human beta-1,4-galactosyltransferases I, II, III, IV, V, and VI expressed in Sf-9 cells.", "journal": "Glycobiology", "date": "2001", "authors": "Guo S, Sato T, Shirane K, Furukawa K", "evidence": [ { "database": "UniProtKB", "id": "O60513", "url": "https://www.uniprot.org/uniprot/O60513" }, { "database": "Reactome", "id": "R-HSA-975577", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975577" } ], "reference": [ { "type": "PubMed", "id": "11588157", "url": "https://glygen.org/publication/PubMed/11588157" } ] }, { "title": "Molecular cloning and characterization of a novel UDP-GlcNAc:GalNAc-peptide beta1,3-N-acetylglucosaminyltransferase (beta 3Gn-T6), an enzyme synthesizing the core 3 structure of O-glycans.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Iwai T, Inaba N, Naundorf A, Zhang Y, Gotoh M, Iwasaki H, Kudo T, Togayachi A, Ishizuka Y, Nakanishi H, Narimatsu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022854", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022854" } ], "reference": [ { "type": "PubMed", "id": "11821425", "url": "https://glygen.org/publication/PubMed/11821425" } ] }, { "title": "Deficiency of UDP-galactose:N-acetylglucosamine beta-1,4-galactosyltransferase I causes the congenital disorder of glycosylation type IId.", "journal": "The Journal of clinical investigation", "date": "2002", "authors": "Hansske B, Thiel C, Lubke T, Hasilik M, Honing S, Peters V, Heidemann PH, Hoffmann GF, Berger EG, von Figura K, Korner C", "evidence": [ { "database": "Reactome", "id": "R-HSA-975577", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975577" } ], "reference": [ { "type": "PubMed", "id": "11901181", "url": "https://glygen.org/publication/PubMed/11901181" } ] }, { "title": "Sialyltransferase ST3Gal-IV operates as a dominant modifier of hemostasis by concealing asialoglycoprotein receptor ligands.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Ellies LG, Ditto D, Levy GG, Wahrenbrock M, Ginsburg D, Varki A, Le DT, Marth JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-975577", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975577" } ], "reference": [ { "type": "PubMed", "id": "12097641", "url": "https://glygen.org/publication/PubMed/12097641" } ] }, { "title": "Enzymatic synthesis in vitro of the disulfated disaccharide unit of corneal keratan sulfate.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Akama TO, Misra AK, Hindsgaul O, Fukuda MN", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022854", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022854" } ], "reference": [ { "type": "PubMed", "id": "12218059", "url": "https://glygen.org/publication/PubMed/12218059" } ] }, { "title": "Beta 1,4-galactosyltransferase (beta 4GalT)-IV is specific for GlcNAc 6-O-sulfate. Beta 4GalT-IV acts on keratan sulfate-related glycans and a precursor glycan of 6-sulfosialyl-Lewis X.", "journal": "The Journal of biological chemistry", "date": "2003-03-14", "authors": "Seko Akira, Dohmae Naoshi, Takio Koji, Yamashita Katsuko", "evidence": [ { "database": "UniProtKB", "id": "O60513", "url": "https://www.uniprot.org/uniprot/O60513" } ], "reference": [ { "type": "PubMed", "id": "12511560", "url": "https://glygen.org/publication/PubMed/12511560" } ] }, { "title": "Identification and functional expression of a second human beta-galactoside alpha2,6-sialyltransferase, ST6Gal II.", "journal": "European journal of biochemistry", "date": "2003", "authors": "Krzewinski-Recchi MA, Julien S, Juliant S, Teintenier-Lelievre M, Samyn-Petit B, Montiel MD, Mir AM, Cerutti M, Harduin-Lepers A, Delannoy P", "evidence": [ { "database": "Reactome", "id": "R-HSA-975577", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975577" } ], "reference": [ { "type": "PubMed", "id": "12603328", "url": "https://glygen.org/publication/PubMed/12603328" } ] }, { "title": "Polysialyltransferases: major players in polysialic acid synthesis on the neural cell adhesion molecule.", "journal": "Biochimie", "date": "2003", "authors": "Angata K, Fukuda M", "evidence": [ { "database": "Reactome", "id": "R-HSA-975577", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975577" } ], "reference": [ { "type": "PubMed", "id": "12765789", "url": "https://glygen.org/publication/PubMed/12765789" } ] }, { "title": "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.", "journal": "Genome Res.", "date": "2003", "authors": "Clark HF, Gurney AL, Abaya E, Baker K, Baldwin D, Brush J, Chen J, Chow B, Chui C, Crowley C, Currell B, Deuel B, Dowd P, Eaton D, Foster J, Grimaldi C, Gu Q, Hass PE, Heldens S, Huang A, Kim HS, Klimowski L, Jin Y, Johnson S, Lee J, Lewis L, Liao D, Mark M, Robbie E, Sanchez C, Schoenfeld J, Seshagiri S, Simmons L, Singh J, Smith V, Stinson J, Vagts A, Vandlen R, Watanabe C, Wieand D, Woods K, Xie MH, Yansura D, Yi S, Yu G, Yuan J, Zhang M, Zhang Z, Goddard A, Wood WI, Godowski P, Gray A", "evidence": [ { "database": "UniProtKB", "id": "O60513", "url": "https://www.uniprot.org/uniprot/O60513" } ], "reference": [ { "type": "PubMed", "id": "12975309", "url": "https://glygen.org/publication/PubMed/12975309" } ] }, { "title": "Cloning and tissue distribution of the human B3GALT7 gene, a member of the beta1,3-Glycosyltransferase family.", "journal": "Glycoconjugate journal", "date": "2004", "authors": "Huang C, Zhou J, Wu S, Shan Y, Teng S, Yu L", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022854", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022854" } ], "reference": [ { "type": "PubMed", "id": "15486459", "url": "https://glygen.org/publication/PubMed/15486459" } ] }, { "title": "Characterization of a cDNA encoding a protein with limited similarity to beta1, 3-N-acetylglucosaminyltransferase.", "journal": "Molecular biology reports", "date": "2004", "authors": "Zheng H, Li Y, Ji C, Li J, Zhang J, Yin G, Xu J, Ye X, Wu M, Zou X, Gu S, Xie Y, Mao Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022854", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022854" } ], "reference": [ { "type": "PubMed", "id": "15560372", "url": "https://glygen.org/publication/PubMed/15560372" } ] }, { "title": "A novel beta1,3-N-acetylglucosaminyltransferase (beta3Gn-T8), which synthesizes poly-N-acetyllactosamine, is dramatically upregulated in colon cancer.", "journal": "FEBS letters", "date": "2005", "authors": "Ishida H, Togayachi A, Sakai T, Iwai T, Hiruma T, Sato T, Okubo R, Inaba N, Kudo T, Gotoh M, Shoda J, Tanaka N, Narimatsu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022854", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022854" } ], "reference": [ { "type": "PubMed", "id": "15620693", "url": "https://glygen.org/publication/PubMed/15620693" } ] }, { "title": "beta4GalT-II is a key regulator of glycosylation of the proteins involved in neuronal development.", "journal": "Biochemical and biophysical research communications", "date": "2005", "authors": "Sasaki N, Manya H, Okubo R, Kobayashi K, Ishida H, Toda T, Endo T, Nishihara S", "evidence": [ { "database": "Reactome", "id": "R-HSA-975577", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975577" } ], "reference": [ { "type": "PubMed", "id": "15939404", "url": "https://glygen.org/publication/PubMed/15939404" } ] }, { "title": "Aberrant expression of N-acetylglucosaminyltransferase-IVa and IVb (GnT-IVa and b) in pancreatic cancer.", "journal": "Biochemical and biophysical research communications", "date": "2006", "authors": "Ide Y, Miyoshi E, Nakagawa T, Gu J, Tanemura M, Nishida T, Ito T, Yamamoto H, Kozutsumi Y, Taniguchi N", "evidence": [ { "database": "Reactome", "id": "R-HSA-975577", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975577" } ], "reference": [ { "type": "PubMed", "id": "16434023", "url": "https://glygen.org/publication/PubMed/16434023" } ] }, { "title": "Increase in beta1-6 GlcNAc branching caused by N-acetylglucosaminyltransferase V directs integrin beta1 stability in human hepatocellular carcinoma cell line SMMC-7721.", "journal": "Journal of cellular biochemistry", "date": "2007", "authors": "Wang L, Liang Y, Li Z, Cai X, Zhang W, Wu G, Jin J, Fang Z, Yang Y, Zha X", "evidence": [ { "database": "Reactome", "id": "R-HSA-975577", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975577" } ], "reference": [ { "type": "PubMed", "id": "16924681", "url": "https://glygen.org/publication/PubMed/16924681" } ] }, { "title": "Kinetic properties and substrate specificities of two recombinant human N-acetylglucosaminyltransferase-IV isozymes.", "journal": "Glycoconjugate journal", "date": "2006", "authors": "Oguri S, Yoshida A, Minowa MT, Takeuchi M", "evidence": [ { "database": "Reactome", "id": "R-HSA-975577", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975577" } ], "reference": [ { "type": "PubMed", "id": "17006639", "url": "https://glygen.org/publication/PubMed/17006639" } ] }, { "title": "Transition of galactosyltransferase 1 from trans-Golgi cisterna to the trans-Golgi network is signal mediated.", "journal": "Molecular biology of the cell", "date": "2006", "authors": "Schaub BE, Berger B, Berger EG, Rohrer J", "evidence": [ { "database": "Reactome", "id": "R-HSA-975577", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975577" } ], "reference": [ { "type": "PubMed", "id": "17021253", "url": "https://glygen.org/publication/PubMed/17021253" } ] }, { "title": "Evidence for a molecular distinction between Golgi and cell surface forms of beta 1,4-galactosyltransferase.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Lopez LC, Youakim A, Evans SC, Shur BD", "evidence": [ { "database": "Reactome", "id": "R-HSA-975577", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975577" } ], "reference": [ { "type": "PubMed", "id": "1714903", "url": "https://glygen.org/publication/PubMed/1714903" } ] }, { "title": "N-glycan alterations are associated with drug resistance in human hepatocellular carcinoma.", "journal": "Molecular cancer", "date": "2007", "authors": "Kudo T, Nakagawa H, Takahashi M, Hamaguchi J, Kamiyama N, Yokoo H, Nakanishi K, Nakagawa T, Kamiyama T, Deguchi K, Nishimura S, Todo S", "evidence": [ { "database": "Reactome", "id": "R-HSA-975577", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975577" } ], "reference": [ { "type": "PubMed", "id": "17488527", "url": "https://glygen.org/publication/PubMed/17488527" } ] }, { "title": "Enzymes responsible for synthesis of corneal keratan sulfate glycosaminoglycans.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Kitayama K, Hayashida Y, Nishida K, Akama TO", "evidence": [ { "database": "UniProtKB", "id": "O60513", "url": "https://www.uniprot.org/uniprot/O60513" } ], "reference": [ { "type": "PubMed", "id": "17690104", "url": "https://glygen.org/publication/PubMed/17690104" } ] }, { "title": "The implication of N-acetylglucosaminyltransferase V expression in gastric cancer.", "journal": "Pathobiology : journal of immunopathology, molecular and cellular biology", "date": "2008", "authors": "Tian H, Miyoshi E, Kawaguchi N, Shaker M, Ito Y, Taniguchi N, Tsujimoto M, Matsuura N", "evidence": [ { "database": "Reactome", "id": "R-HSA-975577", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975577" } ], "reference": [ { "type": "PubMed", "id": "18931531", "url": "https://glygen.org/publication/PubMed/18931531" } ] }, { "title": "The role of N-acetylglucosaminyltransferase III and V in the post-transcriptional modifications of E-cadherin.", "journal": "Human molecular genetics", "date": "2009", "authors": "Pinho SS, Reis CA, Paredes J, Magalhaes AM, Ferreira AC, Figueiredo J, Xiaogang W, Carneiro F, Gartner F, Seruca R", "evidence": [ { "database": "Reactome", "id": "R-HSA-975577", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975577" } ], "reference": [ { "type": "PubMed", "id": "19403558", "url": "https://glygen.org/publication/PubMed/19403558" } ] }, { "title": "MGAT5 alters the severity of multiple sclerosis.", "journal": "Journal of neuroimmunology", "date": "2010", "authors": "Brynedal B, Wojcik J, Esposito F, Debailleul V, Yaouanq J, Martinelli-Boneschi F, Edan G, Comi G, Hillert J, Abderrahim H", "evidence": [ { "database": "Reactome", "id": "R-HSA-975577", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975577" } ], "reference": [ { "type": "PubMed", "id": "20117844", "url": "https://glygen.org/publication/PubMed/20117844" } ] }, { "title": "Precision mapping of the human O-GalNAc glycoproteome through SimpleCell technology.", "journal": "The EMBO journal", "date": "2013", "authors": "Steentoft C, Vakhrushev SY, Joshi HJ, Kong Y, Vester-Christensen MB, Schjoldager KT, Lavrsen K, Dabelsteen S, Pedersen NB, Marcos-Silva L, Gupta R, Bennett EP, Mandel U, Brunak S, Wandall HH, Levery SB, Clausen H", "evidence": [ { "database": "UniCarbKB", "id": "O60513", "url": "" } ], "reference": [ { "type": "PubMed", "id": "23584533", "url": "https://glygen.org/publication/PubMed/23584533" } ] }, { "title": "Transcriptional Mechanism of the beta4-Galactosyltransferase 4 Gene in SW480 Human Colon Cancer Cell Line.", "journal": "Biological & pharmaceutical bulletin", "date": "2017", "authors": "Sugiyama A, Fukushima N, Sato T", "evidence": [ { "database": "RefSeq", "id": "NP_003769", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003769" } ], "reference": [ { "type": "PubMed", "id": "28228616", "url": "https://glygen.org/publication/PubMed/28228616" } ] }, { "title": "Mapping the O-glycoproteome using site-specific extraction of O-linked glycopeptides (EXoO).", "journal": "Molecular systems biology", "date": "2018", "authors": "Yang W, Ao M, Hu Y, Li QK, Zhang H", "evidence": [ { "database": "UniCarbKB", "id": "O60513", "url": "" } ], "reference": [ { "type": "PubMed", "id": "30459171", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "title": "N-glycosylation of the human beta1,4-galactosyltransferase 4 is crucial for its activity and Golgi localization.", "journal": "Glycoconjugate journal", "date": "2020", "authors": "Shauchuk A, Szulc B, Maszczak-Seneczko D, Wiertelak W, Skurska E, Olczak M", "evidence": [ { "database": "UniProtKB", "id": "O60513", "url": "https://www.uniprot.org/uniprot/O60513#ptm_processing" }, { "database": "UniProtKB", "id": "O60513", "url": "https://www.uniprot.org/uniprot/O60513" }, { "database": "RefSeq", "id": "NP_003769", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003769" } ], "reference": [ { "type": "PubMed", "id": "32827291", "url": "https://glygen.org/publication/PubMed/32827291" } ] }, { "title": "The critical role of B4GALT4 in promoting microtubule spindle assembly in HCC through the regulation of PLK1 and RHAMM expression.", "journal": "Journal of cellular physiology", "date": "2022", "authors": "Dai Z, Wang K, Gao Y", "evidence": [ { "database": "RefSeq", "id": "NP_003769", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003769" } ], "reference": [ { "type": "PubMed", "id": "34270095", "url": "https://glygen.org/publication/PubMed/34270095" } ] }, { "title": "Cloning and expression of human Gal beta 1,3(4)GlcNAc alpha 2,3-sialyltransferase.", "journal": "Biochemical and biophysical research communications", "date": "1993", "authors": "Kitagawa H, Paulson JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022854", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022854" } ], "reference": [ { "type": "PubMed", "id": "8333853", "url": "https://glygen.org/publication/PubMed/8333853" } ] }, { "title": "Characterization of two glycolipid: alpha 2-3sialyltransferases, SAT-3 (CMP-NeuAc:nLcOse4Cer alpha 2-3sialyltransferase) and SAT-4 (CMP-NeuAc:GgOse4Cer alpha 2-3sialyltransferase), from human colon carcinoma (Colo 205) cell line.", "journal": "Biochemistry", "date": "1996", "authors": "Basu SS, Basu M, Li Z, Basu S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022854", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022854" } ], "reference": [ { "type": "PubMed", "id": "8611500", "url": "https://glygen.org/publication/PubMed/8611500" } ] }, { "title": "Molecular cloning and expression of human Gal beta 1,3GalNAc alpha 2,3-sialytransferase (hST3Gal II).", "journal": "Biochemical and biophysical research communications", "date": "1996", "authors": "Kim YJ, Kim KS, Kim SH, Kim CH, Ko JH, Choe IS, Tsuji S, Lee YC", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022854", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022854" } ], "reference": [ { "type": "PubMed", "id": "8920913", "url": "https://glygen.org/publication/PubMed/8920913" } ] }, { "title": "Human STX polysialyltransferase forms the embryonic form of the neural cell adhesion molecule. Tissue-specific expression, neurite outgrowth, and chromosomal localization in comparison with another polysialyltransferase, PST.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Angata K, Nakayama J, Fredette B, Chong K, Ranscht B, Fukuda M", "evidence": [ { "database": "Reactome", "id": "R-HSA-975577", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975577" } ], "reference": [ { "type": "PubMed", "id": "9054414", "url": "https://glygen.org/publication/PubMed/9054414" } ] }, { "title": "Molecular cloning and characterization of human keratan sulfate Gal-6-sulfotransferase.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Fukuta M, Inazawa J, Torii T, Tsuzuki K, Shimada E, Habuchi O", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022854", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022854" } ], "reference": [ { "type": "PubMed", "id": "9405439", "url": "https://glygen.org/publication/PubMed/9405439" } ] }, { "title": "Cloning of a human UDP-galactose:2-acetamido-2-deoxy-D-glucose 3beta-galactosyltransferase catalyzing the formation of type 1 chains.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Kolbinger F, Streiff MB, Katopodis AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2022854", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022854" } ], "reference": [ { "type": "PubMed", "id": "9417100", "url": "https://glygen.org/publication/PubMed/9417100" } ] }, { "title": "The expanding beta 4-galactosyltransferase gene family: messages from the databanks.", "journal": "Glycobiology", "date": "1998", "authors": "Lo NW, Shaper JH, Pevsner J, Shaper NL", "evidence": [ { "database": "UniProtKB", "id": "O60513", "url": "https://www.uniprot.org/uniprot/O60513" }, { "database": "Reactome", "id": "R-HSA-975577", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975577" } ], "reference": [ { "type": "PubMed", "id": "9597550", "url": "https://glygen.org/publication/PubMed/9597550" } ] }, { "title": "Cloning of a novel member of the UDP-galactose:beta-N-acetylglucosamine beta1,4-galactosyltransferase family, beta4Gal-T4, involved in glycosphingolipid biosynthesis.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Schwientek T, Almeida R, Levery SB, Holmes EH, Bennett E, Clausen H", "evidence": [ { "database": "UniProtKB", "id": "O60513", "url": "https://www.uniprot.org/uniprot/O60513" } ], "reference": [ { "type": "PubMed", "id": "9792633", "url": "https://glygen.org/publication/PubMed/9792633" } ] } ], "pathway": [ { "id": "hsa:8702", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:8702", "resource": "KEGG Pathway" }, { "id": "R-HSA-2022854", "name": "Keratan sulfate biosynthesis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2022854", "resource": "Reactome", "description": "Keratan sulfate biosynthesis" }, { "id": "R-HSA-975577", "name": "N-Glycan antennae elongation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975577", "resource": "Reactome", "description": "N-Glycan antennae elongation" } ], "orthologs": [ { "uniprot_canonical_ac": "Q66HH1-1", "protein_name": "Beta-1,4-galactosyltransferase 4", "gene_name": "B4galt4", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MGCNPPYLLSYRLRLLLLFTLCLTVLGWATSNYFVGAIQVIPRAKNFMATLHKVMYLGNEETLGHGAAMKKAELANCPSVSPNLRGQNKLVFKPDLTLEEVQAKNPKVSRGRYRPEECKALQRVAVLIPHRNREKHLIYLLEHLHPFLQRQQLDYGIYVIHQTGSKKFNRAKLLNVGYLEALKEENWDCFIFHDVDLVPENDFNLYTCGDQPKHLVVGRNSTGYRLRYSKYFGGVTALSREQFFKVNGFSNNYWGWGGEDDDLRLRVELHKMKISRPKPDVGKYTMIFHTRDKGNEVNGSRMKLLQQMSRVWKTDGLSSCSYRLLSVEHNPLYANITVDFWTAA", "length": 344 }, "evidence": [ { "id": "45930507", "url": "http://www.informatics.jax.org/homology/45930507", "database": "MGI" }, { "id": "O60513", "url": "https://omabrowser.org/oma/group/O60513/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q9JJ04-1", "protein_name": "Beta-1,4-galactosyltransferase 4", "gene_name": "B4galt4", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MGCNPPYHLSYRLRLLLLFTLCLTVVGWATSNYFVGAIQVIPKAKDFMASFHKVIHLGNEETLGHDGATKKPELANCPSVSPNLRGQSKLVFKPDLTLEEIEAENPKVSRGRYHPEECKALQRVAILIPHRNREKHLIYLLEHLHPFLQRQQLDYGIYIIHQTGSKKFNRAKLLNVGYLEALKEENWDCFVFHDVDLVPENDFNLYTCGDQPKHLVVGRNSTGYRLRYSKYFGGVTALSREQFLKVNGFSNNYWGWGGEDDDLRLRVELHKMKISRPKPDVGKYTMIFHTRDKGNEVNMGRMKLLQQMSRVWKTDGLSSCSYRLLSVEHNPLYANITVDFWTAA", "length": 344 }, "evidence": [ { "id": "45930507", "url": "http://www.informatics.jax.org/homology/45930507", "database": "MGI" }, { "id": "O60513", "url": "https://omabrowser.org/oma/group/O60513/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 5, "go_terms": [ { "name": "Golgi membrane", "id": "GO:0000139", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000139", "evidence": [ { "database": "UniProtKB", "id": "O60513", "url": "https://www.uniprot.org/uniprot/O60513" } ], "pmid": "" }, { "name": "Golgi cisterna membrane", "id": "GO:0032580", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032580", "evidence": [ { "database": "UniProtKB", "id": "O60513", "url": "https://www.uniprot.org/uniprot/O60513" } ], "pmid": "" }, { "name": "Golgi apparatus", "id": "GO:0005794", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005794", "evidence": [ { "database": "UniProtKB", "id": "O60513", "url": "https://www.uniprot.org/uniprot/O60513" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "O60513", "url": "https://www.uniprot.org/uniprot/O60513" } ], "pmid": "" }, { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "O60513", "url": "https://www.uniprot.org/uniprot/O60513" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 6, "go_terms": [ { "name": "protein glycosylation", "id": "GO:0006486", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006486", "evidence": [ { "database": "UniProtKB", "id": "O60513", "url": "https://www.uniprot.org/uniprot/O60513" } ], "pmid": "" }, { "name": "carbohydrate metabolic process", "id": "GO:0005975", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005975", "evidence": [ { "database": "UniProtKB", "id": "O60513", "url": "https://www.uniprot.org/uniprot/O60513" } ], "pmid": "" }, { "name": "membrane lipid metabolic process", "id": "GO:0006643", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006643", "evidence": [ { "database": "UniProtKB", "id": "O60513", "url": "https://www.uniprot.org/uniprot/O60513" } ], "pmid": "" }, { "name": "keratan sulfate biosynthetic process", "id": "GO:0018146", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0018146", "evidence": [ { "database": "UniProtKB", "id": "O60513", "url": "https://www.uniprot.org/uniprot/O60513" } ], "pmid": "" }, { "name": "lactosylceramide biosynthetic process", "id": "GO:0001572", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001572", "evidence": [ { "database": "UniProtKB", "id": "O60513", "url": "https://www.uniprot.org/uniprot/O60513" } ], "pmid": "" }, { "name": "glycosylation", "id": "GO:0070085", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070085", "evidence": [ { "database": "UniProtKB", "id": "O60513", "url": "https://www.uniprot.org/uniprot/O60513" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 5, "go_terms": [ { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "O60513", "url": "https://www.uniprot.org/uniprot/O60513" } ], "pmid": "" }, { "name": "glycosyltransferase activity", "id": "GO:0016757", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016757", "evidence": [ { "database": "UniProtKB", "id": "O60513", "url": "https://www.uniprot.org/uniprot/O60513" } ], "pmid": "" }, { "name": "galactosyltransferase activity", "id": "GO:0008378", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008378", "evidence": [ { "database": "UniProtKB", "id": "O60513", "url": "https://www.uniprot.org/uniprot/O60513" } ], "pmid": "" }, { "name": "N-acetyllactosamine synthase activity", "id": "GO:0003945", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003945", "evidence": [ { "database": "UniProtKB", "id": "O60513", "url": "https://www.uniprot.org/uniprot/O60513" } ], "pmid": "" }, { "name": "UDP-galactosyltransferase activity", "id": "GO:0035250", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035250", "evidence": [ { "database": "UniProtKB", "id": "O60513", "url": "https://www.uniprot.org/uniprot/O60513" } ], "pmid": "" } ] } ] }, "pro_annotation": [ { "name": "beta-1,4-galactosyltransferase 4 O-glycosylated 1 (human)", "definition": "A beta-1,4-galactosyltransferase 4 (human) that has been O-glycosylated at the residue equivalent to Thr-69 of the amino acid sequence represented by UniProtKB:O60513-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:O60513-1, Thr-69, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000050789", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000050789" } ] } ], "site_annotation": [ { "start_pos": 220, "end_pos": 222, "annotation": "n_glycosylation_sequon" }, { "start_pos": 335, "end_pos": 337, "annotation": "n_glycosylation_sequon" }, { "start_pos": 4, "end_pos": 6, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "N-glycosylated.", "evidence": [ { "database": "UniProtKB", "id": "O60513", "url": "https://www.uniprot.org/uniprot/O60513" }, { "database": "PubMed", "id": "32827291", "url": "https://glygen.org/publication/PubMed/32827291" } ] } ], "interactions": [], "reactions": [ { "id": "17745", "name": "", "equation": "N-acetyl-D-glucosamine + UDP-alpha-D-galactose = beta-D-galactosyl-(1->4)-N-acetyl-D-glucosamine + H(+) + UDP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P80225-1", "Q66HH1-1", "Q6P768-1", "P15291-1", "O60909-1", "O60512-1", "O60513-1", "Q91YY2-1", "Q9Z2Y2-1", "P15535-1", "Q9JJ04-1" ], "evidence": [ { "id": "17745", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/17745" } ] }, { "id": "31499", "name": "", "equation": "a beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1)-Cer(d18:1(4E)) + UDP-alpha-D-galactose = a neolactoside nLc4Cer(d18:1(4E)) + H(+) + UDP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q66HH1-1", "P80225-1", "Q6P768-1", "O60513-1", "P15291-1", "O60512-1", "Q9JJ04-1", "Q91YY2-1", "P15535-1" ], "evidence": [ { "id": "31499", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/31499" } ] }, { "id": "67872", "name": "", "equation": "3-O-{beta-D-galactosyl-(1->3)-[6-O-sulfo-N-acetyl-beta-D-glucosaminyl-(1->6)]-N-acetyl-alpha-D-galactosaminyl}-L-threonyl-[protein] + UDP-alpha-D-galactose = 3-O-{beta-D-galactosyl-(1->3)-[beta-D-galactosyl-(1->4)-6-O-sulfo-N-acetyl-beta-D-glucosaminyl-(1->6)]-N-acetyl-alpha-D-galactosaminyl}-L-threonyl-[protein] + H(+) + UDP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q66HH1-1", "O60513-1", "Q9JJ04-1" ], "evidence": [ { "id": "67872", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/67872" } ] }, { "id": "67948", "name": "", "equation": "3-O-{beta-D-galactosyl-(1->3)-[6-O-sulfo-N-acetyl-beta-D-glucosaminyl-(1->6)]-N-acetyl-alpha-D-galactosaminyl}-L-seryl-[protein] + UDP-alpha-D-galactose = 3-O-{beta-D-galactosyl-(1->3)-[beta-D-galactosyl-(1->4)-6-O-sulfo-N-acetyl-beta-D-glucosaminyl-(1->6)]-N-acetyl-alpha-D-galactosaminyl}-L-seryl-[protein] + H(+) + UDP", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q66HH1-1", "O60513-1", "Q9JJ04-1" ], "evidence": [ { "id": "67948", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/67948" } ] }, { "id": "R-HSA-2025723", "name": "B4GALTs transfer Gal to the N-glycan precursor", "equation": "", "summary": "The family of beta 4-galactosyltransferases (B4GALTs) is composed of at least six known members with different Km and acceptor specificities (Guo et al. 2001) that probably originated by gene duplication (Lo et al. 1998). They mediate the transfer of galactose to N-glycan structures which initiate the beginning of keratan sulfate (KS) biosynthesis. B4GALT1 is associated with Congenital Disorder of Glycosylation of type IId (MIM:607091) (Hansske et al. 2002), and is expressed as two splicing isoforms of which only one is localized in the Golgi system (Lopez et al. 1991, Schaub et al. 2006).", "cellular_location": "Golgi lumen, Golgi membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O43286-1", "O60513-1", "O60909-1", "Q9UBX8-1", "O60512-1", "P15291-1" ], "evidence": [ { "id": "R-HSA-2025723", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2025723" } ] }, { "id": "R-HSA-2046265", "name": "B4GALTs transfer Gal to the keratan chain", "equation": "", "summary": "The family of beta 4-galactosyltransferases (B4GALTs) is composed by at least six known members with different Km and acceptor specificities (Guo et al. 2001) and probably originated by duplication (Lo et al. 1998). They mediate the transfer of galactose to N-glycan structures, either to begin, or in this case, to elongate keratan chains. B4GALT1 is associated with Congenital Disorder of Glycosylation of type IId (MIM:607091) (Hansske et al. 2002), and is expressed as two splicing isoforms of which only one is localized in the Golgi system (Lopez et al. 1991, Schaub et al. 2006).", "cellular_location": "Golgi lumen, Golgi membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O43286-1", "O60513-1", "O60909-1", "Q9UBX8-1", "O60512-1", "P15291-1" ], "evidence": [ { "id": "R-HSA-2046265", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2046265" } ] }, { "id": "R-HSA-2046298", "name": "B4GALTs transfer Gal to a branch of keratan", "equation": "", "summary": "The family of beta 4-galactosyltransferases (B4GALTs) is composed by at least six known members with different Km and acceptor specificities (Guo et al. 2001) that probably originated by gene duplication (Lo et al. 1998). They mediate the transfer of galactose to N-glycan structures, in this case, to elongate an antenna with a keratan chain. B4GALT1 is associated with Congenital Disorder of Glycosylation of type IId (MIM:607091) (Hansske et al. 2002), and is expressed as two splicing isoforms of which only one is localized in the Golgi system (Lopez et al. 1991, Schaub et al. 2006).", "cellular_location": "Golgi lumen, Golgi membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O43286-1", "O60513-1", "O60909-1", "Q9UBX8-1", "O60512-1", "P15291-1" ], "evidence": [ { "id": "R-HSA-2046298", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2046298" } ] }, { "id": "R-HSA-975919", "name": "Addition of galactose by beta 4-galactosyltransferases", "equation": "", "summary": "Addition of a galactose residue on N-acetylglucosamine. The family of beta 4-galactosyltransferases is composed by at least six known members with different K(m) and acceptor specifities (Guo S et al, 2001) and probably originated by duplication (Lo NW et al, 1998). B4GALT1 is associated with Congenital Disorder of Glycosylation of type IId (Hansske B et al, 2002), and is expressed as two splicing isoforms of which only one is localizated in the Golgi system (Lopez LC et al, 1991; Schaub BE et al, 2006). B4GALT2 is key in the regulation of proteins involved in neuronal development (Sasaki N et
al, 2005).", "cellular_location": "Golgi lumen, Golgi membrane", "input_participant_list": [], "output_participant_list": [ "R-ALL-981618" ], "enzyme_list": [ "O43286-1", "O60513-1", "O60909-1", "Q9UBX8-1", "O60512-1", "P15291-1" ], "evidence": [ { "id": "R-HSA-975919", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975919" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-981618", "participant_name": "Glycoprotein with galactose [Golgi lumen]", "crossref": [ { "id": "33837", "database": "ChEBI", "url": "" }, { "id": "33837", "database": "ChEBI", "url": "" }, { "id": "33837", "database": "ChEBI", "url": "" }, { "id": "33837", "database": "ChEBI", "url": "" }, { "id": "33837", "database": "ChEBI", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "O43286", "gene_name": "B4GALT5", "activity": [ { "ec_number": "2.4.1.-", "activity": "", "evidence": [ { "id": "O43286", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43286" } ] }, { "ec_number": "2.4.1.274", "activity": "a beta-D-glucosyl-(1<->1')-N-acylsphing-4-enine + UDP-alpha-D-galactose = a beta-D-Gal-(1->4)-beta-D-Glc-(1<->1)-Cer(d18:1(4E)) + H(+) + UDP.", "evidence": [ { "id": "O43286", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43286" } ] } ] }, { "uniprot_ac": "O60512", "gene_name": "B4GALT3", "activity": [ { "ec_number": "2.4.1.-", "activity": "", "evidence": [ { "id": "O60512", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60512" } ] }, { "ec_number": "2.4.1.275", "activity": "a beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1)-Cer(d18:1(4E)) + UDP-alpha-D-galactose = a neolactoside nLc4Cer(d18:1(4E)) + H(+) + UDP.", "evidence": [ { "id": "O60512", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60512" } ] }, { "ec_number": "2.4.1.38", "activity": "an N-acetyl-beta-D-glucosaminyl derivative + UDP-alpha-D-galactose = a beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + H(+) + UDP.", "evidence": [ { "id": "O60512", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60512" } ] }, { "ec_number": "2.4.1.90", "activity": "N-acetyl-D-glucosamine + UDP-alpha-D-galactose = beta-D-galactosyl-(1->4)-N-acetyl-D-glucosamine + H(+) + UDP.", "evidence": [ { "id": "O60512", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60512" } ] } ] }, { "uniprot_ac": "O60513", "gene_name": "B4GALT4", "activity": [ { "ec_number": "2.4.1.-", "activity": "", "evidence": [ { "id": "O60513", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60513" } ] }, { "ec_number": "2.4.1.275", "activity": "a beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1)-Cer(d18:1(4E)) + UDP-alpha-D-galactose = a neolactoside nLc4Cer(d18:1(4E)) + H(+) + UDP.", "evidence": [ { "id": "O60513", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60513" } ] }, { "ec_number": "2.4.1.90", "activity": "N-acetyl-D-glucosamine + UDP-alpha-D-galactose = beta-D-galactosyl-(1->4)-N-acetyl-D-glucosamine + H(+) + UDP.", "evidence": [ { "id": "O60513", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60513" } ] } ] }, { "uniprot_ac": "O60909", "gene_name": "B4GALT2", "activity": [ { "ec_number": "2.4.1.-", "activity": "", "evidence": [ { "id": "O60909", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60909" } ] }, { "ec_number": "2.4.1.22", "activity": "D-glucose + UDP-alpha-D-galactose = H(+) + lactose + UDP.", "evidence": [ { "id": "O60909", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60909" } ] }, { "ec_number": "2.4.1.38", "activity": "an N-acetyl-beta-D-glucosaminyl derivative + UDP-alpha-D-galactose = a beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + H(+) + UDP.", "evidence": [ { "id": "O60909", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60909" } ] }, { "ec_number": "2.4.1.90", "activity": "N-acetyl-D-glucosamine + UDP-alpha-D-galactose = beta-D-galactosyl-(1->4)-N-acetyl-D-glucosamine + H(+) + UDP.", "evidence": [ { "id": "O60909", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60909" } ] } ] }, { "uniprot_ac": "P15291", "gene_name": "B4GALT1", "activity": [ { "ec_number": "2.4.1.-", "activity": "", "evidence": [ { "id": "P15291", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15291" } ] }, { "ec_number": "2.4.1.275", "activity": "a beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1)-Cer(d18:1(4E)) + UDP-alpha-D-galactose = a neolactoside nLc4Cer(d18:1(4E)) + H(+) + UDP.", "evidence": [ { "id": "P15291", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15291" } ] }, { "ec_number": "2.4.1.22", "activity": "D-glucose + UDP-alpha-D-galactose = H(+) + lactose + UDP.", "evidence": [ { "id": "P15291", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15291" } ] }, { "ec_number": "2.4.1.38", "activity": "an N-acetyl-beta-D-glucosaminyl derivative + UDP-alpha-D-galactose = a beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + H(+) + UDP.", "evidence": [ { "id": "P15291", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15291" } ] }, { "ec_number": "2.4.1.90", "activity": "N-acetyl-D-glucosamine + UDP-alpha-D-galactose = beta-D-galactosyl-(1->4)-N-acetyl-D-glucosamine + H(+) + UDP.", "evidence": [ { "id": "P15291", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15291" } ] } ] }, { "uniprot_ac": "P15535", "gene_name": "B4galt1", "activity": [ { "ec_number": "2.4.1.-", "activity": "", "evidence": [ { "id": "P15535", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15535" } ] }, { "ec_number": "2.4.1.275", "activity": "a beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1)-Cer(d18:1(4E)) + UDP-alpha-D-galactose = a neolactoside nLc4Cer(d18:1(4E)) + H(+) + UDP.", "evidence": [ { "id": "P15535", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15535" } ] }, { "ec_number": "2.4.1.22", "activity": "D-glucose + UDP-alpha-D-galactose = H(+) + lactose + UDP.", "evidence": [ { "id": "P15535", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15535" } ] }, { "ec_number": "2.4.1.38", "activity": "an N-acetyl-beta-D-glucosaminyl derivative + UDP-alpha-D-galactose = a beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + H(+) + UDP.", "evidence": [ { "id": "P15535", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15535" } ] }, { "ec_number": "2.4.1.90", "activity": "N-acetyl-D-glucosamine + UDP-alpha-D-galactose = beta-D-galactosyl-(1->4)-N-acetyl-D-glucosamine + H(+) + UDP.", "evidence": [ { "id": "P15535", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15535" } ] } ] }, { "uniprot_ac": "P80225", "gene_name": "B4galt1", "activity": [ { "ec_number": "2.4.1.-", "activity": "", "evidence": [ { "id": "P80225", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P80225" } ] }, { "ec_number": "2.4.1.275", "activity": "a beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1)-Cer(d18:1(4E)) + UDP-alpha-D-galactose = a neolactoside nLc4Cer(d18:1(4E)) + H(+) + UDP.", "evidence": [ { "id": "P80225", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P80225" } ] }, { "ec_number": "2.4.1.22", "activity": "D-glucose + UDP-alpha-D-galactose = H(+) + lactose + UDP.", "evidence": [ { "id": "P80225", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P80225" } ] }, { "ec_number": "2.4.1.38", "activity": "an N-acetyl-beta-D-glucosaminyl derivative + UDP-alpha-D-galactose = a beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + H(+) + UDP.", "evidence": [ { "id": "P80225", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P80225" } ] }, { "ec_number": "2.4.1.90", "activity": "N-acetyl-D-glucosamine + UDP-alpha-D-galactose = beta-D-galactosyl-(1->4)-N-acetyl-D-glucosamine + H(+) + UDP.", "evidence": [ { "id": "P80225", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P80225" } ] } ] }, { "uniprot_ac": "Q66HH1", "gene_name": "B4galt4", "activity": [ { "ec_number": "2.4.1.-", "activity": "", "evidence": [ { "id": "Q66HH1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q66HH1" } ] }, { "ec_number": "2.4.1.275", "activity": "a beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1)-Cer(d18:1(4E)) + UDP-alpha-D-galactose = a neolactoside nLc4Cer(d18:1(4E)) + H(+) + UDP.", "evidence": [ { "id": "Q66HH1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q66HH1" } ] }, { "ec_number": "2.4.1.90", "activity": "N-acetyl-D-glucosamine + UDP-alpha-D-galactose = beta-D-galactosyl-(1->4)-N-acetyl-D-glucosamine + H(+) + UDP.", "evidence": [ { "id": "Q66HH1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q66HH1" } ] } ] }, { "uniprot_ac": "Q6P768", "gene_name": "B4galt3", "activity": [ { "ec_number": "2.4.1.-", "activity": "", "evidence": [ { "id": "Q6P768", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P768" } ] }, { "ec_number": "2.4.1.275", "activity": "a beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1)-Cer(d18:1(4E)) + UDP-alpha-D-galactose = a neolactoside nLc4Cer(d18:1(4E)) + H(+) + UDP.", "evidence": [ { "id": "Q6P768", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P768" } ] }, { "ec_number": "2.4.1.38", "activity": "an N-acetyl-beta-D-glucosaminyl derivative + UDP-alpha-D-galactose = a beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + H(+) + UDP.", "evidence": [ { "id": "Q6P768", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P768" } ] }, { "ec_number": "2.4.1.90", "activity": "N-acetyl-D-glucosamine + UDP-alpha-D-galactose = beta-D-galactosyl-(1->4)-N-acetyl-D-glucosamine + H(+) + UDP.", "evidence": [ { "id": "Q6P768", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6P768" } ] } ] }, { "uniprot_ac": "Q91YY2", "gene_name": "B4galt3", "activity": [ { "ec_number": "2.4.1.275", "activity": "a beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1)-Cer(d18:1(4E)) + UDP-alpha-D-galactose = a neolactoside nLc4Cer(d18:1(4E)) + H(+) + UDP.", "evidence": [ { "id": "Q91YY2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91YY2" } ] }, { "ec_number": "2.4.1.38", "activity": "an N-acetyl-beta-D-glucosaminyl derivative + UDP-alpha-D-galactose = a beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + H(+) + UDP.", "evidence": [ { "id": "Q91YY2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91YY2" } ] }, { "ec_number": "2.4.1.90", "activity": "N-acetyl-D-glucosamine + UDP-alpha-D-galactose = beta-D-galactosyl-(1->4)-N-acetyl-D-glucosamine + H(+) + UDP.", "evidence": [ { "id": "Q91YY2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91YY2" } ] }, { "ec_number": "2.4.1.90", "activity": "", "evidence": [ { "id": "Q91YY2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91YY2" } ] }, { "ec_number": "2.4.1.38", "activity": "", "evidence": [ { "id": "Q91YY2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91YY2" } ] }, { "ec_number": "2.4.1.275", "activity": "", "evidence": [ { "id": "Q91YY2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91YY2" } ] }, { "ec_number": "2.4.1.-", "activity": "", "evidence": [ { "id": "Q91YY2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91YY2" } ] } ] }, { "uniprot_ac": "Q9JJ04", "gene_name": "B4galt4", "activity": [ { "ec_number": "2.4.1.-", "activity": "", "evidence": [ { "id": "Q9JJ04", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JJ04" } ] }, { "ec_number": "2.4.1.275", "activity": "a beta-D-GlcNAc-(1->3)-beta-D-Gal-(1->4)-beta-D-Glc-(1<->1)-Cer(d18:1(4E)) + UDP-alpha-D-galactose = a neolactoside nLc4Cer(d18:1(4E)) + H(+) + UDP.", "evidence": [ { "id": "Q9JJ04", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JJ04" } ] }, { "ec_number": "2.4.1.90", "activity": "N-acetyl-D-glucosamine + UDP-alpha-D-galactose = beta-D-galactosyl-(1->4)-N-acetyl-D-glucosamine + H(+) + UDP.", "evidence": [ { "id": "Q9JJ04", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JJ04" } ] } ] }, { "uniprot_ac": "Q9UBX8", "gene_name": "B4GALT6", "activity": [ { "ec_number": "2.4.1.-", "activity": "", "evidence": [ { "id": "Q9UBX8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UBX8" } ] }, { "ec_number": "2.4.1.274", "activity": "a beta-D-glucosyl-(1<->1')-N-acylsphing-4-enine + UDP-alpha-D-galactose = a beta-D-Gal-(1->4)-beta-D-Glc-(1<->1)-Cer(d18:1(4E)) + H(+) + UDP.", "evidence": [ { "id": "Q9UBX8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9UBX8" } ] } ] }, { "uniprot_ac": "Q9Z2Y2", "gene_name": "B4galt2", "activity": [ { "ec_number": "2.4.1.-", "activity": "", "evidence": [ { "id": "Q9Z2Y2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2Y2" } ] }, { "ec_number": "2.4.1.22", "activity": "D-glucose + UDP-alpha-D-galactose = H(+) + lactose + UDP.", "evidence": [ { "id": "Q9Z2Y2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2Y2" } ] }, { "ec_number": "2.4.1.38", "activity": "an N-acetyl-beta-D-glucosaminyl derivative + UDP-alpha-D-galactose = a beta-D-galactosyl-(1->4)-N-acetyl-beta-D-glucosaminyl derivative + H(+) + UDP.", "evidence": [ { "id": "Q9Z2Y2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2Y2" } ] }, { "ec_number": "2.4.1.90", "activity": "N-acetyl-D-glucosamine + UDP-alpha-D-galactose = beta-D-galactosyl-(1->4)-N-acetyl-D-glucosamine + H(+) + UDP.", "evidence": [ { "id": "Q9Z2Y2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Z2Y2" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [ { "glytoucan_ac": "G00027JG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G00034UM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G00069YC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G00079IK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G00112IO", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G00164QP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G00196CO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G00241VQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G00288RP", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G00321UH", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G00376RB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G00383NC", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G00394CR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G00428HK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G00430ZK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G00468NI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G00496OX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G00520NI", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G00560KG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G00653TI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G00707RC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G00728SN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G00729SA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G00745CN", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G00789VI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G00897BY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G00901NZ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G00924FH", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G00932UQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G00944OL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G00978GW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G00979XR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G00980BE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G01056RH", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G01243KR", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G01284WP", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G01325OU", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G01357LV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G01437WY", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G01457KB", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G01471GI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G01532FF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G01584VI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G01643LM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G01665LU", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G01674VT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G01744JD", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G01747FB", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G01749YL", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G01759NM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G01879FC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G01912GF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G01922RI", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G01923FT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G02032MW", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G02078ZZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G02150AC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G02161CI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G02230VA", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G02244ID", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G02289NP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G02370LQ", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G02377RY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G02387FV", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G02393LQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G02403ZU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G02522JF", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G02539TH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G02562EQ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G02563ZC", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G02608NW", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G02642GO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G02860LZ", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G02912JK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G02942YF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G02990AF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G03016BW", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G03035VB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G03052ZR", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G03140AX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G03168RN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G03172PR", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G03200OR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G03266UM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G03304QB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G03340FG", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G03425VF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G03462LS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G03484HH", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G03494YC", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G03520RT", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G03549GG", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G03574EH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G03591CN", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G03605AU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G03670RH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G03674DU", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G03720YG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G03792OA", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G03900NK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G03941EL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G04002YJ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G04014AR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G04014FP", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G04043RM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G04091CN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G04114CX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G04116CC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G04185QP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G04324CR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G04428BJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G04450CG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G04478DK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G04505IS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G04527KW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G04531NI", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G04536JV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G04557PM", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G04564SK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G04765GH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G04842IW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G04949CY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G04970RV", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G05028TR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G05128BK", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G05184IQ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G05252QE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G05278GV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G05286IK", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G05378UG", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G05380VG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G05400IQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G05402FG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G05411CD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G05412ZS", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G05456PR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G05562YT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G05644LC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G05670VR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G05675LB", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G05690OR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G05724WC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G05767GS", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G05784QE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G05874CB", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G05918XD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G05970FR", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G05994BK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G06036CF", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G06067PC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G06317RG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G06341YK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G06404BM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G06435TQ", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G06439PI", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G06448OR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G06453RB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G06503AU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G06507BB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G06523WI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G06563KK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G06577DG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G06624ZC", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G06650FN", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G06662ZP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G06710OE", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G06755AP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G06786CI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G06864JC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G06990MN", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G07061BV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G07061YF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G07099ZR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G07145VL", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G07191NE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G07210GE", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G07360NF", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G07405CY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G07430HH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G07435LO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G07480TU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G07578MJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G07610JY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G07646UD", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G07677VL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G07680WY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G07689ET", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G07764JS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G07789RJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G07819HC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G07932PU", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G07982LO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G08016YO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G08046LM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G08055MG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G08059ZN", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G08107SW", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G08140FC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G08190JB", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G08201TX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G08244KE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G08244YE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G08246QI", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G08264JX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G08308ZP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G08358DN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G08366OY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G08382XT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G08426DX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G08569VN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G08784DO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G08952PH", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G09147XQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G09154YX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G09185DX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G09198TC", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G09207SI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G09226UP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G09403AR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G09424UT", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G09425PN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G09441VY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G09520ZQ", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G09575SG", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G09583DW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G09588MX", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G09640VJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G09678FF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G09682KX", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G09698FP", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G09761AD", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G09767ET", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G09781FH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G09831CM", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G09845DR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G09938IH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G10119AX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G10180QX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G10300QZ", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G10302UO", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G10372YC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G10388YZ", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G10408DE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G10487BH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G10581YA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G10604KJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G10608NX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G10643IE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G10687EF", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G10688VV", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G10706IL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G10739QG", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G10816YX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G10831FE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G10924UK", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G10925II", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G10954DW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G10954XM", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G10993EM", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G11083DH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G11105TT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G11120EJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G11198HA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G11220GW", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G11272SN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G11276SJ", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G11457RF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G11466IA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G11482NO", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G11679KK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G11704PO", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G11819NV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G11827HH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G11848VF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G11936KZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G12020PN", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G12074QJ", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G12111NA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G12114XT", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G12121CY", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G12133SZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G12230UX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G12232OT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G12340JM", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G12350CH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G12396GB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G12405JG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G12486YB", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G12526XX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G12574EB", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G12604MY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G12616PJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G12637ID", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G12848QL", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G13089IH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G13101AX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G13104VJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G13122AV", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G13179DW", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G13260JU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G13292XY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G13346PK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G13496UJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G13610SN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G13616KY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G13684QB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G13695SV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G13717KM", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G13761UE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G13814UH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G13816ZL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G13858YJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G13863XN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G13890JV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G13894RO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G13968BO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G14138XB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G14188TW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G14205YR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G14303LL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G14317JF", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G14346JI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G14375KO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G14453LC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G14555ST", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G14567YG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G14623FX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G14722QE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G14781HP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G14815WH", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G14829OL", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G14919CV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G14955CK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G14965PJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G14978ZY", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G15033WI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G15086ZG", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G15249CA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G15307GJ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G15555MR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G15577KP", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G15631KB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G15635CJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G15648GT", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G15667KI", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G15756SW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G15772KA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G15849KC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G15876HU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G15952WX", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G16078YI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G16270SN", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G16456ZV", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G16503YF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G16536QD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G16682CP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G16687RY", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G16709FR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G16739XD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G16768QV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G16816IR", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G16867VE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G16984QJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G17034UD", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G17039UO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G17050CK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G17077YF", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G17173XA", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G17218WW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G17241OS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G17251XF", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G17294JY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G17300DB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G17331IX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G17346NI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G17361GJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G17454VN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G17457PQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G17465GV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G17500FP", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G17527HL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G17673XH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G17709UI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G17733ZN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G17752YB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G17810KS", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G17827ZK", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G17940HM", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G18123MJ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G18132YR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G18149MR", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G18299YA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G18347PA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G18362VR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G18423OV", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G18427DX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G18559VR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G18603OH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G18603ZQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G18653BM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G18800AB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G18814OJ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G18837VD", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G18853HA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G18878GS", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G18878PL", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G18890KW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G18930SC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G18950NM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G18953GB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G18982QA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G19075LN", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G19173OJ", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G19212IL", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G19231UV", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G19238ZQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G19342EE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G19555CW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G19618VN", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G19664QJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G19756XC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G19793PI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G19806ZW", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G19807JC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G19954YX", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G19957ZD", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G20222KH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G20246IY", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G20251UM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G20310DM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G20438JB", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G20440GC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G20453WS", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G20557GR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G20566UO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G20713UI", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G20718YD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G20739VI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G20745AF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G20752RM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G20828MB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G20835CN", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G20878US", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G20879UO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G20887HP", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G20993TP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G21029LJ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G21147BK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G21312EA", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G21385AQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G21412CQ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G21557NG", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G21564HN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G21696DT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G21740EF", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G21807KQ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G21827YQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G21845NG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G21880FP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G21905ZO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G21939VU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G21939WK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G21989SY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G22012EW", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G22070LE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G22171KQ", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G22327AZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G22343QB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G22385OT", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G22498IQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G22540KI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G22609VV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G22626SX", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G22629JM", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G22668GN", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G22773YW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G22782LH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G22793FR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G22803YZ", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G22815DC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G22841DM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G22849VW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G22970UG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G23016AG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G23021IW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G23021NE", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G23048PE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G23066SI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G23113ER", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G23119MJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G23126IF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G23193CN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G23250OE", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G23262BU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G23262LC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G23348CE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G23392LW", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G23404PC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G23416ZA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G23438NR", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G23463KX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G23491CM", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G23501RV", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G23564VW", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G23654OQ", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G23674BI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G23801QI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G23866EW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G23870PO", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G23893ZL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G23909XW", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G23975EE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G23999MD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G24030QV", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G24120OI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G24142JB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G24151NT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G24168XN", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G24218RK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G24218XI", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G24283IO", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G24293BT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G24303LM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G24327KR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G24363HJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G24366RG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G24371IA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G24375OF", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G24475OY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G24739SA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G24798BT", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G24820LP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G24845EE", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G24856YP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G24931MM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G24951IK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G25012OX", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G25043OJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G25044JE", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G25064SU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G25127JU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G25146DY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G25233TU", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G25322NY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G25323VU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G25382RS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G25416CE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G25421NH", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G25443TD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G25459WN", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G25498HI", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G25499LZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G25524RD", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G25529RM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G25538MM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G25612EW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G25716MV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G25780HH", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G25804XU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G25835YC", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G25845BH", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G25848FU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G25895SL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G25934VE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G25935VE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G25937FN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G25953KD", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G25955UH", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G25977RW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G26099QT", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G26176JA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G26185YJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G26209TI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G26224UH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G26228QQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G26301NP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G26325AQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G26326PX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G26341AW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G26358SO", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G26497EU", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G26570RB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G26596ON", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G26700PN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G26712CT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G26718PT", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G26754XS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G26827ST", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G27000YJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G27071PO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G27248RA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G27263EA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G27300OX", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G27384IP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G27409LG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G27431EQ", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G27526RV", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G27562KD", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G27605DL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G27626TX", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G27655DO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G27726WH", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G27866VO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G27883TZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G27888XB", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G27889FI", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G27893KR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G28077AI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G28116PK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G28136FA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G28226YW", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G28329XZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G28336JR", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G28371PC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G28505XN", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G28525CY", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G28561QO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G28570DO", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G28582VX", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G28665FP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G28749YQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G28782ND", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G28791JD", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G28801XY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G28877HV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G28881KN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G28885XK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G28898NZ", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G28989XR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G29014XV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G29025YS", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G29290QO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G29301RL", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G29495CE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G29503CE", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G29524AT", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G29622NE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G29628MO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G29712MR", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G29725MK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G29729DB", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G29739GM", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G29818FJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G29849JL", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G29956GF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G29988NK", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G30090IC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G30182VC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G30241UB", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G30284BK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G30296PK", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G30304DE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G30304IT", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G30372CO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G30392XP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G30431XW", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G30443NG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G30524AR", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G30524IG", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G30591GE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G30614QN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G30651QG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G30739AG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G30871VQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G31073HZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G31087MR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G31101EW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G31118TG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G31317BJ", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G31345CV", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G31378RD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G31493NN", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G31540HC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G31563MH", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G31729QS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G31849TV", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G31948FR", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G32216IU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G32218WF", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G32253LY", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G32289FM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G32405GG", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G32417DU", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G32485KG", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G32556JI", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G32590UP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G32652KI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G32684NS", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G32722PR", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G32723SL", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G32735YJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G32785BQ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G32853SP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G32863IR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G32877EI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G32910OR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G32944VN", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G32998WQ", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G33018IJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G33115WA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G33159AG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G33278DK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G33294DV", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G33334QS", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G33345BX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G33364OS", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G33401IN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G33479HZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G33508VK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G33569OU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G33593EQ", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G33610ZO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G33633KK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G33718UW", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G33719VU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G33740YL", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G33758XE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G33772BZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G33825CM", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G33858ZT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G33860PM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G33866SM", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G33877TL", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G33886DT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G33892UJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G33908QE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G33963JX", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G34049BA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G34073UX", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G34096TA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G34100DU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G34118NA", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G34143CH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G34706DW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G34764BK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G34854XJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G34863TS", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G34962LY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G34988TR", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G35106OM", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G35199BM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G35234CM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G35243PQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G35316IV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G35347WX", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G35409SK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G35432EX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G35486FC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G35528EA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G35632SP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G35656YC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G35799DH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G35815ZB", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G35875IX", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G35884UD", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G35898DT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G35910XN", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G35941VN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G35945JK", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G35946GZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G35949CT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G36046VV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G36138ZV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G36184OR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G36231CI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G36253YP", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G36404TW", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G36406GU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G36479RD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G36482YM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G36573BV", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G36597IG", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G36669SS", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G36674QY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G36777IJ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G36793ZF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G36807NH", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G36855EL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G36958OJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G36983SB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G37003XY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G37115PC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G37134CP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G37239FO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G37241GG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G37282LW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G37354FL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G37381UQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G37416IR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G37435GT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G37597VQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G37638KH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G37653KL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G37689ZA", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G37716XX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G37779JP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G37801HD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G37843CX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G37927WZ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G38002BK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G38004LX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G38027UF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G38120GJ", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G38189CI", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G38234JH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G38296RM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G38316MW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G38361SH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G38402DW", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G38418FR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G38462TG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G38468XG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G38568EL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G38684VZ", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G38702PM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G38722VX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G38767OS", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G38812YS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G38859XU", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G38887TM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G38979WI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G39100MY", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G39130DL", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G39135DL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G39246KD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G39247UK", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G39260NC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G39283IB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G39305NP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G39308RS", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G39321UZ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G39326PP", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G39417RW", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G39423SD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G39516UK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G39523KI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G39615UL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G39624YQ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G39643KO", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G39676NA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G39720OK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G39762RW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G39785OI", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G39890DX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G39893XZ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G40088CY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G40107NH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G40188OO", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G40270LS", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G40289VL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G40291QP", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G40319SF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G40347YM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G40393FZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G40397HC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G40413JC", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G40445LE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G40455IF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G40539YV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G40560AU", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G40560HO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G40565CN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G40606LI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G40660XA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G40689UV", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G40709XS", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G40757HO", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G40792HV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G40852TV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G40909HG", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G40957MU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G41165PK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G41196CX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G41227XH", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G41232YR", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G41245OZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G41257VM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G41286JH", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G41322DV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G41358UX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G41372SJ", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G41384PQ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G41403QR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G41451JJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G41539MU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G41552DE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G41581KJ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G41780OY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G41797KJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G41836YE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G41928NU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G42002WQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G42039AA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G42089IU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G42105TS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G42138LH", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G42147XQ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G42239FO", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G42239OO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G42245KI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G42300CL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G42325VD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G42368XT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G42393CS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G42444RF", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G42531AE", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G42603RO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G42632OC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G42650PV", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G42665KV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G42667BL", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G42752PT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G42772WO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G42814RP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G42828SU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G42912TT", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G42927HH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G43059PA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G43146HZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G43167FQ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G43220WQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G43265YA", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G43415UJ", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G43449ON", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G43619YE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G43639BV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G43662XM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G43668RJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G43933MN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G43972TU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G43993DD", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G44233ST", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G44236OL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G44374JT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G44411RJ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G44414IQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G44463UK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G44495BT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G44543KU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G44551BR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G44597NW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G44639QZ", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G44772RK", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G44809JX", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G44880NI", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G44907FO", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G44917UQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G45086UC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G45095CF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G45120SG", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G45304XA", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G45335XP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G45362KT", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G45367LB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G45402WV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G45494FB", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G45516VR", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G45565NV", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G45596OR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G45707SN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G45756EL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G45917UD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G45939NL", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G46029TT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G46060BG", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G46168RR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G46174KH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G46360PG", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G46520QG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G46532VN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G46711IU", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G46743AZ", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G46748BU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G46754UT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G46772BG", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G46785SS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G46822ZY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G46823CW", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G46915JA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G46935AJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G47152AG", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G47174QJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G47201SK", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G47307MO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G47459CP", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G47520QY", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G47557KS", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G47560LW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G47709SA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G47772RH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G47925PB", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G48064BJ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G48115DD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G48192XR", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G48265KY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G48355MU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G48367IB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G48375OF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G48440GN", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G48465YI", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G48499NG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G48503ML", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G48533PM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G48638TB", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G48791KW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G48809VN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G48823WJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G48851YP", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G48884SG", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G49077EU", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G49088AN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G49104WF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G49120XR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G49228QV", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G49277CJ", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G49390AT", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G49499OL", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G49508KM", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G49671FR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G49773DF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G49844LC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G49854OS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G49915EH", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G49936GP", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G49944DR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G50003EV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G50192TG", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G50198YU", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G50215WR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G50223FX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G50252SB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G50362JF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G50370PE", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G50425IY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G50482KM", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G50558NC", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G50574FX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G50613GW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G50619VO", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G50652EJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G50685MJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G50762OP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G50769VE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G50808YS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G50809LR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G50896EJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G50905UI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G50937OW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G51018LC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G51103QO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G51131QP", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G51140AE", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G51216AJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G51318YG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G51340HW", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G51343UJ", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G51349BU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G51500KY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G51554PH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G51557QE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G51586EE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G51678TA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G51747SV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G51809TM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G51842SQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G51862BI", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G51883EC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G51911XK", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G51963NX", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G51992CI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G52120NK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G52179YJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G52239LM", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G52262VT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G52273YQ", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G52376IF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G52380IS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G52447UD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G52460PC", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G52515QC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G52558KX", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G52608IK", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G52639VC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G52759XA", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G52794ID", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G52839BU", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G52902AR", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G52960IE", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G52971SZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G53000BS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G53034PL", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G53064IK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G53084TQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G53151WW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G53206FD", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G53208AY", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G53219BI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G53220ZS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G53225BR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G53246IE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G53251NX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G53303ZX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G53396TS", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G53404LB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G53435KM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G53472RQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G53490OS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G53542OI", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G53778MF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G53809VI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G53827VR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G53856PB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G53861OY", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G53869ZZ", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G53880XP", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G53933PW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G54029EI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G54083SI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G54125VH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G54190AS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G54212AC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G54264AR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G54334WY", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G54335XN", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G54394ER", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G54409FD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G54434IR", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G54458VQ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G54513GY", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G54542VV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G54555CN", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G54557YU", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G54561II", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G54567NU", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G54651DQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G54706BB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G54741SP", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G54896JZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G54938LL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G54970OI", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G55043JL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G55051BJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G55104BW", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G55126WZ", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G55144QZ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G55146EO", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G55174HS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G55205VX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G55259BS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G55282VK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G55331YF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G55402MT", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G55480NU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G55487QV", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G55492KC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G55567ZW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G55636WA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G55638XL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G55695AY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G55728EM", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G55870EJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G55880FX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G55967EP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G55986UN", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G56011JM", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G56111FM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G56186MJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G56202KK", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G56285KF", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G56293JI", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G56427WT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G56506GT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G56529CD", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G56575BH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G56657VE", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G56913CG", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G56961QY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G57051HS", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G57068ZS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G57092PW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G57130XG", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G57385MA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G57471CR", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G57545VN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G57592QM", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G57598XN", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G57755LH", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G57772TI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G57836JM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G57872KZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G57949TL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G57993RM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G58006UM", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G58145JY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G58201OX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G58272ZE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G58276QF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G58293BE", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G58386YP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G58402CL", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G58473ZD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G58489YE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G58511VX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G58577QT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G58580BP", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G58582XO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G58590MR", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G58620PN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G58670TY", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G58683GH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G58878NJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G58890ZT", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G58959YB", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G58972ZH", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G59031ZJ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G59103LK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G59155GF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G59306VK", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G59379KN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G59432AC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G59498PG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G59658KK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G59659CN", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G59674PZ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G59712UJ", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G59746EH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G59804FF", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G59930AW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G59944EN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G59951KW", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G59969VC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G59970QL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G59973RN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G59999BN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G60059YM", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G60067UC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G60231EF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G60234BX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G60282OI", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G60341PX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G60437DK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G60457MA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G60461BM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G60558WQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G60603HJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G60615ZD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G60687DB", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G60731ZH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G60734PM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G60741OC", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G60799ZL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G60833BB", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G60884FR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G60890ZT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G60949GI", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G60955ML", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G61009EJ", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G61011QL", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G61119KT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G61159LY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G61339UO", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G61367OF", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G61582HZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G61724IO", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G61730RY", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G61780GR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G61887VA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G61889LW", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G61972DW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G62002KG", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G62014YU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G62044IM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G62070TZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G62081IR", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G62165LJ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G62189UN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G62217NB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G62221RF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G62278MB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G62311FX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G62407IF", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G62437NU", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G62469XB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G62577TV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G62765JV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G63193BW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G63193FF", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G63194GH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G63213PP", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G63258OL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G63286MF", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G63309YY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G63317CA", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G63324SB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G63329SO", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G63404EE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G63416WN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G63427CD", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G63444WV", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G63570GH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G63628UX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G63727WO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G63748AU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G63754TT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G63787FE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G63794QO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G63845LK", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G63946SF", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G63978FG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G64002SF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G64008QI", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G64055WO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G64102JR", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G64164CA", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G64206XB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G64239KZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G64252WT", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G64305XQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G64482PB", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G64485VT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G64563CQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G64566OC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G64575OQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G64577HA", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G64774WV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G64844ET", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G64852XI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G64878VD", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G64881OC", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G64899EB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G64904QS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G64931FF", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G64965PX", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G64973KT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G65037OI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G65085NL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G65124UZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G65249DN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G65262KR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G65321RW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G65348IZ", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G65363PV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G65364FS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G65365ZJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G65369IB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G65396UE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G65408JY", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G65669BM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G65805JY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G65815BT", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G65895VF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G65955VU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G65978JH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G66021ZE", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G66030KY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G66040YD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G66162WI", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G66166BF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G66184ZO", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G66188DL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G66205CG", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G66271TT", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G66360FX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G66367EU", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G66405LD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G66419SM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G66435SV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G66489LJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G66505YL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G66512FS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G66685LA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G66699QG", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G66722AJ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G66741QE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G66772SE", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G66830UP", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G66867PA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G66887YI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G66961JH", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G66977DX", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G66991YE", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G67046QM", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G67053LB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G67174VO", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G67195ED", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G67255LY", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G67281LU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G67300CR", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G67384KH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G67400MO", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G67407NJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G67561OD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G67586UM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G67590LG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G67624GB", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G67650WH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G67686RZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G67693JC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G67775HG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G67796SA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G67821CP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G67883AD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G67920QO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G68007WG", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G68038KC", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G68062BK", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G68074JL", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G68133RV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G68175FX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G68210RO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G68253RD", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G68264WB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G68286QZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G68373VW", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G68384KC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G68391RZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G68529LC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G68614NL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G68636XD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G68639VP", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G68686HN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G68713BO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G68776NM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G68806LA", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G68881YW", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G68894XH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G68951DB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G68990TK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G69052CM", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G69065FL", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G69093SL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G69137GO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G69229KW", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G69233PF", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G69327YC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G69420JU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G69443HY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G69446XZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G69500TM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G69616MR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G69631DE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G69683VZ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G69735UM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G69748TK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G69762CO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G69762TP", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G69774ND", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G69808IK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G69824GC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G69876CC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G69890SN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G69897TU", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G70081ZH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G70125XL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G70422TG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G70479DP", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G70520NA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G70590VH", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G70631UV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G70647PV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G70783BY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G70857WY", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G71091AL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G71094KR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G71121NN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G71174VV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G71234WE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G71306LD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G71338QU", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G71362YO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G71409LF", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G71479KG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G71506JZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G71511JI", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G71586EH", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G71695GL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G71698NY", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G71707QJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G71713QS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G71767XQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G71816WC", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G71835SV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G71958XX", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G71961AV", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G71964JP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G71969OB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G72070EH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G72154SP", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G72175XZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G72289FX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G72304KR", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G72336LC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G72446TS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G72526DQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G72579SX", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G72614KG", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G72620YF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G72647WK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G72693SY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G72745SQ", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G72790LD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G72929XF", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G73328UF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G73330CF", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G73351YM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G73423PD", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G73440TD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G73507OY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G73574DM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G73653TX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G73723ZY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G73829NH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G73971ME", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G74012IM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G74038AG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G74114HO", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G74130BZ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G74130TT", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G74241QD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G74242PX", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G74339LA", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G74396CO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G74463NF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G74471QR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G74473MP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G74484ON", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G74542HC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G74607VK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G74632FV", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G74782FR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G74917JV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G74918VW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G74975UG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G75042KU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G75171WW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G75178DV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G75339KH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G75381CL", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G75407RU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G75500ME", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G75547HK", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G75586OT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G75594JP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G75599HG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G75621PH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G75637RB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G75687SF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G75704MB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G75709RV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G75786FQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G75851ZW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G75868SR", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G75905JY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G75906TR", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G76031FX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G76213KN", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G76299ZG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G76317AM", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G76362LL", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G76387IG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G76389HC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G76420FO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G76431SN", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G76470HC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G76481US", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G76500NB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G76505ZE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G76524PQ", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G76544YY", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G76561LL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G76726PJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G76748ZU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G76763LN", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G76863NB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G76876LB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G76986FH", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G77109JA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G77136XW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G77149IZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G77208XM", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G77218JF", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G77413CE", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G77550KK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G77557JA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G77633IZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G77740PR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G77937PE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G77938VI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G77938WM", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G77960OV", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G78011OA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G78032US", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G78106KK", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G78108ZM", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G78262KC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G78315BS", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G78315FS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G78333MH", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G78519JI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G78657XR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G78695ET", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G78757VY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G78759XX", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G78789AJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G78915OI", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G78992FU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G79017QZ", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G79035QO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G79083TY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G79222ND", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G79243QP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G79364NZ", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G79464QJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G79566BO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G79600DE", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G79745IB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G79762CW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G79855KD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G79878OX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G79915IB", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G79968EZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G80027ER", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G80068SW", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G80147HT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G80176YK", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G80281PU", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G80316IP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G80343TU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G80489MK", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G80618TG", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G80667HT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G80678HX", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G80700YJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G80719YH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G80738PE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G80951VR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G81013HU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G81041HS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G81112MA", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G81115FG", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G81167HN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G81213GH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G81272FZ", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G81303NJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G81471KU", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G81534KB", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G81541IU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G81628EZ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G81632WR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G81680BU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G81725CS", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G81753IL", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G81825YE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G82083TQ", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G82133EG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G82175BQ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G82251ZP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G82264VK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G82285OB", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G82362HL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G82370DV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G82412EH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G82427FY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G82512PT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G82621TY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G82693QG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G82700SN", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G82785ZH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G82790IO", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G82831RJ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G82862JX", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G82952OK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G83092KU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G83134ZR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G83140GU", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G83192EO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G83206CA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G83232LD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G83241PZ", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G83244OE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G83261UB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G83502DX", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G83546KK", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G83561CI", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G83567OS", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G83620XJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G83643ND", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G83754KL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G83831AS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G83843GL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G83952ID", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G83998HE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G84147VQ", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G84168WH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G84184XU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G84228OY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G84273UX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G84366AE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G84398ZW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G84515GE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G84571QT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G84596RP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G84646MS", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G84647SC", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G84821OV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G84853WN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G84958AF", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G84969LS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G85039TI", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G85213IC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G85213NF", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G85284LO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G85284MK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G85302NF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G85313YF", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G85315VP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G85393KI", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G85493TB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G85545QE", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G85633MF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G85670FA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G85721WE", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G85890AG", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G85907UO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G85972YO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G85997RC", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G86013XY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G86083AM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G86085BW", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G86085HN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G86117ZB", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G86167MF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G86199GK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G86239DV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G86372GF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G86537AD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G86557DD", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G86634NY", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G86669AN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G86736BF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G86782PI", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G86871XB", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G87249CK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G87310ZF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G87514QJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G87528ZH", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G87574LM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G87676CC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G87808DX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G87847UQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G87984PA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G88014YP", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G88043PD", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G88050IP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G88089UV", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G88122BX", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G88139CF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G88188XI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G88204LN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G88347ND", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G88366YR", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G88431RN", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G88508SI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G88609PK", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G88624YG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G88678EQ", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G88687UE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G88689KL", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G88696BY", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G88708RX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G88725FA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G88759BF", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G88780VN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G88828CK", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G88837PJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G88856QG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G88975RE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G89058HG", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G89129AU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G89210OT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G89230YO", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G89242LQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G89242PW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G89398MH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G89753PC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G89798IM", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G89816MU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G89990JE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G89996XH", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G90103MR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G90135ZJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G90205AB", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G90221FQ", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G90242XR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G90251SV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G90295ID", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G90350EB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G90402OU", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G90436CB", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G90439ZM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G90451QF", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G90684PC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G90739UE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G90771OP", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G90829NZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G90928ZN", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G90965BZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G90999PU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G90999QY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G91043NZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G91069QW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G91093AL", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G91144VS", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G91161VR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G91166AC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G91181WA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G91313DF", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G91368WO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G91637SF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G91684MM", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G91731DX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G91732VA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G91756JQ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G91945VH", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G92115PW", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G92115RL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G92155IO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G92175OV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G92296LB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G92302BV", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G92318PO", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G92327HS", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G92332SI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G92354TO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G92399AI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G92485YK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G92716MQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G92829RR", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G92982UI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G93045SX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G93088DU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G93090IR", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G93160RG", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G93239VC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G93279YE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G93296CH", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G93333OF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G93450CE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G93461HH", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G93592ZT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G93612YS", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G93627NS", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G93696JX", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G93774RM", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G93801LA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G93861XR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G93984MO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G94058TU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G94062FP", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G94070ID", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G94146NJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G94351CH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G94416QP", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G94502LK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G94514IB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G94517VF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G94541HG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G94566ZN", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G94593TA", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G94595ZZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G94599QJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G94618YC", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G94621HP", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G94627QP", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G94768NG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G94850KK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G94855OA", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G94938LU", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G94941PK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G95003CS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G95151JF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G95292IF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G95304AA", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G95329IQ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G95353IZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G95415HZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G95430GC", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G95448VV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G95532JO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G95593KU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G95706CX", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G95739UA", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G95890CG", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G95925PE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G96005ME", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G96017QA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G96079CK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G96093AA", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G96119TZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G96142QQ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G96334ZO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G96336FY", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G96349RY", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G96373OE", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G96464PC", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G96568SI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G96576RP", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G96576WB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G96599KT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G96643WB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G96691CI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G96758WF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G96763TB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G96950XO", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G97083VO", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G97271OF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G97316FN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G97345NY", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G97413OV", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G97436XI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G97452SL", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G97494HI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G97529OC", "type": "Other", "subtype": "Other" }, { "glytoucan_ac": "G97553OZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G97595JJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G97657WO", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G97777ZK", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G97840DJ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G97841LZ", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G97850YT", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G97863GV", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G98003WW", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G98073MH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G98127AN", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G98308VA", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G98383AS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G98473NJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G98518WL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G98658WC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G98795OG", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G98817QU", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G98873GM", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G98891IZ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G98912YW", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G98925GS", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G98940EW", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G98977CH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G99039KB", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G99041XF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G99137GH", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G99236CU", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G99244AI", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G99264QJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G99281CN", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G99354AR", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G99372JL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G99402IB", "type": "O-linked", "subtype": "Core 3" }, { "glytoucan_ac": "G99435JQ", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G99448MJ", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G99466GU", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G99507PM", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G99517NL", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G99567UC", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G99730GF", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G99738HT", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G99738PW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G99785MW", "type": "O-linked", "subtype": "Core 2" }, { "glytoucan_ac": "G99792ZO", "type": "O-linked", "subtype": "Core 4" }, { "glytoucan_ac": "G99893CA", "type": "O-linked", "subtype": "Core 6" }, { "glytoucan_ac": "G99987ZQ", "type": "O-linked", "subtype": "Core 2" } ], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [ 220, 335 ], "o_linked_sites": [ 62, 69 ], "snv_sites": [ 69, 220, 254, 335 ], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 220, "end_pos": 222 }, { "start_pos": 335, "end_pos": 337 }, { "start_pos": 4, "end_pos": 6 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 2 }, { "field": "o_linked_glycan_sites", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 2 }, { "field": "o_linked_glycan_sites", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 52 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }