{ "uniprot_canonical_ac": "O60499-1", "uniprot_ac": "O60499", "uniprot_id": "STX10_HUMAN", "mass": { "chemical_mass": 28114.0, "monoisotopic_mass": 28114.0 }, "refseq": { "ac": "NP_001258540", "name": "syntaxin-10 isoform 4", "summary": "This gene belongs to the syntaxin family and encodes a soluble N-ethylmaleimide sensitive factor attachment protein receptor (SNARE). The encoded protein is involved in docking and fusion events at the Golgi apparatus. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2012].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001258540" }, "gene_names": [ { "name": "STX10", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O60499", "id": "O60499" }, { "name": "STX10", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001258540", "id": "NP_001258540" }, { "name": "SYN10", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O60499", "id": "O60499" }, { "name": "hsyn10; SYN10", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001258540", "id": "NP_001258540" } ], "protein_names": [ { "name": "Syntaxin-10", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O60499" }, { "name": "Syn10", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O60499" }, { "name": "syntaxin-10 isoform 4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001258540", "id": "NP_001258540" } ], "function": [ { "annotation": "Loss of syntaxin 10 leads to defects in normal chlamydial maturation including: variable inclusion size with fewer chlamydial organisms per inclusion, fewer infectious progeny, and delayed or halted reticulate body-elementary body differentiation. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001258540", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001258540" }, { "database": "PubMed", "id": "26442221", "url": "https://glygen.org/publication/PubMed/26442221" } ] }, { "annotation": "May have a hitherto unrecognized function in the trans-Golgi network-endosome boundary. Erratum:[Mol Membr Biol. 2005 Sep-Oct;22(5):453]", "evidence": [ { "database": "RefSeq", "id": "NP_001258540", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001258540" }, { "database": "PubMed", "id": "16154903", "url": "https://glygen.org/publication/PubMed/16154903" } ] }, { "annotation": "SNARE involved in vesicular transport from the late endosomes to the trans-Golgi network.", "evidence": [ { "database": "UniProtKB", "id": "O60499", "url": "https://www.uniprot.org/uniprot/O60499#function" }, { "database": "PubMed", "id": "18195106", "url": "https://glygen.org/publication/PubMed/18195106" } ] }, { "annotation": "This gene belongs to the syntaxin family and encodes a soluble N-ethylmaleimide sensitive factor attachment protein receptor (SNARE). The encoded protein is involved in docking and fusion events at the Golgi apparatus. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2012].", "evidence": [ { "database": "RefSeq", "id": "NP_001258540", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001258540" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "86.6", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000104915", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000104915" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "81.43", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000104915", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000104915" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "85.85", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000104915", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000104915" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "72.12", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000104915", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000104915" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "92.2", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000104915", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000104915" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "89.25", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000104915", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000104915" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "80.85", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000104915", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000104915" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "86.97", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000104915", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000104915" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "92.42", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000104915", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000104915" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "74.9", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000104915", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000104915" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "86.34", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000104915", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000104915" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "94", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000104915", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000104915" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "94.07", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000104915", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000104915" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O60499", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60499" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O60499", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60499" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O60499", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60499" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O60499", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60499" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O60499", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60499" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O60499", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60499" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O60499", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60499" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O60499", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60499" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O60499", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60499" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O60499", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60499" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O60499", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60499" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O60499", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60499" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O60499", "url": "https://www.uniprot.org/uniprot/O60499" } ], "common_name": "Human" } ], "gene": [ { "name": "STX10", "url": "https://www.uniprot.org/uniprot/O60499", "locus": { "chromosome": "19", "start_pos": 13144058, "end_pos": 13150383, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000104915", "url": "https://www.ensembl.org/id/ENSG00000104915" } ] } } ], "crossref": [ { "id": "ENSG00000104915", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000104915", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd15851", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd15851", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd21446", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd21446", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "STX10", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=STX10", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "8677", "url": "https://www.ncbi.nlm.nih.gov/gene/8677", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "11428", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=11428", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O60499", "url": "https://www.ebi.ac.uk/intact/interactors/id:O60499*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000727", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000727", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006012", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006012", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR010989", "url": "https://www.ebi.ac.uk/interpro/entry/IPR010989", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR015260", "url": "https://www.ebi.ac.uk/interpro/entry/IPR015260", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR045242", "url": "https://www.ebi.ac.uk/interpro/entry/IPR045242", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:8677", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:8677", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "603765", "url": "http://www.omim.org/entry/603765", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O60499", "url": "https://www.nextprot.org/entry/NX_O60499", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "FHEAKHE", "url": "https://omabrowser.org/oma/group/FHEAKHE/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "588552at2759", "url": "http://www.orthodb.org/?query=588552at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR12791", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12791", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12791:SF60", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12791:SF60", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR19957", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR19957", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR19957:SF106", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR19957:SF106", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "4DND", "url": "https://www.rcsb.org/structure/4DND", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF05739", "url": "http://pfam.xfam.org/family/PF05739", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF09177", "url": "http://pfam.xfam.org/family/PF09177", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O60499", "url": "https://pharos.nih.gov/targets/O60499", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O60499", "url": "http://purl.obolibrary.org/obo/PR_O60499", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001258540", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001258540", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "F6RTM7", "url": "https://www.uniprot.org/uniprot/F6RTM7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F6RTM7-1", "url": "https://www.uniprot.org/uniprot/F6RTM7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K7EIY4", "url": "https://www.uniprot.org/uniprot/K7EIY4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K7EIY4-1", "url": "https://www.uniprot.org/uniprot/K7EIY4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K7EJ05", "url": "https://www.uniprot.org/uniprot/K7EJ05", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K7EJ05-1", "url": "https://www.uniprot.org/uniprot/K7EJ05-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K7EK75", "url": "https://www.uniprot.org/uniprot/K7EK75", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K7EK75-1", "url": "https://www.uniprot.org/uniprot/K7EK75-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K7ELY2", "url": "https://www.uniprot.org/uniprot/K7ELY2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K7ELY2-1", "url": "https://www.uniprot.org/uniprot/K7ELY2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K7EPP9", "url": "https://www.uniprot.org/uniprot/K7EPP9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K7EPP9-1", "url": "https://www.uniprot.org/uniprot/K7EPP9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K7EQ84", "url": "https://www.uniprot.org/uniprot/K7EQ84", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "K7EQ84-1", "url": "https://www.uniprot.org/uniprot/K7EQ84-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O60499", "url": "https://www.uniprot.org/uniprot/O60499", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O60499-1", "url": "https://www.uniprot.org/uniprot/O60499-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O60499-2", "url": "https://www.uniprot.org/uniprot/O60499-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5U8S2", "url": "https://www.uniprot.org/uniprot/Q5U8S2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5U8S2-1", "url": "https://www.uniprot.org/uniprot/Q5U8S2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "X6R2W0", "url": "https://www.uniprot.org/uniprot/X6R2W0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "X6R2W0-1", "url": "https://www.uniprot.org/uniprot/X6R2W0-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSLEDPFFVVRGEVQKAVNTARGLYQRWCELLQESAAVGREELDWTTNELRNGLRSIEWDLEDLEETIGIVEANPGKFKLPAGDLQERKVFVERMREAVQEMKDHMVSPTAVAFLERNNREILAGKPAAQKSPSDLLDASAVSATSRYIEEQQATQQLIMDEQDQQLEMVSGSIQVLKHMSGRVGEELDEQGIMLDAFAQEMDHTQSRMDGVLRKLAKVSHMTSDRRQWCAIAVLVGVLLLVLILLFSL", "length": 249, "header": "sp|O60499-1|STX10_HUMAN Isoform 1 of Syntaxin-10 OS=Homo sapiens OX=9606 GN=STX10 PE=1 SV=1 CANONICAL=O60499-1" }, "isoforms": [ { "isoform_ac": "F6RTM7-1", "url": "", "sequence": { "sequence": "MSLEDPFFVVRGEVQKAVNTARGLYQRWCELLQESAAVGREELDWTTNELRNGLRSIEWDLEDLEETIVSAHV", "length": 73, "header": "tr|F6RTM7-1|STX10_HUMAN Computationally mapped isoform of Syntaxin-10 OS=Homo sapiens OX=9606 GN=STX10 PE=1 SV=1 CANONICAL=O60499-1" }, "locus": { "chromosome": "19", "start_pos": 13150173, "end_pos": 13149591, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000440593.3", "url": "https://www.ensembl.org/id/ENST00000440593.3" }, { "database": "Ensembl Peptide", "id": "ENSP00000415176.3", "url": "https://www.ensembl.org/id/ENSP00000415176.3" } ] } }, { "isoform_ac": "K7EIY4-1", "url": "", "sequence": { "sequence": "XAVNTARGLYQRWCELLQESAAVGREELDWTTNELRNGLRSIEWDLEDLEETIGIVEANPGKFKLPAGDLQERKVFVERMREAVQEMKDHMVSPTAVAFLERNNREILAGKPAAQKSPSDLLDASAVSATSRYIEEQQATQQLIMDEQDQQLEMVSGSIQVLKHMSGRVGEELDEQGIMLDAFAQEMDHTQSRMDGVLRKLAKVSHMTSVPGPQSHLPLCLIHVPTWK", "length": 228, "header": "tr|K7EIY4-1|STX10_HUMAN Computationally mapped isoform of Syntaxin-10 OS=Homo sapiens OX=9606 GN=STX10 PE=1 SV=1 CANONICAL=O60499-1" }, "locus": { "chromosome": "19", "start_pos": 13149885, "end_pos": 13144082, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000587318.5", "url": "https://www.ensembl.org/id/ENST00000587318.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000464943.1", "url": "https://www.ensembl.org/id/ENSP00000464943.1" } ] } }, { "isoform_ac": "K7EJ05-1", "url": "", "sequence": { "sequence": "MREAVQEMKDHMVSPTAVAFLERNNREILAGKPAAQKSPSDLLDASAVSATSRYIEEQ", "length": 58, "header": "tr|K7EJ05-1|STX10_HUMAN Computationally mapped isoform of Syntaxin-10 OS=Homo sapiens OX=9606 GN=STX10 PE=1 SV=1 CANONICAL=O60499-1" }, "locus": { "chromosome": "19", "start_pos": 13149516, "end_pos": 13145303, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000591197.1", "url": "https://www.ensembl.org/id/ENST00000591197.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000464970.1", "url": "https://www.ensembl.org/id/ENSP00000464970.1" } ] } }, { "isoform_ac": "K7EK75-1", "url": "", "sequence": { "sequence": "MSLEDPFFVVRGEVQKAVNTARGLYQRWCELLQESAAVGREELDWTTNELRNGLRSIEWDLEDLEETIDILGLYTRRQASCPEVTQRPAGCQRSLGHISLHRGAAGHTAADHG", "length": 113, "header": "tr|K7EK75-1|STX10_HUMAN Computationally mapped isoform of Syntaxin-10 OS=Homo sapiens OX=9606 GN=STX10 PE=1 SV=1 CANONICAL=O60499-1" }, "locus": { "chromosome": "19", "start_pos": 13150173, "end_pos": 13144860, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000591843.1", "url": "https://www.ensembl.org/id/ENST00000591843.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000465495.1", "url": "https://www.ensembl.org/id/ENSP00000465495.1" } ] } }, { "isoform_ac": "K7ELY2-1", "url": "", "sequence": { "sequence": "LQESAAVGREELDWTTNELRNGLRSIEWDLEDLEETIGIVEANPGKFKLPAGDLQERKVFVERMREAVQEMKDHMVSPTAVAFLERNNREILAGKPAAQKSPSDLLDASAVSATSRYIEEQQATQQLIMDEQDQQLEMVSGSIQVLKHMSGRVGEELDEQGIMLDAFAQEMDHTQSRMDGVLRKLAKVSHMTSALPGRLVP", "length": 201, "header": "tr|K7ELY2-1|K7ELY2_HUMAN Computationally mapped isoform of Syntaxin 10 OS=Homo sapiens OX=9606 GN=STX10 PE=1 SV=1 CANONICAL=O60499-1" }, "locus": { "chromosome": "19", "start_pos": 13149839, "end_pos": 13144381, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000593126.5", "url": "https://www.ensembl.org/id/ENST00000593126.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000466272.1", "url": "https://www.ensembl.org/id/ENSP00000466272.1" } ] } }, { "isoform_ac": "K7EPP9-1", "url": "", "sequence": { "sequence": "MREAVQEMKDHMVSPTAVAFLERNNREILAGKPAAQKSPSDLLDASAVSATSRYIEEQQATQQLIMDEQDQQLEMVSGSIQVLKHMSGRVGEELDEQGIMLDAFAQEMDHTQSRMDGVLRKL", "length": 122, "header": "tr|K7EPP9-1|STX10_HUMAN Computationally mapped isoform of Syntaxin-10 OS=Homo sapiens OX=9606 GN=STX10 PE=1 SV=1 CANONICAL=O60499-1" }, "locus": { "chromosome": "19", "start_pos": 13149516, "end_pos": 13144602, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000588848.5", "url": "https://www.ensembl.org/id/ENST00000588848.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000467479.1", "url": "https://www.ensembl.org/id/ENSP00000467479.1" } ] } }, { "isoform_ac": "K7EQ84-1", "url": "", "sequence": { "sequence": "XCCVPLQILAGKPAAQKSPSDLLDASAVSATSRYIEEQQATQQLIMDEQDQQLEMVSGSIQVLKHMSGRVGEELDEQGIMLDAFAQEMDHTQSRMDG", "length": 97, "header": "tr|K7EQ84-1|K7EQ84_HUMAN Computationally mapped isoform of Syntaxin 10 OS=Homo sapiens OX=9606 GN=STX10 PE=1 SV=8 CANONICAL=O60499-1" }, "locus": { "chromosome": "19", "start_pos": 13145414, "end_pos": 13144615, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000591415.1", "url": "https://www.ensembl.org/id/ENST00000591415.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000467713.1", "url": "https://www.ensembl.org/id/ENSP00000467713.1" } ] } }, { "isoform_ac": "O60499-1", "url": "", "sequence": { "sequence": "MSLEDPFFVVRGEVQKAVNTARGLYQRWCELLQESAAVGREELDWTTNELRNGLRSIEWDLEDLEETIGIVEANPGKFKLPAGDLQERKVFVERMREAVQEMKDHMVSPTAVAFLERNNREILAGKPAAQKSPSDLLDASAVSATSRYIEEQQATQQLIMDEQDQQLEMVSGSIQVLKHMSGRVGEELDEQGIMLDAFAQEMDHTQSRMDGVLRKLAKVSHMTSDRRQWCAIAVLVGVLLLVLILLFSL", "length": 249, "header": "sp|O60499-1|STX10_HUMAN Isoform 1 of Syntaxin-10 OS=Homo sapiens OX=9606 GN=STX10 PE=1 SV=1 CANONICAL=O60499-1" }, "locus": { "chromosome": "19", "start_pos": 13150173, "end_pos": 13144413, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000587230.6", "url": "https://www.ensembl.org/id/ENST00000587230.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000466298.1", "url": "https://www.ensembl.org/id/ENSP00000466298.1" } ] } }, { "isoform_ac": "O60499-2", "url": "", "sequence": { "sequence": "MSLEDPFFVVRGEVQKAVNTARGLYQRWCELLQESAAVGREELDWTTNELRNGLRSIEWDLEDLEETIGIVEANPGKPAAQKSPSDLLDASAVSATSRYIEEQQATQQLIMDEQDQQLEMVSGSIQVLKHMSGRVGEELDEQGIMLDAFAQEMDHTQSRMDGVLRKLAKVSHMTSDRRQWCAIAVLVGVLLLVLILLFSL", "length": 200, "header": "sp|O60499-2|STX10_HUMAN Isoform 2 of Syntaxin-10 OS=Homo sapiens OX=9606 GN=STX10 PE=1 SV=1 CANONICAL=O60499-1" }, "locus": { "chromosome": "19", "start_pos": 13150173, "end_pos": 13144413, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000343587.9", "url": "https://www.ensembl.org/id/ENST00000343587.9" }, { "database": "Ensembl Peptide", "id": "ENSP00000339350.4", "url": "https://www.ensembl.org/id/ENSP00000339350.4" } ] } }, { "isoform_ac": "Q5U8S2-1", "url": "", "sequence": { "sequence": "MSLEDPFFVVRGEVQKAVNTARGLYQRWCELLQESAAVGREELDWTTNELRNGLRSIEWDLEDLEETIGIVEANPGKFKLPAGDLQERKVFVERMREAVQEMKDHMVSPTAVAFLERNNREILAGKPAAQKSPSDLLDASAVSATSRYIEEQQATQQLIMDEQDQQLEMVSGSIQVLKHMSGRVGEELDEQGIMLDAFAQEMDHTQSRMDGVLRKLAKVSHMTSGESPQGRGQSWWGQVVGGTLSP", "length": 246, "header": "tr|Q5U8S2-1|STX10_HUMAN Computationally mapped isoform of Syntaxin-10 OS=Homo sapiens OX=9606 GN=STX10 PE=1 SV=1 CANONICAL=O60499-1" }, "locus": { "chromosome": "19", "start_pos": 13150173, "end_pos": 13144512, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000589083.5", "url": "https://www.ensembl.org/id/ENST00000589083.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000465398.1", "url": "https://www.ensembl.org/id/ENSP00000465398.1" } ] } }, { "isoform_ac": "X6R2W0-1", "url": "", "sequence": { "sequence": "MSLEDPFFVVRGEVQKAVNTARGLYQRWCELLQESAAVGREELDWTTNELRNGLRSIEWDLEDLEETIGIVEANPGKFKLPAGDLQERKVFVERMREAVQEMKDHMVSPTAVAFLERNNREILAGKPAAQKSPSDLLDASAVSATSRYIEEQQATQQLIMDEQDQQLEMVSGSIQVLKHMSGRVGEELDEQACWMPSPKRWTTPSPAWTGSSGSWPKYPT", "length": 220, "header": "tr|X6R2W0-1|X6R2W0_HUMAN Computationally mapped isoform of Syntaxin 10 OS=Homo sapiens OX=9606 GN=STX10 PE=1 SV=1 CANONICAL=O60499-1" }, "locus": { "chromosome": "19", "start_pos": 13150173, "end_pos": 13144586, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000242770.9", "url": "https://www.ensembl.org/id/ENST00000242770.9" }, { "database": "Ensembl Peptide", "id": "ENSP00000242770.5", "url": "https://www.ensembl.org/id/ENSP00000242770.5" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 108, "end_pos": 108, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O60499", "url": "https://www.uniprot.org/uniprot/O60499" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O60499", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60499" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "phospho.ELM", "id": "O60499", "url": "http://phospho.elm.eu.org/byAccession/O60499.html" } ], "site_lbl": "Ser108" }, { "start_pos": 110, "end_pos": 110, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "O60499", "url": "https://www.uniprot.org/uniprot/O60499" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "iPTMnet", "id": "O60499", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60499" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" } ], "site_lbl": "Thr110" }, { "start_pos": 132, "end_pos": 132, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O60499", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60499" }, { "database": "PubMed", "id": "18578522", "url": "https://glygen.org/publication/PubMed/18578522" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "20166139", "url": "https://glygen.org/publication/PubMed/20166139" }, { "database": "PubMed", "id": "20230923", "url": "https://glygen.org/publication/PubMed/20230923" }, { "database": "phospho.ELM", "id": "O60499", "url": "http://phospho.elm.eu.org/byAccession/O60499.html" } ], "site_lbl": "Ser132" }, { "start_pos": 134, "end_pos": 134, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O60499", "url": "https://www.uniprot.org/uniprot/O60499" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "iPTMnet", "id": "O60499", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60499" }, { "database": "PubMed", "id": "18578522", "url": "https://glygen.org/publication/PubMed/18578522" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "20058876", "url": "https://glygen.org/publication/PubMed/20058876" }, { "database": "PubMed", "id": "20230923", "url": "https://glygen.org/publication/PubMed/20230923" }, { "database": "phospho.ELM", "id": "O60499", "url": "http://phospho.elm.eu.org/byAccession/O60499.html" } ], "site_lbl": "Ser134" }, { "start_pos": 140, "end_pos": 140, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O60499", "url": "https://www.uniprot.org/uniprot/O60499" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "iPTMnet", "id": "O60499", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60499" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "phospho.ELM", "id": "O60499", "url": "http://phospho.elm.eu.org/byAccession/O60499.html" } ], "site_lbl": "Ser140" }, { "start_pos": 143, "end_pos": 143, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O60499", "url": "https://www.uniprot.org/uniprot/O60499" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" }, { "database": "iPTMnet", "id": "O60499", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60499" }, { "database": "phospho.ELM", "id": "O60499", "url": "http://phospho.elm.eu.org/byAccession/O60499.html" } ], "site_lbl": "Ser143" }, { "start_pos": 2, "end_pos": 2, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O60499", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60499" }, { "database": "PubMed", "id": "18578522", "url": "https://glygen.org/publication/PubMed/18578522" } ], "site_lbl": "Ser2" } ], "glycation": [], "keywords": [], "publication": [ { "title": "A novel Rab6-interacting domain defines a family of Golgi-targeted coiled-coil proteins.", "journal": "Current biology : CB", "date": "1999", "authors": "Barr FA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "10209123", "url": "https://glygen.org/publication/PubMed/10209123" } ] }, { "title": "NSF N-terminal domain crystal structure: models of NSF function.", "journal": "Molecular cell", "date": "1999", "authors": "Yu RC, Jahn R, Brunger AT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "10445031", "url": "https://glygen.org/publication/PubMed/10445031" } ] }, { "title": "An NSF function distinct from ATPase-dependent SNARE disassembly is essential for Golgi membrane fusion.", "journal": "Nature cell biology", "date": "1999", "authors": "Muller JM, Rabouille C, Newman R, Shorter J, Freemont P, Schiavo G, Warren G, Shima DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "10559959", "url": "https://glygen.org/publication/PubMed/10559959" } ] }, { "title": "Vps52p, Vps53p, and Vps54p form a novel multisubunit complex required for protein sorting at the yeast late Golgi.", "journal": "Molecular biology of the cell", "date": "2000", "authors": "Conibear E, Stevens TH", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "10637310", "url": "https://glygen.org/publication/PubMed/10637310" } ] }, { "title": "Multiple aspects of Rab protein action in the secretory pathway: focus on Rab3 and Rab6.", "journal": "Biochimie", "date": "2000", "authors": "Darchen F, Goud B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "10865125", "url": "https://glygen.org/publication/PubMed/10865125" } ] }, { "title": "Ric1p and Rgp1p form a complex that catalyses nucleotide exchange on Ypt6p.", "journal": "The EMBO journal", "date": "2000", "authors": "Siniossoglou S, Peak-Chew SY, Pelham HR", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "10990452", "url": "https://glygen.org/publication/PubMed/10990452" } ] }, { "title": "ADP-ribosylation factors (ARFs) and ARF-like 1 (ARL1) have both specific and shared effectors: characterizing ARL1-binding proteins.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Van Valkenburgh H, Shern JF, Sharer JD, Zhu X, Kahn RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "11303027", "url": "https://glygen.org/publication/PubMed/11303027" } ] }, { "title": "The structural basis of Arfaptin-mediated cross-talk between Rac and Arf signalling pathways.", "journal": "Nature", "date": "2001", "authors": "Tarricone C, Xiao B, Justin N, Walker PA, Rittinger K, Gamblin SJ, Smerdon SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "11346801", "url": "https://glygen.org/publication/PubMed/11346801" } ] }, { "title": "Role of Rab9 GTPase in facilitating receptor recruitment by TIP47.", "journal": "Science (New York, N.Y.)", "date": "2001", "authors": "Carroll KS, Hanna J, Simon I, Krise J, Barbero P, Pfeffer SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "11359012", "url": "https://glygen.org/publication/PubMed/11359012" } ] }, { "title": "An effector of Ypt6p binds the SNARE Tlg1p and mediates selective fusion of vesicles with late Golgi membranes.", "journal": "The EMBO journal", "date": "2001", "authors": "Siniossoglou S, Pelham HR", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "11689439", "url": "https://glygen.org/publication/PubMed/11689439" } ] }, { "title": "Visualization of Rab9-mediated vesicle transport from endosomes to the trans-Golgi in living cells.", "journal": "The Journal of cell biology", "date": "2002", "authors": "Barbero P, Bittova L, Pfeffer SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "11827983", "url": "https://glygen.org/publication/PubMed/11827983" } ] }, { "title": "Early/recycling endosomes-to-TGN transport involves two SNARE complexes and a Rab6 isoform.", "journal": "The Journal of cell biology", "date": "2002", "authors": "Mallard F, Tang BL, Galli T, Tenza D, Saint-Pol A, Yue X, Antony C, Hong W, Goud B, Johannes L", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "11839770", "url": "https://glygen.org/publication/PubMed/11839770" } ] }, { "title": "Sequential SNARE disassembly and GATE-16-GOS-28 complex assembly mediated by distinct NSF activities drives Golgi membrane fusion.", "journal": "The Journal of cell biology", "date": "2002", "authors": "Muller JM, Shorter J, Newman R, Deinhardt K, Sagiv Y, Elazar Z, Warren G, Shima DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "12070132", "url": "https://glygen.org/publication/PubMed/12070132" } ] }, { "title": "Vps51p links the VFT complex to the SNARE Tlg1p.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Siniossoglou S, Pelham HR", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "12377769", "url": "https://glygen.org/publication/PubMed/12377769" } ] }, { "title": "Golgi recruitment of GRIP domain proteins by Arf-like GTPase 1 is regulated by Arf-like GTPase 3.", "journal": "Current biology : CB", "date": "2003", "authors": "Setty SR, Shin ME, Yoshino A, Marks MS, Burd CG", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "12620188", "url": "https://glygen.org/publication/PubMed/12620188" } ] }, { "title": "The ARF-like GTPases Arl1p and Arl3p act in a pathway that interacts with vesicle-tethering factors at the Golgi apparatus.", "journal": "Current biology : CB", "date": "2003", "authors": "Panic B, Whyte JR, Munro S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "12620189", "url": "https://glygen.org/publication/PubMed/12620189" } ] }, { "title": "Structural basis for Arl1-dependent targeting of homodimeric GRIP domains to the Golgi apparatus.", "journal": "Molecular cell", "date": "2003", "authors": "Panic B, Perisic O, Veprintsev DB, Williams RL, Munro S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "14580338", "url": "https://glygen.org/publication/PubMed/14580338" } ] }, { "title": "Structural basis for recruitment of GRIP domain golgin-245 by small GTPase Arl1.", "journal": "Nature structural & molecular biology", "date": "2004", "authors": "Wu M, Lu L, Hong W, Song H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "14718928", "url": "https://glygen.org/publication/PubMed/14718928" } ] }, { "title": "Implication of ZW10 in membrane trafficking between the endoplasmic reticulum and Golgi.", "journal": "The EMBO journal", "date": "2004", "authors": "Hirose H, Arasaki K, Dohmae N, Takio K, Hatsuzawa K, Nagahama M, Tani K, Yamamoto A, Tohyama M, Tagaya M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "15029241", "url": "https://glygen.org/publication/PubMed/15029241" } ] }, { "title": "Multiple binding proteins suggest diverse functions for the N-ethylmaleimide sensitive factor.", "journal": "Journal of structural biology", "date": "2004", "authors": "Whiteheart SW, Matveeva EA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "15037235", "url": "https://glygen.org/publication/PubMed/15037235" } ] }, { "title": "Targeting of the Arf-like GTPase Arl3p to the Golgi requires N-terminal acetylation and the membrane protein Sys1p.", "journal": "Nature cell biology", "date": "2004", "authors": "Behnia R, Panic B, Whyte JR, Munro S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "15077113", "url": "https://glygen.org/publication/PubMed/15077113" } ] }, { "title": "Golgi targeting of ARF-like GTPase Arl3p requires its Nalpha-acetylation and the integral membrane protein Sys1p.", "journal": "Nature cell biology", "date": "2004", "authors": "Setty SR, Strochlic TI, Tong AH, Boone C, Burd CG", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "15077114", "url": "https://glygen.org/publication/PubMed/15077114" } ] }, { "title": "TMF is a golgin that binds Rab6 and influences Golgi morphology.", "journal": "BMC cell biology", "date": "2004", "authors": "Fridmann-Sirkis Y, Siniossoglou S, Pelham HR", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "15128430", "url": "https://glygen.org/publication/PubMed/15128430" } ] }, { "title": "Autoantigen Golgin-97, an effector of Arl1 GTPase, participates in traffic from the endosome to the trans-golgi network.", "journal": "Molecular biology of the cell", "date": "2004", "authors": "Lu L, Tai G, Hong W", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "15269279", "url": "https://glygen.org/publication/PubMed/15269279" } ] }, { "title": "Regulation of microtubule-dependent recycling at the trans-Golgi network by Rab6A and Rab6A'.", "journal": "Molecular biology of the cell", "date": "2005", "authors": "Young J, Stauber T, del Nery E, Vernos I, Pepperkok R, Nilsson T", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "15483056", "url": "https://glygen.org/publication/PubMed/15483056" } ] }, { "title": "The trans-Golgi network GRIP-domain proteins form alpha-helical homodimers.", "journal": "The Biochemical journal", "date": "2005", "authors": "Luke MR, Houghton F, Perugini MA, Gleeson PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "15654769", "url": "https://glygen.org/publication/PubMed/15654769" } ] }, { "title": "Cisternal rab proteins regulate Golgi apparatus redistribution in response to hypotonic stress.", "journal": "Molecular biology of the cell", "date": "2005", "authors": "Jiang S, Storrie B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "15758030", "url": "https://glygen.org/publication/PubMed/15758030" } ] }, { "title": "tGolgin-1 (p230, golgin-245) modulates Shiga-toxin transport to the Golgi and Golgi motility towards the microtubule-organizing centre.", "journal": "Journal of cell science", "date": "2005", "authors": "Yoshino A, Setty SR, Poynton C, Whiteman EL, Saint-Pol A, Burd CG, Johannes L, Holzbaur EL, Koval M, McCaffery JM, Marks MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "15870108", "url": "https://glygen.org/publication/PubMed/15870108" } ] }, { "title": "Characterization of the human GARP (Golgi associated retrograde protein) complex.", "journal": "Exp. Cell Res.", "date": "2005", "authors": "Liewen H, Meinhold-Heerlein I, Oliveira V, Schwarzenbacher R, Luo G, Wadle A, Jung M, Pfreundschuh M, Stenner-Liewen F", "evidence": [ { "database": "UniProtKB", "id": "O60499", "url": "https://www.uniprot.org/uniprot/O60499" }, { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "15878329", "url": "https://glygen.org/publication/PubMed/15878329" } ] }, { "title": "The Arf-like GTPase Arl1 and its role in membrane traffic.", "journal": "Biochemical Society transactions", "date": "2005", "authors": "Munro S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "16042553", "url": "https://glygen.org/publication/PubMed/16042553" } ] }, { "title": "Roles of ARFRP1 (ADP-ribosylation factor-related protein 1) in post-Golgi membrane trafficking.", "journal": "Journal of cell science", "date": "2005", "authors": "Shin HW, Kobayashi H, Kitamura M, Waguri S, Suganuma T, Uchiyama Y, Nakayama K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "16129887", "url": "https://glygen.org/publication/PubMed/16129887" } ] }, { "title": "Trans-Golgi network syntaxin 10 functions distinctly from syntaxins 6 and 16.", "journal": "Molecular membrane biology", "date": "2005", "authors": "Wang Y, Tai G, Lu L, Johannes L, Hong W, Tang BL", "evidence": [ { "database": "RefSeq", "id": "NP_001258540", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001258540" } ], "reference": [ { "type": "PubMed", "id": "16154903", "url": "https://glygen.org/publication/PubMed/16154903" } ] }, { "title": "RINT-1 regulates the localization and entry of ZW10 to the syntaxin 18 complex.", "journal": "Molecular biology of the cell", "date": "2006", "authors": "Arasaki K, Taniguchi M, Tani K, Tagaya M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "16571679", "url": "https://glygen.org/publication/PubMed/16571679" } ] }, { "title": "A functional role for the GCC185 golgin in mannose 6-phosphate receptor recycling.", "journal": "Molecular biology of the cell", "date": "2006", "authors": "Reddy JV, Burguete AS, Sridevi K, Ganley IG, Nottingham RM, Pfeffer SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "16885419", "url": "https://glygen.org/publication/PubMed/16885419" } ] }, { "title": "SNAREs--engines for membrane fusion.", "journal": "Nature reviews. Molecular cell biology", "date": "2006", "authors": "Jahn R, Scheller RH", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "16912714", "url": "https://glygen.org/publication/PubMed/16912714" } ] }, { "title": "Retrograde transport from endosomes to the trans-Golgi network.", "journal": "Nature reviews. Molecular cell biology", "date": "2006", "authors": "Bonifacino JS, Rojas R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "16936697", "url": "https://glygen.org/publication/PubMed/16936697" } ] }, { "title": "Multiple and stepwise interactions between coatomer and ADP-ribosylation factor-1 (Arf1)-GTP.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2007", "authors": "Sun Z, Anderl F, Frohlich K, Zhao L, Hanke S, Brugger B, Wieland F, Bethune J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "17451557", "url": "https://glygen.org/publication/PubMed/17451557" } ] }, { "title": "The trans-Golgi network golgin, GCC185, is required for endosome-to-Golgi transport and maintenance of Golgi structure.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2007", "authors": "Derby MC, Lieu ZZ, Brown D, Stow JL, Goud B, Gleeson PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "17488291", "url": "https://glygen.org/publication/PubMed/17488291" } ] }, { "title": "Specific Rab GTPase-activating proteins define the Shiga toxin and epidermal growth factor uptake pathways.", "journal": "The Journal of cell biology", "date": "2007", "authors": "Fuchs E, Haas AK, Spooner RA, Yoshimura S, Lord JM, Barr FA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "17562788", "url": "https://glygen.org/publication/PubMed/17562788" } ] }, { "title": "Analysis of GTPase-activating proteins: Rab1 and Rab43 are key Rabs required to maintain a functional Golgi complex in human cells.", "journal": "Journal of cell science", "date": "2007", "authors": "Haas AK, Yoshimura S, Stephens DJ, Preisinger C, Fuchs E, Barr FA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "17684057", "url": "https://glygen.org/publication/PubMed/17684057" } ] }, { "title": "Functional involvement of TMF/ARA160 in Rab6-dependent retrograde membrane traffic.", "journal": "Experimental cell research", "date": "2007", "authors": "Yamane J, Kubo A, Nakayama K, Yuba-Kubo A, Katsuno T, Tsukita S, Tsukita S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "17698061", "url": "https://glygen.org/publication/PubMed/17698061" } ] }, { "title": "A syntaxin 10-SNARE complex distinguishes two distinct transport routes from endosomes to the trans-Golgi in human cells.", "journal": "The Journal of cell biology", "date": "2008", "authors": "Ganley IG, Espinosa E, Pfeffer SR", "evidence": [ { "database": "UniProtKB", "id": "O60499", "url": "https://www.uniprot.org/uniprot/O60499" }, { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "18195106", "url": "https://glygen.org/publication/PubMed/18195106" } ] }, { "title": "Rab and Arl GTPase family members cooperate in the localization of the golgin GCC185.", "journal": "Cell", "date": "2008", "authors": "Burguete AS, Fenn TD, Brunger AT, Pfeffer SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "18243103", "url": "https://glygen.org/publication/PubMed/18243103" } ] }, { "title": "Large scale screening for novel rab effectors reveals unexpected broad Rab binding specificity.", "journal": "Molecular & cellular proteomics : MCP", "date": "2008", "authors": "Fukuda M, Kanno E, Ishibashi K, Itoh T", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "18256213", "url": "https://glygen.org/publication/PubMed/18256213" } ] }, { "title": "Requirement of the human GARP complex for mannose 6-phosphate-receptor-dependent sorting of cathepsin D to lysosomes.", "journal": "Molecular biology of the cell", "date": "2008", "authors": "Perez-Victoria FJ, Mardones GA, Bonifacino JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "18367545", "url": "https://glygen.org/publication/PubMed/18367545" } ] }, { "title": "TiO(2)-based phosphoproteomic analysis of the plasma membrane and the effects of phosphatase inhibitor treatment.", "journal": "Journal of proteome research", "date": "2008", "authors": "Thingholm TE, Larsen MR, Ingrell CR, Kassem M, Jensen ON", "evidence": [ { "database": "iPTMnet", "id": "O60499-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60499-1" } ], "reference": [ { "type": "PubMed", "id": "18578522", "url": "https://glygen.org/publication/PubMed/18578522" } ] }, { "title": "Rab18 and Rab43 have key roles in ER-Golgi trafficking.", "journal": "Journal of cell science", "date": "2008", "authors": "Dejgaard SY, Murshid A, Erman A, Kizilay O, Verbich D, Lodge R, Dejgaard K, Ly-Hartig TB, Pepperkok R, Simpson JC, Presley JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "18664496", "url": "https://glygen.org/publication/PubMed/18664496" } ] }, { "title": "A quantitative atlas of mitotic phosphorylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "O60499", "url": "https://www.uniprot.org/uniprot/O60499" }, { "database": "iPTMnet", "id": "O60499-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60499-1" } ], "reference": [ { "type": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ] }, { "title": "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.", "journal": "Mol. Cell", "date": "2008", "authors": "Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M", "evidence": [ { "database": "UniProtKB", "id": "K7EJ05", "url": "https://www.uniprot.org/uniprot/K7EJ05" }, { "database": "iPTMnet", "id": "O60499-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60499-1" } ], "reference": [ { "type": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" } ] }, { "title": "Multiple Rab GTPase binding sites in GCC185 suggest a model for vesicle tethering at the trans-Golgi.", "journal": "Molecular biology of the cell", "date": "2009", "authors": "Hayes GL, Brown FC, Haas AK, Nottingham RM, Barr FA, Pfeffer SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "18946081", "url": "https://glygen.org/publication/PubMed/18946081" } ] }, { "title": "Membrane fusion: grappling with SNARE and SM proteins.", "journal": "Science (New York, N.Y.)", "date": "2009", "authors": "Sudhof TC, Rothman JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "19164740", "url": "https://glygen.org/publication/PubMed/19164740" } ] }, { "title": "RhoBTB3: a Rho GTPase-family ATPase required for endosome to Golgi transport.", "journal": "Cell", "date": "2009", "authors": "Espinosa EJ, Calero M, Sridevi K, Pfeffer SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "19490898", "url": "https://glygen.org/publication/PubMed/19490898" } ] }, { "title": "Dual roles of the mammalian GARP complex in tethering and SNARE complex assembly at the trans-golgi network.", "journal": "Molecular and cellular biology", "date": "2009", "authors": "Perez-Victoria FJ, Bonifacino JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "19620288", "url": "https://glygen.org/publication/PubMed/19620288" } ] }, { "title": "Global effects of kinase inhibitors on signaling networks revealed by quantitative phosphoproteomics.", "journal": "Molecular & cellular proteomics : MCP", "date": "2009", "authors": "Pan C, Olsen JV, Daub H, Mann M", "evidence": [ { "database": "iPTMnet", "id": "O60499-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60499-1" } ], "reference": [ { "type": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" } ] }, { "title": "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.", "journal": "Science signaling", "date": "2009", "authors": "Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK", "evidence": [ { "database": "UniProtKB", "id": "O60499", "url": "https://www.uniprot.org/uniprot/O60499" }, { "database": "iPTMnet", "id": "O60499", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60499" } ], "reference": [ { "type": "PubMed", "id": "19690332", "url": "https://glygen.org/publication/PubMed/19690332" } ] }, { "title": "Exploring the human leukocyte phosphoproteome using a microfluidic reversed-phase-TiO2-reversed-phase high-performance liquid chromatography phosphochip coupled to a quadrupole time-of-flight mass spectrometer.", "journal": "Analytical chemistry", "date": "2010", "authors": "Raijmakers R, Kraiczek K, de Jong AP, Mohammed S, Heck AJ", "evidence": [ { "database": "iPTMnet", "id": "O60499-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60499-1" } ], "reference": [ { "type": "PubMed", "id": "20058876", "url": "https://glygen.org/publication/PubMed/20058876" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "UniProtKB", "id": "O60499", "url": "https://www.uniprot.org/uniprot/O60499" }, { "database": "iPTMnet", "id": "O60499-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60499-1" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "Phosphoproteome analysis of human liver tissue by long-gradient nanoflow LC coupled with multiple stage MS analysis.", "journal": "Electrophoresis", "date": "2010", "authors": "Han G, Ye M, Liu H, Song C, Sun D, Wu Y, Jiang X, Chen R, Wang C, Wang L, Zou H", "evidence": [ { "database": "iPTMnet", "id": "O60499-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60499-1" } ], "reference": [ { "type": "PubMed", "id": "20166139", "url": "https://glygen.org/publication/PubMed/20166139" } ] }, { "title": "Phosphoproteomic analysis of primary human multiple myeloma cells.", "journal": "Journal of proteomics", "date": "2010", "authors": "Ge F, Xiao CL, Yin XF, Lu CH, Zeng HL, He QY", "evidence": [ { "database": "iPTMnet", "id": "O60499-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60499-1" } ], "reference": [ { "type": "PubMed", "id": "20230923", "url": "https://glygen.org/publication/PubMed/20230923" } ] }, { "title": "Ang2/fat-free is a conserved subunit of the Golgi-associated retrograde protein complex.", "journal": "Molecular biology of the cell", "date": "2010", "authors": "Perez-Victoria FJ, Schindler C, Magadan JG, Mardones GA, Delevoye C, Romao M, Raposo G, Bonifacino JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "20685960", "url": "https://glygen.org/publication/PubMed/20685960" } ] }, { "title": "Transport according to GARP: receiving retrograde cargo at the trans-Golgi network.", "journal": "Trends in cell biology", "date": "2011", "authors": "Bonifacino JS, Hierro A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "21183348", "url": "https://glygen.org/publication/PubMed/21183348" } ] }, { "title": "Entry at the trans-face of the Golgi.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2011", "authors": "Pfeffer SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "21421921", "url": "https://glygen.org/publication/PubMed/21421921" } ] }, { "title": "The golgin coiled-coil proteins of the Golgi apparatus.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2011", "authors": "Munro S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "21436057", "url": "https://glygen.org/publication/PubMed/21436057" } ] }, { "title": "Requirements for the catalytic cycle of the N-ethylmaleimide-Sensitive Factor (NSF).", "journal": "Biochimica et biophysica acta", "date": "2012", "authors": "Zhao C, Smith EC, Whiteheart SW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "21689688", "url": "https://glygen.org/publication/PubMed/21689688" } ] }, { "title": "The COG complex interacts directly with Syntaxin 6 and positively regulates endosome-to-TGN retrograde transport.", "journal": "The Journal of cell biology", "date": "2011", "authors": "Laufman O, Hong W, Lev S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "21807881", "url": "https://glygen.org/publication/PubMed/21807881" } ] }, { "title": "Electron tomography reveals Rab6 is essential to the trafficking of trans-Golgi clathrin and COPI-coated vesicles and the maintenance of Golgi cisternal number.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2012", "authors": "Storrie B, Micaroni M, Morgan GP, Jones N, Kamykowski JA, Wilkins N, Pan TH, Marsh BJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "22335553", "url": "https://glygen.org/publication/PubMed/22335553" } ] }, { "title": "Genome-wide siRNA screen reveals amino acid starvation-induced autophagy requires SCOC and WAC.", "journal": "The EMBO journal", "date": "2012", "authors": "McKnight NC, Jefferies HB, Alemu EA, Saunders RE, Howell M, Johansen T, Tooze SA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "22354037", "url": "https://glygen.org/publication/PubMed/22354037" } ] }, { "title": "Are Rab proteins the link between Golgi organization and membrane trafficking?", "journal": "Cellular and molecular life sciences : CMLS", "date": "2012", "authors": "Liu S, Storrie B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "22581368", "url": "https://glygen.org/publication/PubMed/22581368" } ] }, { "title": "Coiling up with SCOC and WAC: two new regulators of starvation-induced autophagy.", "journal": "Autophagy", "date": "2012", "authors": "Joachim J, Wirth M, McKnight NC, Tooze SA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "22717455", "url": "https://glygen.org/publication/PubMed/22717455" } ] }, { "title": "Ric1-Rgp1 complex is a guanine nucleotide exchange factor for the late Golgi Rab6A GTPase and an effector of the medial Golgi Rab33B GTPase.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Pusapati GV, Luchetti G, Pfeffer SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "23091056", "url": "https://glygen.org/publication/PubMed/23091056" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "O60499", "url": "https://www.uniprot.org/uniprot/O60499" }, { "database": "iPTMnet", "id": "O60499", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60499" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "Rab6a/a' are important Golgi regulators of pro-inflammatory TNF secretion in macrophages.", "journal": "PloS one", "date": "2013", "authors": "Micaroni M, Stanley AC, Khromykh T, Venturato J, Wong CX, Lim JP, Marsh BJ, Storrie B, Gleeson PA, Stow JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "23437303", "url": "https://glygen.org/publication/PubMed/23437303" } ] }, { "title": "A two-tier Golgi-based control of organelle size underpins the functional plasticity of endothelial cells.", "journal": "Developmental cell", "date": "2014", "authors": "Ferraro F, Kriston-Vizi J, Metcalf DJ, Martin-Martin B, Freeman J, Burden JJ, Westmoreland D, Dyer CE, Knight AE, Ketteler R, Cutler DF", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "24794632", "url": "https://glygen.org/publication/PubMed/24794632" } ] }, { "title": "Membrane tethering.", "journal": "F1000prime reports", "date": "2014", "authors": "Chia PZ, Gleeson PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "25343031", "url": "https://glygen.org/publication/PubMed/25343031" } ] }, { "title": "The trans-Golgi SNARE syntaxin 10 is required for optimal development of Chlamydia trachomatis.", "journal": "Frontiers in cellular and infection microbiology", "date": "2015", "authors": "Lucas AL, Ouellette SP, Kabeiseman EJ, Cichos KH, Rucks EA", "evidence": [ { "database": "RefSeq", "id": "NP_001258540", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001258540" } ], "reference": [ { "type": "PubMed", "id": "26442221", "url": "https://glygen.org/publication/PubMed/26442221" } ] }, { "title": "Lysosome biogenesis requires Rab9 function and receptor recycling from endosomes to the trans-Golgi network.", "journal": "The Journal of cell biology", "date": "1994", "authors": "Riederer MA, Soldati T, Shapiro AD, Lin J, Pfeffer SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "7909812", "url": "https://glygen.org/publication/PubMed/7909812" } ] }, { "title": "A protein assembly-disassembly pathway in vitro that may correspond to sequential steps of synaptic vesicle docking, activation, and fusion.", "journal": "Cell", "date": "1993", "authors": "Sollner T, Bennett MK, Whiteheart SW, Scheller RH, Rothman JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "8221884", "url": "https://glygen.org/publication/PubMed/8221884" } ] }, { "title": "Rab9 functions in transport between late endosomes and the trans Golgi network.", "journal": "The EMBO journal", "date": "1993", "authors": "Lombardi D, Soldati T, Riederer MA, Goda Y, Zerial M, Pfeffer SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "8440258", "url": "https://glygen.org/publication/PubMed/8440258" } ] }, { "title": "Sec18p (NSF)-driven release of Sec17p (alpha-SNAP) can precede docking and fusion of yeast vacuoles.", "journal": "Cell", "date": "1996", "authors": "Mayer A, Wickner W, Haas A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "8620540", "url": "https://glygen.org/publication/PubMed/8620540" } ] }, { "title": "A v-SNARE implicated in intra-Golgi transport.", "journal": "The Journal of cell biology", "date": "1996", "authors": "Nagahama M, Orci L, Ravazzola M, Amherdt M, Lacomis L, Tempst P, Rothman JE, Sollner TH", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "8636227", "url": "https://glygen.org/publication/PubMed/8636227" } ] }, { "title": "Identification of a novel Rac1-interacting protein involved in membrane ruffling.", "journal": "The EMBO journal", "date": "1996", "authors": "Van Aelst L, Joneson T, Bar-Sagi D", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "8670882", "url": "https://glygen.org/publication/PubMed/8670882" } ] }, { "title": "GTP-bound forms of rab6 induce the redistribution of Golgi proteins into the endoplasmic reticulum.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Martinez O, Antony C, Pehau-Arnaudet G, Berger EG, Salamero J, Goud B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "9050864", "url": "https://glygen.org/publication/PubMed/9050864" } ] }, { "title": "Assembly and disassembly of a ternary complex of synaptobrevin, syntaxin, and SNAP-25 in the membrane of synaptic vesicles.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Otto H, Hanson PI, Jahn R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "9177194", "url": "https://glygen.org/publication/PubMed/9177194" } ] }, { "title": "A novel Rab9 effector required for endosome-to-TGN transport.", "journal": "The Journal of cell biology", "date": "1997", "authors": "Diaz E, Schimmoller F, Pfeffer SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "9230071", "url": "https://glygen.org/publication/PubMed/9230071" } ] }, { "title": "Syntaxin 10: a member of the syntaxin family localized to the trans-Golgi network.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1998", "authors": "Tang B L, Low D Y, Tan A E, Hong W", "evidence": [ { "database": "UniProtKB", "id": "O60499", "url": "https://www.uniprot.org/uniprot/O60499" } ], "reference": [ { "type": "PubMed", "id": "9446797", "url": "https://glygen.org/publication/PubMed/9446797" } ] }, { "title": "TIP47: a cargo selection device for mannose 6-phosphate receptor trafficking.", "journal": "Cell", "date": "1998", "authors": "Diaz E, Pfeffer SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "9590177", "url": "https://glygen.org/publication/PubMed/9590177" } ] } ], "pathway": [ { "id": "hsa:8677", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:8677", "resource": "KEGG Pathway" }, { "id": "R-HSA-6811440", "name": "Retrograde transport at the Trans-Golgi-Network", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440", "resource": "Reactome", "description": "Retrograde transport at the Trans-Golgi-Network" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 9, "go_terms": [ { "name": "Golgi membrane", "id": "GO:0000139", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000139", "evidence": [ { "database": "UniProtKB", "id": "O60499", "url": "https://www.uniprot.org/uniprot/O60499" } ], "pmid": "" }, { "name": "trans-Golgi network", "id": "GO:0005802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005802", "evidence": [ { "database": "UniProtKB", "id": "O60499", "url": "https://www.uniprot.org/uniprot/O60499" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "O60499", "url": "https://www.uniprot.org/uniprot/O60499" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "O60499", "url": "https://www.uniprot.org/uniprot/O60499" } ], "pmid": "" }, { "name": "trans-Golgi network membrane", "id": "GO:0032588", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032588", "evidence": [ { "database": "UniProtKB", "id": "O60499", "url": "https://www.uniprot.org/uniprot/O60499" } ], "pmid": "" }, { "name": "perinuclear region of cytoplasm", "id": "GO:0048471", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048471", "evidence": [ { "database": "UniProtKB", "id": "O60499", "url": "https://www.uniprot.org/uniprot/O60499" } ], "pmid": "" }, { "name": "endomembrane system", "id": "GO:0012505", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0012505", "evidence": [ { "database": "UniProtKB", "id": "O60499", "url": "https://www.uniprot.org/uniprot/O60499" } ], "pmid": "" }, { "name": "vesicle", "id": "GO:0031982", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031982", "evidence": [ { "database": "UniProtKB", "id": "O60499", "url": "https://www.uniprot.org/uniprot/O60499" } ], "pmid": "" }, { "name": "SNARE complex", "id": "GO:0031201", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031201", "evidence": [ { "database": "UniProtKB", "id": "O60499", "url": "https://www.uniprot.org/uniprot/O60499" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 6, "go_terms": [ { "name": "intracellular protein transport", "id": "GO:0006886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006886", "evidence": [ { "database": "UniProtKB", "id": "O60499", "url": "https://www.uniprot.org/uniprot/O60499" } ], "pmid": "" }, { "name": "Golgi vesicle transport", "id": "GO:0048193", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048193", "evidence": [ { "database": "UniProtKB", "id": "O60499", "url": "https://www.uniprot.org/uniprot/O60499" } ], "pmid": "" }, { "name": "regulation of protein localization", "id": "GO:0032880", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032880", "evidence": [ { "database": "UniProtKB", "id": "O60499", "url": "https://www.uniprot.org/uniprot/O60499" } ], "pmid": "" }, { "name": "retrograde transport, endosome to Golgi", "id": "GO:0042147", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042147", "evidence": [ { "database": "UniProtKB", "id": "O60499", "url": "https://www.uniprot.org/uniprot/O60499" } ], "pmid": "" }, { "name": "vesicle fusion", "id": "GO:0006906", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006906", "evidence": [ { "database": "UniProtKB", "id": "O60499", "url": "https://www.uniprot.org/uniprot/O60499" } ], "pmid": "" }, { "name": "vesicle docking", "id": "GO:0048278", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048278", "evidence": [ { "database": "UniProtKB", "id": "O60499", "url": "https://www.uniprot.org/uniprot/O60499" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "SNAP receptor activity", "id": "GO:0005484", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005484", "evidence": [ { "database": "UniProtKB", "id": "O60499", "url": "https://www.uniprot.org/uniprot/O60499" } ], "pmid": "" }, { "name": "syntaxin binding", "id": "GO:0019905", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019905", "evidence": [ { "database": "UniProtKB", "id": "O60499", "url": "https://www.uniprot.org/uniprot/O60499" } ], "pmid": "" }, { "name": "SNARE binding", "id": "GO:0000149", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000149", "evidence": [ { "database": "UniProtKB", "id": "O60499", "url": "https://www.uniprot.org/uniprot/O60499" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [ 2, 108, 110, 132, 134, 140, 143 ], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 7 }, { "field": "total_sites", "count": 7 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 86 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }