{ "uniprot_canonical_ac": "O60224-1", "uniprot_ac": "O60224", "uniprot_id": "SSX4_HUMAN", "mass": { "chemical_mass": 21858.0, "monoisotopic_mass": 21858.0 }, "refseq": { "ac": "NP_001030004", "name": "protein SSX4 isoform a", "summary": "The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneously humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. SSX1, SSX2 and SSX4 genes have been involved in the t(X;18) translocation characteristically found in all synovial sarcomas. This translocation results in the fusion of the synovial sarcoma translocation gene on chromosome 18 to one of the SSX genes on chromosome X. Chromosome Xp11 contains a segmental duplication resulting in two identical copies of synovial sarcoma, X breakpoint 4, SSX4 and SSX4B, in tail-to-tail orientation. This gene, SSX4B, represents the more centromeric copy. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001030004" }, "gene_names": [ { "name": "SSX4B", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O60224", "id": "O60224" }, { "name": "SSX4", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O60224", "id": "O60224" }, { "name": "CT5.4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001030004", "id": "NP_001030004" }, { "name": "SSX4A", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O60224", "id": "O60224" }, { "name": "SSX4B", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001030004", "id": "NP_001030004" } ], "protein_names": [ { "name": "Protein SSX4", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O60224" }, { "name": "CT5.4", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O60224" }, { "name": "Cancer/testis antigen 5.4", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O60224" }, { "name": "protein SSX4 isoform a", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001030004", "id": "NP_001030004" }, { "name": "protein SSX4; cancer/testis antigen 5.4; synovial sarcoma, X breakpoint 4B", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001030004", "id": "NP_001030004" } ], "function": [ { "annotation": "Could act as a modulator of transcription.", "evidence": [ { "database": "UniProtKB", "id": "O60224", "url": "https://www.uniprot.org/uniprot/O60224#function" } ] }, { "annotation": "The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneously humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. SSX1, SSX2 and SSX4 genes have been involved in the t(X;18) translocation characteristically found in all synovial sarcomas. This translocation results in the fusion of the synovial sarcoma translocation gene on chromosome 18 to one of the SSX genes on chromosome X. Chromosome Xp11 contains a segmental duplication resulting in two identical copies of synovial sarcoma, X breakpoint 4, SSX4 and SSX4B, in tail-to-tail orientation. This gene, SSX4B, represents the more centromeric copy. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_001030004", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001030004" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "18.51", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000268009", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000268009" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "16.41", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000268009", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000268009" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "43.36", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000268009", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000268009" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "30.43", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000268009", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000268009" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "28.84", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000268009", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000268009" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "29.68", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000268009", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000268009" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "27.75", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000268009", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000268009" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "21.75", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000268009", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000268009" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "25.75", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000268009", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000268009" } ] } ], "expression_disease": [ { "significant": "No", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O60224", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60224" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O60224", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60224" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O60224", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60224" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O60224", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60224" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O60224", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60224" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O60224", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60224" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O60224", "url": "https://www.uniprot.org/uniprot/O60224" } ], "common_name": "Human" } ], "gene": [ { "name": "SSX4B", "url": "https://www.uniprot.org/uniprot/O60224", "locus": { "chromosome": "X", "start_pos": 48402082, "end_pos": 48411960, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000269791", "url": "https://www.ensembl.org/id/ENSG00000269791" } ] } } ], "crossref": [ { "id": "ENSG00000268009", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000268009", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "SSX4", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=SSX4", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "SSX4B", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=SSX4B", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "548313", "url": "https://www.ncbi.nlm.nih.gov/gene/548313", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "6759", "url": "https://www.ncbi.nlm.nih.gov/gene/6759", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "11338", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=11338", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "16880", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=16880", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O60224", "url": "https://www.ebi.ac.uk/intact/interactors/id:O60224*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001909", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001909", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003655", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003655", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR019041", "url": "https://www.ebi.ac.uk/interpro/entry/IPR019041", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR028804", "url": "https://www.ebi.ac.uk/interpro/entry/IPR028804", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036051", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036051", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:548313", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:548313", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "hsa:6759", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:6759", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "300326", "url": "http://www.omim.org/entry/300326", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O60224", "url": "https://www.nextprot.org/entry/NX_O60224", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "FHGNDFD", "url": "https://omabrowser.org/oma/group/FHGNDFD/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4658774at2759", "url": "http://www.orthodb.org/?query=4658774at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR14112", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR14112", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR14112:SF8", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR14112:SF8", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF09514", "url": "http://pfam.xfam.org/family/PF09514", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O60224", "url": "https://pharos.nih.gov/targets/O60224", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O60224", "url": "http://purl.obolibrary.org/obo/PR_O60224", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_001030004", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001030004", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "O60224", "url": "https://www.uniprot.org/uniprot/O60224", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O60224-1", "url": "https://www.uniprot.org/uniprot/O60224-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O60224-2", "url": "https://www.uniprot.org/uniprot/O60224-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MNGDDAFARRPRDDAQISEKLRKAFDDIAKYFSKKEWEKMKSSEKIVYVYMKLNYEVMTKLGFKVTLPPFMRSKRAADFHGNDFGNDRNHRNQVERPQMTFGSLQRIFPKIMPKKPAEEENGLKEVPEASGPQNDGKQLCPPGNPSTLEKINKTSGPKRGKHAWTHRLRERKQLVVYEEISDPEEDDE", "length": 188, "header": "sp|O60224-1|SSX4_HUMAN Isoform 1 of Protein SSX4 OS=Homo sapiens OX=9606 GN=SSX4B PE=1 SV=1 CANONICAL=O60224-1" }, "isoforms": [ { "isoform_ac": "O60224-1", "url": "", "sequence": { "sequence": "MNGDDAFARRPRDDAQISEKLRKAFDDIAKYFSKKEWEKMKSSEKIVYVYMKLNYEVMTKLGFKVTLPPFMRSKRAADFHGNDFGNDRNHRNQVERPQMTFGSLQRIFPKIMPKKPAEEENGLKEVPEASGPQNDGKQLCPPGNPSTLEKINKTSGPKRGKHAWTHRLRERKQLVVYEEISDPEEDDE", "length": 188, "header": "sp|O60224-1|SSX4_HUMAN Isoform 1 of Protein SSX4 OS=Homo sapiens OX=9606 GN=SSX4B PE=1 SV=1 CANONICAL=O60224-1" }, "locus": { "chromosome": "X", "start_pos": 48411372, "end_pos": 48403459, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000595235.6", "url": "https://www.ensembl.org/id/ENST00000595235.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000469394.1", "url": "https://www.ensembl.org/id/ENSP00000469394.1" } ] } }, { "isoform_ac": "O60224-2", "url": "", "sequence": { "sequence": "MNGDDAFARRPRDDAQISEKLRKAFDDIAKYFSKKEWEKMKSSEKIVYVYMKLNYEVMTKLGFKVTLPPFMRSKRAADFHGNDFGNDRNHRNQVERPQMTFGSLQRIFPKDPKGGNMPGPTDCVRESSWWFMKRSATLRKMTSNSPRGYDTCP", "length": 153, "header": "sp|O60224-2|SSX4_HUMAN Isoform 2 of Protein SSX4 OS=Homo sapiens OX=9606 GN=SSX4B PE=1 SV=1 CANONICAL=O60224-1" }, "locus": { "chromosome": "X", "start_pos": 48392779, "end_pos": 48384054, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000620320.4", "url": "https://www.ensembl.org/id/ENST00000620320.4" }, { "database": "Ensembl Peptide", "id": "ENSP00000483262.1", "url": "https://www.ensembl.org/id/ENSP00000483262.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "SSX: a multigene family with several members transcribed in normal testis and human cancer.", "journal": "Int. J. Cancer", "date": "1997", "authors": "Gure A O, T\u00fcreci O, Sahin U, Tsang S, Scanlan M J, J\u00e4ger E, Knuth A, Pfreundschuh M, Old L J, Chen Y T", "evidence": [ { "database": "UniProtKB", "id": "O60224", "url": "https://www.uniprot.org/uniprot/O60224" } ], "reference": [ { "type": "PubMed", "id": "9378559", "url": "https://glygen.org/publication/PubMed/9378559" } ] } ], "pathway": [ { "id": "hsa:548313", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:548313", "resource": "KEGG Pathway" }, { "id": "hsa:6759", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:6759", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "A2AHC7-1", "protein_name": "Predicted gene 6592", "gene_name": "Ssxb14", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "METVISCEKIPMEVLHKPKNICKAFQDISTYFSGEEWGKLTEWQKSAYMYMKRNYTRMTGVTVNQPVFMSGKEQAKQSLVKGIEVHDSEDECFEESFGVTPRKRMKLTSVTISIHNVEGSLASGENDSNLAETDGIQVNVWSHRLRERKYRVIYSEISDPEEEEDDDY", "length": 168 }, "evidence": [ { "id": "45936424", "url": "http://www.informatics.jax.org/homology/45936424", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "A2BI73-1", "protein_name": "Predicted gene 14459", "gene_name": "Ssxb15", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MVSFQNNTNMETVSSCEKIPMEVLCEPKNICKAFQDISTYFSDEEWGKLTEWQKSAYVYMKRNYIRMTDLGVTVNQPVFMRGKDQDKQCLVEGIEVHDSNDECFEGSFGVTPRKRMKLTSVTISIHNVEERLASGEYDSNLAETGGIQVNVWSHRLRERKYRVIYSEISDPEEEEDDYY", "length": 179 }, "evidence": [ { "id": "45936430", "url": "http://www.informatics.jax.org/homology/45936430", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "A2BI93-1", "protein_name": "Synovial sarcoma, X member B9", "gene_name": "Ssxb9", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MLEEDKIVSFQNHTDMETVSSCEKVPMEVLYEPKNICKAFQDISTYFSDEEWGKLTQWQKSAYVYMKRNYIRMTDLGVTVNQPVFMRGKEQDKQSLVEGIEDHDSDDECFEGSFGVTPRKRMKLTSVTISIHNVEGSLASVKNDSNLAETSGIRVNVWSHRLRERKYRVIYEEISDPEEEEDDDY", "length": 185 }, "evidence": [ { "id": "45936431", "url": "http://www.informatics.jax.org/homology/45936431", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "B1AUS7-1", "protein_name": "Protein SSXA1", "gene_name": "Ssxa1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MKRRSHSVNLGKTKHKPEETCQAFEDISKYFSKEEWKKLSRSEKITYVYMKRNYTTMTNLGLRAHLPDFMESKERVTKSVLSDSDEVSSHESQDKRKNPVV", "length": 101 }, "evidence": [ { "id": "45936426", "url": "http://www.informatics.jax.org/homology/45936426", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "B1AY40-1", "protein_name": "Synovial sarcoma, X member B8", "gene_name": "Ssxb8", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "METVSFCEKVPMEVLYEPKNICKAFQDISTYFSDEEWGKLTQWQKSAYVYMKRNYIRMTDLGVTVNQPVFMSGKEQDKQSLVEGIEVHDSEDECFEGSFGVTPIKQMKLTPVTISIHNVEGSLASGENNSNLAETSGIQVNVWSHRLRERKYRVIYEEISDPEEEEDDDY", "length": 170 }, "evidence": [ { "id": "45936420", "url": "http://www.informatics.jax.org/homology/45936420", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "M0R5E6-1", "protein_name": "SSX family member 2", "gene_name": "Ssx2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MTHSVNLRKTKHKPEEACKAFEDISKYFSREEWAKLSHSEKITYVYMKRNYTTMTNLGLRAHLPDFMESNEQATKSVLNDSDEVFSHESQGLRRRPVSIWSHRLRERKKQVIYEEISDPEDEKEEREEEKIEKGIGGQGGEGERGKEGRRKNTMV", "length": 155 }, "evidence": [ { "id": "45936426", "url": "http://www.informatics.jax.org/homology/45936426", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "O60225-1", "protein_name": "Protein SSX5", "gene_name": "SSX5", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MNGDDAFVRRPRVGSQIPEKMQKAFDDIAKYFSEKEWEKMKASEKIIYVYMKRKYEAMTKLGFKATLPPFMRNKRVADFQGNDFDNDPNRGNQVEHPQMTFGRLQGIFPKITPEKPAEEGNDSKGVPEASGPQNNGKQLRPSGKLNTSEKVNKTSGPKRGKHAWTHRVRERKQLVIYEEISDPQEDDE", "length": 188 }, "evidence": [ { "id": "45936429", "url": "http://www.informatics.jax.org/homology/45936429", "database": "MGI" }, { "id": "45936430", "url": "http://www.informatics.jax.org/homology/45936430", "database": "MGI" }, { "id": "45936431", "url": "http://www.informatics.jax.org/homology/45936431", "database": "MGI" }, { "id": "45936424", "url": "http://www.informatics.jax.org/homology/45936424", "database": "MGI" }, { "id": "45936427", "url": "http://www.informatics.jax.org/homology/45936427", "database": "MGI" }, { "id": "45936426", "url": "http://www.informatics.jax.org/homology/45936426", "database": "MGI" }, { "id": "45936423", "url": "http://www.informatics.jax.org/homology/45936423", "database": "MGI" }, { "id": "45936422", "url": "http://www.informatics.jax.org/homology/45936422", "database": "MGI" }, { "id": "45936428", "url": "http://www.informatics.jax.org/homology/45936428", "database": "MGI" }, { "id": "45936420", "url": "http://www.informatics.jax.org/homology/45936420", "database": "MGI" }, { "id": "45936425", "url": "http://www.informatics.jax.org/homology/45936425", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q16384-1", "protein_name": "Protein SSX1", "gene_name": "SSX1", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MNGDDTFAKRPRDDAKASEKRSKAFDDIATYFSKKEWKKMKYSEKISYVYMKRNYKAMTKLGFKVTLPPFMCNKQATDFQGNDFDNDHNRRIQVEHPQMTFGRLHRIIPKIMPKKPAEDENDSKGVSEASGPQNDGKQLHPPGKANISEKINKRSGPKRGKHAWTHRLRERKQLVIYEEISDPEEDDE", "length": 188 }, "evidence": [ { "id": "45936429", "url": "http://www.informatics.jax.org/homology/45936429", "database": "MGI" }, { "id": "45936430", "url": "http://www.informatics.jax.org/homology/45936430", "database": "MGI" }, { "id": "45936424", "url": "http://www.informatics.jax.org/homology/45936424", "database": "MGI" }, { "id": "45936427", "url": "http://www.informatics.jax.org/homology/45936427", "database": "MGI" }, { "id": "45936426", "url": "http://www.informatics.jax.org/homology/45936426", "database": "MGI" }, { "id": "45936423", "url": "http://www.informatics.jax.org/homology/45936423", "database": "MGI" }, { "id": "45936422", "url": "http://www.informatics.jax.org/homology/45936422", "database": "MGI" }, { "id": "45936428", "url": "http://www.informatics.jax.org/homology/45936428", "database": "MGI" }, { "id": "45936420", "url": "http://www.informatics.jax.org/homology/45936420", "database": "MGI" }, { "id": "45936425", "url": "http://www.informatics.jax.org/homology/45936425", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q16385-1", "protein_name": "Protein SSX2", "gene_name": "SSX2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MNGDDAFARRPTVGAQIPEKIQKAFDDIAKYFSKEEWEKMKASEKIFYVYMKRKYEAMTKLGFKATLPPFMCNKRAEDFQGNDLDNDPNRGNQVERPQMTFGRLQGISPKIMPKKPAEEGNDSEEVPEASGPQNDGKELCPPGKPTTSEKIHERSGPKRGEHAWTHRLRERKQLVIYEEISDPEEDDE", "length": 188 }, "evidence": [ { "id": "45936429", "url": "http://www.informatics.jax.org/homology/45936429", "database": "MGI" }, { "id": "45936430", "url": "http://www.informatics.jax.org/homology/45936430", "database": "MGI" }, { "id": "45936431", "url": "http://www.informatics.jax.org/homology/45936431", "database": "MGI" }, { "id": "45936424", "url": "http://www.informatics.jax.org/homology/45936424", "database": "MGI" }, { "id": "45936427", "url": "http://www.informatics.jax.org/homology/45936427", "database": "MGI" }, { "id": "45936426", "url": "http://www.informatics.jax.org/homology/45936426", "database": "MGI" }, { "id": "45936423", "url": "http://www.informatics.jax.org/homology/45936423", "database": "MGI" }, { "id": "45936422", "url": "http://www.informatics.jax.org/homology/45936422", "database": "MGI" }, { "id": "45936428", "url": "http://www.informatics.jax.org/homology/45936428", "database": "MGI" }, { "id": "45936420", "url": "http://www.informatics.jax.org/homology/45936420", "database": "MGI" }, { "id": "45936425", "url": "http://www.informatics.jax.org/homology/45936425", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q6XAR7-1", "protein_name": "SSXB10 protein", "gene_name": "Ssxb10", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "METVSSCEKIPMEVLYEPKNICKAFQDISTYFSDEEWGKLTEWQKSAYVYMKRNYIRMTDLGVTVNQPVFMRGKEQDKQSLVEGIEDHDSEDECFEGSFGVTPRKRMKLTSVTISIHNVEGSLASGENDSNLAEPGGIQVNVWSHRLRERKYRVIYSEISDPEEEEDDDY", "length": 170 }, "evidence": [ { "id": "45936429", "url": "http://www.informatics.jax.org/homology/45936429", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q6XAS2-1", "protein_name": "Synovial sarcoma, X member B5", "gene_name": "Ssxb5", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MEVLYEPKNNCKAFQDISTYFSDEEWGKLTQWQKSAYVYMKRNYIRMTDLGVNVNQPVFMRGKEQAKQFLVEGIEDHDSEDECFEESFGVTPRKRMKLTSVTISIHNVEGSLASGENDSNLAETDGIQVNVWSHRLRERKYRVIYSEISDPEEEEDDDY", "length": 159 }, "evidence": [ { "id": "45936425", "url": "http://www.informatics.jax.org/homology/45936425", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q6XAS3-1", "protein_name": "SSXB4 protein", "gene_name": "Ssxb13", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "METLRSCEKIPMEVLYEPKNICKAFQDISTYYSDEEWGKLTQWQKSAYVYMKRNYIRMTDLGVTMNQPVFMRGKEQAKQSLFEGIEVHDSDVECFEGSFGVIPRKRMKLTLVTISIRNVEERLASGEHDSNLAETGGIQVNVWSNRLRERKYRVIYSEISYPEEEEDDDY", "length": 170 }, "evidence": [ { "id": "45936427", "url": "http://www.informatics.jax.org/homology/45936427", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q6XAS4-1", "protein_name": "Synovial sarcoma, X member B3", "gene_name": "Ssxb3", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "METVSSCEKIPMEVLYEPKNICKAFQDISTYFSDEEWGKLTQWQKSAYMYMKRNYIRMTDLGVTVNQPVFMRGKEQEKQSLVEGIEVHDSDDECFEGSFDVTPRKRMKLTSVTISIHNVEGSLASGKNDSNLAETDGIQVNVWSHRLRERKYRVIYSEISDPEEEEDDDY", "length": 170 }, "evidence": [ { "id": "45936422", "url": "http://www.informatics.jax.org/homology/45936422", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q7RTT5-1", "protein_name": "Protein SSX7", "gene_name": "SSX7", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MNGDDAFARRPRAGAQIPEKIQKSFDDIAKYFSKKEWEKMKSLEKISYVYMKRKYEAMTKLGFKATLPPFMHNTGATDLQGNDFDNDRNQGNQVERPQMTFCRLQRIFPKIMPKKPAEEGNDSKGVPEASGSQNDGKHLCPPGKPSTSEKINKTSGPKRGKHAWTHRLRERKQLVIYEEISDPEEDDE", "length": 188 }, "evidence": [ { "id": "45936429", "url": "http://www.informatics.jax.org/homology/45936429", "database": "MGI" }, { "id": "45936430", "url": "http://www.informatics.jax.org/homology/45936430", "database": "MGI" }, { "id": "45936431", "url": "http://www.informatics.jax.org/homology/45936431", "database": "MGI" }, { "id": "45936424", "url": "http://www.informatics.jax.org/homology/45936424", "database": "MGI" }, { "id": "45936427", "url": "http://www.informatics.jax.org/homology/45936427", "database": "MGI" }, { "id": "45936426", "url": "http://www.informatics.jax.org/homology/45936426", "database": "MGI" }, { "id": "45936423", "url": "http://www.informatics.jax.org/homology/45936423", "database": "MGI" }, { "id": "45936422", "url": "http://www.informatics.jax.org/homology/45936422", "database": "MGI" }, { "id": "45936428", "url": "http://www.informatics.jax.org/homology/45936428", "database": "MGI" }, { "id": "45936420", "url": "http://www.informatics.jax.org/homology/45936420", "database": "MGI" }, { "id": "45936425", "url": "http://www.informatics.jax.org/homology/45936425", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q8C5Z3-1", "protein_name": "Synovial sarcoma, X member B2", "gene_name": "Ssxb2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MMQCTVLQNGDLNSLKRRTFGFVLEEDKIVSFQNHPDMETVSSCEKNPMEVLYEPKNICKAFQDISTYFSDEEWGKLTQWQKSAYVYMKRNYIRMTDLGVTVNQPVFMRGKEQDKQSLVEGIEVHDSDETSGIRVNVWSHRLRERKYRVIYEEISDPEEEEDDDY", "length": 165 }, "evidence": [ { "id": "45936432", "url": "http://www.informatics.jax.org/homology/45936432", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q99909-1", "protein_name": "Protein SSX3", "gene_name": "SSX3", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MNGDDTFARRPTVGAQIPEKIQKAFDDIAKYFSKEEWEKMKVSEKIVYVYMKRKYEAMTKLGFKAILPSFMRNKRVTDFQGNDFDNDPNRGNQVQRPQMTFGRLQGIFPKIMPKKPAEEGNVSKEVPEASGPQNDGKQLCPPGKPTTSEKINMISGPKRGEHAWTHRLRERKQLVIYEEISDPEEDDE", "length": 188 }, "evidence": [ { "id": "45936429", "url": "http://www.informatics.jax.org/homology/45936429", "database": "MGI" }, { "id": "45936430", "url": "http://www.informatics.jax.org/homology/45936430", "database": "MGI" }, { "id": "45936431", "url": "http://www.informatics.jax.org/homology/45936431", "database": "MGI" }, { "id": "45936424", "url": "http://www.informatics.jax.org/homology/45936424", "database": "MGI" }, { "id": "45936427", "url": "http://www.informatics.jax.org/homology/45936427", "database": "MGI" }, { "id": "45936426", "url": "http://www.informatics.jax.org/homology/45936426", "database": "MGI" }, { "id": "45936423", "url": "http://www.informatics.jax.org/homology/45936423", "database": "MGI" }, { "id": "45936422", "url": "http://www.informatics.jax.org/homology/45936422", "database": "MGI" }, { "id": "45936428", "url": "http://www.informatics.jax.org/homology/45936428", "database": "MGI" }, { "id": "45936420", "url": "http://www.informatics.jax.org/homology/45936420", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q9CPU1-1", "protein_name": "Synovial sarcoma, X member B, breakpoint 1", "gene_name": "Ssxb1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "METVSSCEKVPMEVLYEPKNICKAFQDISTYFSDEEWGKLTQWQKSAYVYMKRNYIRMTDLGVTVNQPVFMRGKEQAKQSLVEGIEVHDSEDECFEGSFGVTPIKRMKLTSVTISFHNVEGSLASGENDCNLAETGGIQVNVWSHRLRERKYRVIYSEISDTEEEEDDDY", "length": 170 }, "evidence": [ { "id": "45936428", "url": "http://www.informatics.jax.org/homology/45936428", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "O60224", "url": "https://www.uniprot.org/uniprot/O60224" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "regulation of DNA-templated transcription", "id": "GO:0006355", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006355", "evidence": [ { "database": "UniProtKB", "id": "O60224", "url": "https://www.uniprot.org/uniprot/O60224" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 152, "end_pos": 154, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 152, "end_pos": 154 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 1 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }