{ "uniprot_canonical_ac": "O60218-1", "uniprot_ac": "O60218", "uniprot_id": "AK1BA_HUMAN", "mass": { "chemical_mass": 36020.0, "monoisotopic_mass": 36020.0 }, "refseq": { "ac": "NP_064695", "name": "aldo-keto reductase family 1 member B10", "summary": "This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_064695" }, "gene_names": [ { "name": "AKR1B10", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O60218", "id": "O60218" }, { "name": "AKR1B10", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_064695", "id": "NP_064695" }, { "name": "AKR1B11; AKR1B12; ALDRLn; ARL-1; ARL1; HIS; HSI", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_064695", "id": "NP_064695" }, { "name": "AKR1B11", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O60218", "id": "O60218" } ], "protein_names": [ { "name": "Aldo-keto reductase family 1 member B10", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O60218" }, { "name": "1.1.1.300", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O60218" }, { "name": "1.1.1.54", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O60218" }, { "name": "ARL-1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O60218" }, { "name": "ARP", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O60218" }, { "name": "Aldose reductase-like", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O60218" }, { "name": "Aldose reductase-related protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O60218" }, { "name": "SI reductase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O60218" }, { "name": "Small intestine reductase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O60218" }, { "name": "aldo-keto reductase family 1 member B10", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_064695", "id": "NP_064695" }, { "name": "aldose reductase-like 1; aldo-keto reductase family 1, member B11 (aldose reductase-like); aldose reductase-like peptide; aldose reductase-related protein; small intestine reductase; ARP; hARP; SI reductase; aldo-keto reductase family 1, member B10 (aldose reductase)", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_064695", "id": "NP_064695" }, { "name": "hARP", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O60218" } ], "function": [ { "annotation": "AKR1B10 regulates M2 macrophage polarization to promote the malignant phenotype of gastric cancer.", "evidence": [ { "database": "RefSeq", "id": "NP_064695", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_064695" }, { "database": "PubMed", "id": "37039038", "url": "https://glygen.org/publication/PubMed/37039038" } ] }, { "annotation": "Aldo-keto Reductase 1B10 Restrains Cell Migration, Invasion, and Adhesion of Gastric Cancer via Regulating Integrin Subunit Alpha 5.", "evidence": [ { "database": "RefSeq", "id": "NP_064695", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_064695" }, { "database": "PubMed", "id": "37823316", "url": "https://glygen.org/publication/PubMed/37823316" } ] }, { "annotation": "Catalyzes the NADPH-dependent reduction of a wide variety of carbonyl-containing compounds to their corresponding alcohols (PubMed:9565553, PubMed:18087047, PubMed:12732097, PubMed:19013440, PubMed:19563777). Displays strong enzymatic activity toward all-trans-retinal, 9-cis-retinal, and 13-cis-retinal (PubMed:12732097, PubMed:18087047). Plays a critical role in detoxifying dietary and lipid-derived unsaturated carbonyls, such as crotonaldehyde, 4-hydroxynonenal, trans-2-hexenal, trans-2,4-hexadienal and their glutathione-conjugates carbonyls (GS-carbonyls) (PubMed:19013440, PubMed:19563777). Displays no reductase activity towards glucose (PubMed:12732097).", "evidence": [ { "database": "UniProtKB", "id": "O60218", "url": "https://www.uniprot.org/uniprot/O60218#function" }, { "database": "PubMed", "id": "18087047", "url": "https://glygen.org/publication/PubMed/18087047" }, { "database": "PubMed", "id": "9565553", "url": "https://glygen.org/publication/PubMed/9565553" }, { "database": "PubMed", "id": "19563777", "url": "https://glygen.org/publication/PubMed/19563777" }, { "database": "PubMed", "id": "19013440", "url": "https://glygen.org/publication/PubMed/19013440" }, { "database": "PubMed", "id": "12732097", "url": "https://glygen.org/publication/PubMed/12732097" } ] }, { "annotation": "Meta-analysis of gene-disease association. (HuGE Navigator)", "evidence": [ { "database": "RefSeq", "id": "NP_064695", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_064695" }, { "database": "PubMed", "id": "11703436", "url": "https://glygen.org/publication/PubMed/11703436" } ] }, { "annotation": "Observational study of gene-disease association. (HuGE Navigator)", "evidence": [ { "database": "RefSeq", "id": "NP_064695", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_064695" }, { "database": "PubMed", "id": "12365083", "url": "https://glygen.org/publication/PubMed/12365083" } ] }, { "annotation": "RNF152 Suppresses Fatty Acid Oxidation and Metastasis of Lung Adenocarcinoma by Inhibiting IRAK1-Mediated AKR1B10 Expression.", "evidence": [ { "database": "RefSeq", "id": "NP_064695", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_064695" }, { "database": "PubMed", "id": "37717980", "url": "https://glygen.org/publication/PubMed/37717980" } ] }, { "annotation": "Serum AKR1B10 as an indicator of unfavorable survival of hepatocellular carcinoma.", "evidence": [ { "database": "RefSeq", "id": "NP_064695", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_064695" }, { "database": "PubMed", "id": "37500927", "url": "https://glygen.org/publication/PubMed/37500927" } ] }, { "annotation": "This gene encodes a member of the aldo/keto reductase superfamily, which consists of more than 40 known enzymes and proteins. This member can efficiently reduce aliphatic and aromatic aldehydes, and it is less active on hexoses. It is highly expressed in adrenal gland, small intestine, and colon, and may play an important role in liver carcinogenesis. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_064695", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_064695" } ] }, { "annotation": "Warburg effect enhanced by AKR1B10 promotes acquired resistance to pemetrexed in lung cancer-derived brain metastasis. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_064695", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_064695" }, { "database": "PubMed", "id": "37587486", "url": "https://glygen.org/publication/PubMed/37587486" } ] } ], "disease": [], "snv": [], "mutagenesis": [ { "start_pos": 125, "end_pos": 125, "sequence_org": "K", "sequence_mut": "L", "comment": "Increased affinity and reduced catalytic activity towards all-trans-retinaldehyde.", "evidence": [ { "database": "UniProtKB", "id": "O60218", "url": "https://www.uniprot.org/uniprot/O60218" }, { "database": "PubMed", "id": "18087047", "url": "https://glygen.org/publication/PubMed/18087047" } ] }, { "start_pos": 299, "end_pos": 299, "sequence_org": "C", "sequence_mut": "S", "comment": "Decreased affinity and reduced catalytic activity towards 4-hydroxynonenal.", "evidence": [ { "database": "UniProtKB", "id": "O60218", "url": "https://www.uniprot.org/uniprot/O60218" }, { "database": "PubMed", "id": "19013440", "url": "https://glygen.org/publication/PubMed/19013440" } ] }, { "start_pos": 301, "end_pos": 301, "sequence_org": "V", "sequence_mut": "L", "comment": "Reduced catalytic activity towards all-trans-retinaldehyde.", "evidence": [ { "database": "UniProtKB", "id": "O60218", "url": "https://www.uniprot.org/uniprot/O60218" }, { "database": "PubMed", "id": "18087047", "url": "https://glygen.org/publication/PubMed/18087047" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "60.9", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000198074", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198074" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "85.08", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000198074", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198074" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "95.3", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000198074", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198074" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "49.96", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000198074", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198074" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "68.02", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000198074", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198074" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "95.28", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000198074", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198074" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "97.21", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000198074", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198074" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "85.89", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000198074", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198074" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "53.58", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000198074", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198074" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "47.6", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000198074", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198074" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "64.98", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000198074", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198074" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "55.51", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000198074", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198074" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "51.76", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000198074", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198074" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O60218", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60218" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O60218", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60218" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O60218", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60218" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O60218", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60218" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O60218", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60218" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O60218", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60218" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O60218", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60218" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O60218", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60218" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O60218", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60218" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O60218", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60218" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O60218", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60218" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O60218", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O60218" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O60218", "url": "https://www.uniprot.org/uniprot/O60218" } ], "common_name": "Human" } ], "gene": [ { "name": "AKR1B10", "url": "https://www.uniprot.org/uniprot/O60218", "locus": { "chromosome": "7", "start_pos": 134541412, "end_pos": 134527567, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000198074", "url": "https://www.ensembl.org/id/ENSG00000198074" } ] } } ], "crossref": [ { "id": "ENSG00000198074", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198074", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "1.1.1.21", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=1.1.1.21&UniProtAcc=O60218", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "cd19107", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd19107", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL5983", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL5983", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "AKR1B10", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=AKR1B10", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "57016", "url": "https://www.ncbi.nlm.nih.gov/gene/57016", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "382", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=382", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O60218", "url": "https://www.ebi.ac.uk/intact/interactors/id:O60218*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR018170", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018170", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR020471", "url": "https://www.ebi.ac.uk/interpro/entry/IPR020471", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR023210", "url": "https://www.ebi.ac.uk/interpro/entry/IPR023210", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036812", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036812", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:57016", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:57016", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "604707", "url": "http://www.omim.org/entry/604707", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O60218", "url": "https://www.nextprot.org/entry/NX_O60218", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "O60218", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O60218", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "ACATNQV", "url": "https://omabrowser.org/oma/group/ACATNQV/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "890110at2759", "url": "http://www.orthodb.org/?query=890110at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11732", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11732", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11732:SF278", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11732:SF278", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1ZUA", "url": "https://www.rcsb.org/structure/1ZUA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4GA8", "url": "https://www.rcsb.org/structure/4GA8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4GAB", "url": "https://www.rcsb.org/structure/4GAB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4GQ0", "url": "https://www.rcsb.org/structure/4GQ0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4GQG", "url": "https://www.rcsb.org/structure/4GQG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4I5X", "url": "https://www.rcsb.org/structure/4I5X", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4ICC", "url": "https://www.rcsb.org/structure/4ICC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4JIH", "url": "https://www.rcsb.org/structure/4JIH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4JII", "url": "https://www.rcsb.org/structure/4JII", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4WEV", "url": "https://www.rcsb.org/structure/4WEV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4XZL", "url": "https://www.rcsb.org/structure/4XZL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4XZM", "url": "https://www.rcsb.org/structure/4XZM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4XZN", "url": "https://www.rcsb.org/structure/4XZN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5LIK", "url": "https://www.rcsb.org/structure/5LIK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5LIU", "url": "https://www.rcsb.org/structure/5LIU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5LIW", "url": "https://www.rcsb.org/structure/5LIW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5LIX", "url": "https://www.rcsb.org/structure/5LIX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5LIY", "url": "https://www.rcsb.org/structure/5LIY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5M2F", "url": "https://www.rcsb.org/structure/5M2F", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5Y7N", "url": "https://www.rcsb.org/structure/5Y7N", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00248", "url": "http://pfam.xfam.org/family/PF00248", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O60218", "url": "https://pharos.nih.gov/targets/O60218", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O60218", "url": "http://purl.obolibrary.org/obo/PR_O60218", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_064695", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_064695", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "12168", "url": "https://www.rhea-db.org/rhea/12168", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "25033", "url": "https://www.rhea-db.org/rhea/25033", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "54916", "url": "https://www.rhea-db.org/rhea/54916", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "54920", "url": "https://www.rhea-db.org/rhea/54920", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "58336", "url": "https://www.rhea-db.org/rhea/58336", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "58416", "url": "https://www.rhea-db.org/rhea/58416", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "58420", "url": "https://www.rhea-db.org/rhea/58420", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "58424", "url": "https://www.rhea-db.org/rhea/58424", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "58428", "url": "https://www.rhea-db.org/rhea/58428", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "58432", "url": "https://www.rhea-db.org/rhea/58432", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "58436", "url": "https://www.rhea-db.org/rhea/58436", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "O60218", "url": "https://www.uniprot.org/uniprot/O60218", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O60218-1", "url": "https://www.uniprot.org/uniprot/O60218-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MATFVELSTKAKMPIVGLGTWKSPLGKVKEAVKVAIDAGYRHIDCAYVYQNEHEVGEAIQEKIQEKAVKREDLFIVSKLWPTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGDDLFPKDDKGNAIGGKATFLDAWEAMEELVDEGLVKALGVSNFSHFQIEKLLNKPGLKYKPVTNQVECHPYLTQEKLIQYCHSKGITVTAYSPLGSPDRPWAKPEDPSLLEDPKIKEIAAKHKKTAAQVLIRFHIQRNVIVIPKSVTPARIVENIQVFDFKLSDEEMATILSFNRNWRACNVLQSSHLEDYPFNAEY", "length": 316, "header": "sp|O60218-1|AK1BA_HUMAN Isoform 1 of Aldo-keto reductase family 1 member B10 OS=Homo sapiens OX=9606 GN=AKR1B10 PE=1 SV=2 CANONICAL=O60218-1" }, "isoforms": [ { "isoform_ac": "O60218-1", "url": "", "sequence": { "sequence": "MATFVELSTKAKMPIVGLGTWKSPLGKVKEAVKVAIDAGYRHIDCAYVYQNEHEVGEAIQEKIQEKAVKREDLFIVSKLWPTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKSGDDLFPKDDKGNAIGGKATFLDAWEAMEELVDEGLVKALGVSNFSHFQIEKLLNKPGLKYKPVTNQVECHPYLTQEKLIQYCHSKGITVTAYSPLGSPDRPWAKPEDPSLLEDPKIKEIAAKHKKTAAQVLIRFHIQRNVIVIPKSVTPARIVENIQVFDFKLSDEEMATILSFNRNWRACNVLQSSHLEDYPFNAEY", "length": 316, "header": "sp|O60218-1|AK1BA_HUMAN Isoform 1 of Aldo-keto reductase family 1 member B10 OS=Homo sapiens OX=9606 GN=AKR1B10 PE=1 SV=2 CANONICAL=O60218-1" }, "locus": { "chromosome": "7", "start_pos": 134541086, "end_pos": 134527912, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000359579.5", "url": "https://www.ensembl.org/id/ENST00000359579.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000352584.4", "url": "https://www.ensembl.org/id/ENSP00000352584.4" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "O60218", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O60218" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" } ] } ], "phosphorylation": [ { "start_pos": 137, "end_pos": 137, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O60218", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60218" }, { "database": "PubMed", "id": "27869121", "url": "" } ], "site_lbl": "Thr137" }, { "start_pos": 23, "end_pos": 23, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O60218", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60218" }, { "database": "PubMed", "id": "19415658", "url": "https://glygen.org/publication/PubMed/19415658" } ], "site_lbl": "Ser23" }, { "start_pos": 288, "end_pos": 288, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O60218", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60218" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Thr288" }, { "start_pos": 291, "end_pos": 291, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O60218", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60218" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser291" } ], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "The structure of human retinol-binding protein (RBP) with its carrier protein transthyretin reveals an interaction with the carboxy terminus of RBP.", "journal": "Biochemistry", "date": "1999", "authors": "Naylor HM, Newcomer ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "10052934", "url": "https://glygen.org/publication/PubMed/10052934" } ] }, { "title": "Hydrolysis of retinyl esters by pancreatic triglyceride lipase.", "journal": "Biochemistry", "date": "2000", "authors": "van Bennekum AM, Fisher EA, Blaner WS, Harrison EH", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "10769148", "url": "https://glygen.org/publication/PubMed/10769148" } ] }, { "title": "Rapid initial removal of chylomicron remnants by the mouse liver does not require hepatically localized apolipoprotein E.", "journal": "Journal of lipid research", "date": "2000", "authors": "Yu KC, Jiang Y, Chen W, Cooper AD", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "11060341", "url": "https://glygen.org/publication/PubMed/11060341" } ] }, { "title": "Retinyl ester secretion by intestinal cells: a specific and regulated process dependent on assembly and secretion of chylomicrons.", "journal": "Journal of lipid research", "date": "2001", "authors": "Nayak N, Harrison EH, Hussain MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "11181758", "url": "https://glygen.org/publication/PubMed/11181758" } ] }, { "title": "Identification, retinoid binding, and x-ray analysis of a human retinol-binding protein.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "Folli C, Calderone V, Ottonello S, Bolchi A, Zanotti G, Stoppini M, Berni R", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "11274389", "url": "https://glygen.org/publication/PubMed/11274389" } ] }, { "title": "Analysis of the association between diabetic nephropathy and polymorphisms in the aldose reductase gene in Type 1 and Type 2 diabetes mellitus.", "journal": "Diabetic medicine : a journal of the British Diabetic Association", "date": "2001", "authors": "Neamat-Allah M, Feeney SA, Savage DA, Maxwell AP, Hanson RL, Knowler WC, El Nahas AM, Plater ME, Shaw J, Boulton AJ, Duff GW, Cox A", "evidence": [ { "database": "RefSeq", "id": "NP_064695", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_064695" } ], "reference": [ { "type": "PubMed", "id": "11703436", "url": "https://glygen.org/publication/PubMed/11703436" } ] }, { "title": "[Polymorphism of aldose reductase gene and susceptibility to retinopathy and nephropathy in Caucasians with type 1 diabetes].", "journal": "Archives des maladies du coeur et des vaisseaux", "date": "2002", "authors": "Fanelli A, Hadjadj S, Gallois Y, Fumeron F, Betoule D, Grandchamp B, Marre M", "evidence": [ { "database": "RefSeq", "id": "NP_064695", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_064695" } ], "reference": [ { "type": "PubMed", "id": "12365083", "url": "https://glygen.org/publication/PubMed/12365083" } ] }, { "title": "Human aldose reductase and human small intestine aldose reductase are efficient retinal reductases: consequences for retinoid metabolism.", "journal": "The Biochemical journal", "date": "2003", "authors": "Crosas B, Hyndman DJ, Gallego O, Martras S, Pares X, Flynn TG, Farres J", "evidence": [ { "database": "UniProtKB", "id": "O60218", "url": "https://www.uniprot.org/uniprot/O60218" } ], "reference": [ { "type": "PubMed", "id": "12732097", "url": "https://glygen.org/publication/PubMed/12732097" } ] }, { "title": "Human lipoprotein lipase: relationship of activity, heparin affinity, and conformation as studied with monoclonal antibodies.", "journal": "Journal of lipid research", "date": "1992", "authors": "Peterson J, Fujimoto WY, Brunzell JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "1279089", "url": "https://glygen.org/publication/PubMed/1279089" } ] }, { "title": "Identification of all-trans-retinol:all-trans-13,14-dihydroretinol saturase.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Moise AR, Kuksa V, Imanishi Y, Palczewski K", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "15358783", "url": "https://glygen.org/publication/PubMed/15358783" } ] }, { "title": "Purification and partial characterization of cellular retinol-binding protein, type two, from human small intestine.", "journal": "The Journal of nutrition", "date": "1992", "authors": "Inagami S, Ong DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "1542003", "url": "https://glygen.org/publication/PubMed/1542003" } ] }, { "title": "Two-step mechanism of binding of apolipoprotein E to heparin: implications for the kinetics of apolipoprotein E-heparan sulfate proteoglycan complex formation on cell surfaces.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Futamura M, Dhanasekaran P, Handa T, Phillips MC, Lund-Katz S, Saito H", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "15583000", "url": "https://glygen.org/publication/PubMed/15583000" } ] }, { "title": "Overexpression of the aldo-keto reductase family protein AKR1B10 is highly correlated with smokers' non-small cell lung carcinomas.", "journal": "Clin. Cancer Res.", "date": "2005", "authors": "Fukumoto Shin-ichi, Yamauchi Naoko, Moriguchi Hisashi, Hippo Yoshitaka, Watanabe Akira, Shibahara Junji, Taniguchi Hirokazu, Ishikawa Shumpei, Ito Hirotaka, Yamamoto Shogo, Iwanari Hiroko, Hironaka Mitsugu, Ishikawa Yuichi, Niki Toshiro, Sohara Yasunori, Kodama Tatsuhiko, Nishimura Masaharu, Fukayama Masashi, Dosaka-Akita Hirotoshi, Aburatani Hiroyuki", "evidence": [ { "database": "UniProtKB", "id": "O60218", "url": "https://www.uniprot.org/uniprot/O60218" } ], "reference": [ { "type": "PubMed", "id": "15755999", "url": "https://glygen.org/publication/PubMed/15755999" } ] }, { "title": "Apoa5 Q139X truncation predisposes to late-onset hyperchylomicronemia due to lipoprotein lipase impairment.", "journal": "The Journal of clinical investigation", "date": "2005", "authors": "Marcais C, Verges B, Charriere S, Pruneta V, Merlin M, Billon S, Perrot L, Drai J, Sassolas A, Pennacchio LA, Fruchart-Najib J, Fruchart JC, Durlach V, Moulin P", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "16200213", "url": "https://glygen.org/publication/PubMed/16200213" } ] }, { "title": "Palmitoyl transferase activity of lecithin retinol acyl transferase.", "journal": "Biochemistry", "date": "2006", "authors": "Xue L, Jahng WJ, Gollapalli D, Rando RR", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "16939223", "url": "https://glygen.org/publication/PubMed/16939223" } ] }, { "title": "Hydrophobic ligand binding properties of the human lipocalin apolipoprotein M.", "journal": "Journal of lipid research", "date": "2007", "authors": "Ahnstrom J, Faber K, Axler O, Dahlback B", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "17525477", "url": "https://glygen.org/publication/PubMed/17525477" } ] }, { "title": "Mechanisms of provitamin A (carotenoid) and vitamin A (retinol) transport into and out of intestinal Caco-2 cells.", "journal": "Journal of lipid research", "date": "2007", "authors": "During A, Harrison EH", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "17644776", "url": "https://glygen.org/publication/PubMed/17644776" } ] }, { "title": "Structural basis for the high all-trans-retinaldehyde reductase activity of the tumor marker AKR1B10.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Gallego O, Ruiz FX, Ardevol A, Dominguez M, Alvarez R, de Lera AR, Rovira C, Farres J, Fita I, Pares X", "evidence": [ { "database": "UniProtKB", "id": "O60218", "url": "https://www.uniprot.org/uniprot/O60218" }, { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "18087047", "url": "https://glygen.org/publication/PubMed/18087047" } ] }, { "title": "In vitro and in vivo characterization of retinoid synthesis from beta-carotene.", "journal": "Archives of biochemistry and biophysics", "date": "2008", "authors": "Fierce Y, de Morais Vieira M, Piantedosi R, Wyss A, Blaner WS, Paik J", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "18295589", "url": "https://glygen.org/publication/PubMed/18295589" } ] }, { "title": "The signal peptide anchors apolipoprotein M in plasma lipoproteins and prevents rapid clearance of apolipoprotein M from plasma.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Christoffersen C, Ahnstrom J, Axler O, Christensen EI, Dahlback B, Nielsen LB", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "18460466", "url": "https://glygen.org/publication/PubMed/18460466" } ] }, { "title": "Role of the N- and C-terminal domains in binding of apolipoprotein E isoforms to heparan sulfate and dermatan sulfate: a surface plasmon resonance study.", "journal": "Biochemistry", "date": "2008", "authors": "Yamauchi Y, Deguchi N, Takagi C, Tanaka M, Dhanasekaran P, Nakano M, Handa T, Phillips MC, Lund-Katz S, Saito H", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "18507396", "url": "https://glygen.org/publication/PubMed/18507396" } ] }, { "title": "Neutral and acid retinyl ester hydrolases associated with rat liver microsomes: relationships to microsomal cholesteryl ester hydrolases.", "journal": "Journal of lipid research", "date": "1991", "authors": "Gad MZ, Harrison EH", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "1856611", "url": "https://glygen.org/publication/PubMed/1856611" } ] }, { "title": "Role of human aldo-keto-reductase AKR1B10 in the protection against toxic aldehydes.", "journal": "Chemico-biological interactions", "date": "2009", "authors": "Martin HJ, Maser E", "evidence": [ { "database": "UniProtKB", "id": "O60218", "url": "https://www.uniprot.org/uniprot/O60218" } ], "reference": [ { "type": "PubMed", "id": "19013440", "url": "https://glygen.org/publication/PubMed/19013440" } ] }, { "title": "Aldo-keto reductases from the AKR1B subfamily: retinoid specificity and control of cellular retinoic acid levels.", "journal": "Chemico-biological interactions", "date": "2009", "authors": "Ruiz FX, Gallego O, Ardevol A, Moro A, Dominguez M, Alvarez S, Alvarez R, de Lera AR, Rovira C, Fita I, Pares X, Farres J", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "19014918", "url": "https://glygen.org/publication/PubMed/19014918" } ] }, { "title": "Retinol saturase promotes adipogenesis and is downregulated in obesity.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Schupp M, Lefterova MI, Janke J, Leitner K, Cristancho AG, Mullican SE, Qatanani M, Szwergold N, Steger DJ, Curtin JC, Kim RJ, Suh MJ, Albert MR, Engeli S, Gudas LJ, Lazar MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "19139408", "url": "https://glygen.org/publication/PubMed/19139408" } ] }, { "title": "Phosphoproteomic analysis of distinct tumor cell lines in response to nocodazole treatment.", "journal": "Proteomics", "date": "2009", "authors": "Nagano K, Shinkawa T, Mutoh H, Kondoh O, Morimoto S, Inomata N, Ashihara M, Ishii N, Aoki Y, Haramura M", "evidence": [ { "database": "iPTMnet", "id": "O60218", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60218" } ], "reference": [ { "type": "PubMed", "id": "19415658", "url": "https://glygen.org/publication/PubMed/19415658" } ] }, { "title": "Aldo-keto reductase family 1 B10 protein detoxifies dietary and lipid-derived alpha, beta-unsaturated carbonyls at physiological levels.", "journal": "Biochemical and biophysical research communications", "date": "2009-09-18", "authors": "Zhong Linlin, Liu Ziwen, Yan Ruilan, Johnson Stephen, Zhao Yupei, Fang Xiubin, Cao Deliang", "evidence": [ { "database": "UniProtKB", "id": "O60218", "url": "https://www.uniprot.org/uniprot/O60218" } ], "reference": [ { "type": "PubMed", "id": "19563777", "url": "https://glygen.org/publication/PubMed/19563777" } ] }, { "title": "Lysine acetylation targets protein complexes and co-regulates major cellular functions.", "journal": "Science (New York, N.Y.)", "date": "2009", "authors": "Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M", "evidence": [ { "database": "UniProtKB", "id": "O60218", "url": "https://www.uniprot.org/uniprot/O60218" } ], "reference": [ { "type": "PubMed", "id": "19608861", "url": "https://glygen.org/publication/PubMed/19608861" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "iPTMnet", "id": "O60218", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O60218" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "A mitochondrial enzyme degrades carotenoids and protects against oxidative stress.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2011", "authors": "Amengual J, Lobo GP, Golczak M, Li HN, Klimova T, Hoppel CL, Wyss A, Palczewski K, von Lintig J", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "21106934", "url": "https://glygen.org/publication/PubMed/21106934" } ] }, { "title": "Aldo-keto reductase family 1, member B10 is secreted through a lysosome-mediated non-classical pathway.", "journal": "Biochem. J.", "date": "2011", "authors": "Luo Di-xian, Huang Mei C, Ma Jun, Gao Zachary, Liao Duan-fang, Cao Deliang", "evidence": [ { "database": "UniProtKB", "id": "O60218", "url": "https://www.uniprot.org/uniprot/O60218" } ], "reference": [ { "type": "PubMed", "id": "21585341", "url": "https://glygen.org/publication/PubMed/21585341" } ] }, { "title": "Retinaldehyde is a substrate for human aldo-keto reductases of the 1C subfamily.", "journal": "The Biochemical journal", "date": "2011", "authors": "Ruiz FX, Porte S, Gallego O, Moro A, Ardevol A, Del Rio-Espinola A, Rovira C, Farres J, Pares X", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "21851338", "url": "https://glygen.org/publication/PubMed/21851338" } ] }, { "title": "Two carotenoid oxygenases contribute to mammalian provitamin A metabolism.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Amengual J, Widjaja-Adhi MA, Rodriguez-Santiago S, Hessel S, Golczak M, Palczewski K, von Lintig J", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "24106281", "url": "https://glygen.org/publication/PubMed/24106281" } ] }, { "title": "Hydrolysis of retinyl palmitate by enzymes of rat pancreas and liver. Differentiation of bile salt-dependent and bile salt-independent, neutral retinyl ester hydrolases in rat liver.", "journal": "The Journal of biological chemistry", "date": "1989", "authors": "Harrison EH, Gad MZ", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "2793848", "url": "https://glygen.org/publication/PubMed/2793848" } ] }, { "title": "A triarylphosphine-trimethylpiperidine reagent for the one-step derivatization and enrichment of protein post-translational modifications and identification by mass spectrometry.", "journal": "Chemical communications (Cambridge, England)", "date": "2018", "authors": "Huo B, Zhang W, Zhao X, Dong H, Yu Y, Wang J, Qian X, Qin W", "evidence": [ { "database": "O-GlcNAc Database", "id": "O60218", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O60218" } ], "reference": [ { "type": "PubMed", "id": "30379171", "url": "https://glygen.org/publication/PubMed/30379171" } ] }, { "title": "AKR1B10 regulates M2 macrophage polarization to promote the malignant phenotype of gastric cancer.", "journal": "Bioscience reports", "date": "2023-10-31", "authors": "Wu Yi, Hao Yanjie, Zhuang Qing'xin, Ma Xiaoli, Shi Chao", "evidence": [ { "database": "RefSeq", "id": "NP_064695", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_064695" } ], "reference": [ { "type": "PubMed", "id": "37039038", "url": "https://glygen.org/publication/PubMed/37039038" } ] }, { "title": "Transthyretin: a choroid plexus-specific transport protein in human brain. The 1986 S. Weir Mitchell award.", "journal": "Neurology", "date": "1986", "authors": "Herbert J, Wilcox JN, Pham KT, Fremeau RT Jr, Zeviani M, Dwork A, Soprano DR, Makover A, Goodman DS, Zimmerman EA, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "3714052", "url": "https://glygen.org/publication/PubMed/3714052" } ] }, { "title": "Serum AKR1B10 as an indicator of unfavorable survival of hepatocellular carcinoma.", "journal": "Journal of gastroenterology", "date": "2023-07-27", "authors": "Xie Chenglin, Ye Xu, Zeng Li, Zeng Xi, Cao Deliang", "evidence": [ { "database": "RefSeq", "id": "NP_064695", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_064695" } ], "reference": [ { "type": "PubMed", "id": "37500927", "url": "https://glygen.org/publication/PubMed/37500927" } ] }, { "title": "Warburg effect enhanced by AKR1B10 promotes acquired resistance to pemetrexed in lung cancer-derived brain metastasis.", "journal": "Journal of translational medicine", "date": "2023-08-16", "authors": "Duan Wenzhe, Liu Wenwen, Xia Shengkai, Zhou Yang, Tang Mengyi, Xu Mingxin, Lin Manqing, Li Xinyu, Wang Qi", "evidence": [ { "database": "RefSeq", "id": "NP_064695", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_064695" } ], "reference": [ { "type": "PubMed", "id": "37587486", "url": "https://glygen.org/publication/PubMed/37587486" } ] }, { "title": "RNF152 Suppresses Fatty Acid Oxidation and Metastasis of Lung Adenocarcinoma by Inhibiting IRAK1-Mediated AKR1B10 Expression.", "journal": "The American journal of pathology", "date": "2023-10", "authors": "Zhu Dengyan, Nie Yunfei, Zhao Yang, Chen Xiaoming, Yang Zhichang, Yang Yang", "evidence": [ { "database": "RefSeq", "id": "NP_064695", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_064695" } ], "reference": [ { "type": "PubMed", "id": "37717980", "url": "https://glygen.org/publication/PubMed/37717980" } ] }, { "title": "Aldo-keto Reductase 1B10 Restrains Cell Migration, Invasion, and Adhesion of Gastric Cancer via Regulating Integrin Subunit Alpha 5.", "journal": "The Turkish journal of gastroenterology : the official journal of Turkish Society of Gastroenterology", "date": "2023-12", "authors": "Yao Haibo, Hu Junfeng, Shao Yanfei, Shah Qinshu, Zheng Shusen", "evidence": [ { "database": "RefSeq", "id": "NP_064695", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_064695" } ], "reference": [ { "type": "PubMed", "id": "37823316", "url": "https://glygen.org/publication/PubMed/37823316" } ] }, { "title": "Comparison of apolipoprotein C-II-deficient triacylglycerol-rich lipoproteins and trioleoylglycerol/phosphatidylcholine-stabilized particles as substrates for lipoprotein lipase.", "journal": "Biochimica et biophysica acta", "date": "1986", "authors": "Jackson RL, Tajima S, Yamamura T, Yokoyama S, Yamamoto A", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "3942763", "url": "https://glygen.org/publication/PubMed/3942763" } ] }, { "title": "Interchange of apolipoproteins between chylomicrons and high density lipoproteins during alimentary lipemia in man.", "journal": "The Journal of clinical investigation", "date": "1973", "authors": "Havel RJ, Kane JP, Kashyap ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "4345202", "url": "https://glygen.org/publication/PubMed/4345202" } ] }, { "title": "Inhibition of lipoprotein lipase by an apoprotein of human very low density lipoprotein.", "journal": "Biochemical and biophysical research communications", "date": "1972", "authors": "Brown WV, Baginsky ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "5057882", "url": "https://glygen.org/publication/PubMed/5057882" } ] }, { "title": "Retinol-binding protein: the transport protein for vitamin A in human plasma.", "journal": "The Journal of clinical investigation", "date": "1968", "authors": "Kanai M, Raz A, Goodman DS", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "5675424", "url": "https://glygen.org/publication/PubMed/5675424" } ] }, { "title": "Newly administered [3H]retinol is transferred from hepatocytes to stellate cells in liver for storage.", "journal": "Experimental cell research", "date": "1984", "authors": "Blomhoff R, Holte K, Naess L, Berg T", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "6420172", "url": "https://glygen.org/publication/PubMed/6420172" } ] }, { "title": "In vivo uptake of chylomicron [3H]retinyl ester by rat liver: evidence for retinol transfer from parenchymal to nonparenchymal cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1982", "authors": "Blomhoff R, Helgerud P, Rasmussen M, Berg T, Norum KR", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "6961410", "url": "https://glygen.org/publication/PubMed/6961410" } ] }, { "title": "Role of heparan sulfate proteoglycans in the binding and uptake of apolipoprotein E-enriched remnant lipoproteins by cultured cells.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Ji ZS, Brecht WJ, Miranda RD, Hussain MM, Innerarity TL, Mahley RW", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "7683668", "url": "https://glygen.org/publication/PubMed/7683668" } ] }, { "title": "Retinyl ester hydrolytic activity associated with human intestinal brush border membranes.", "journal": "The American journal of clinical nutrition", "date": "1994", "authors": "Rigtrup KM, McEwen LR, Said HM, Ong DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "8017323", "url": "https://glygen.org/publication/PubMed/8017323" } ] }, { "title": "Disruption of the transthyretin gene results in mice with depressed levels of plasma retinol and thyroid hormone.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Episkopou V, Maeda S, Nishiguchi S, Shimada K, Gaitanaris GA, Gottesman ME, Robertson EJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "8384721", "url": "https://glygen.org/publication/PubMed/8384721" } ] }, { "title": "Lipoprotein lipase-mediated uptake of lipoprotein in human fibroblasts: evidence for an LDL receptor-independent internalization pathway.", "journal": "Journal of lipid research", "date": "1996", "authors": "Fernandez-Borja M, Bellido D, Vilella E, Olivecrona G, Vilaro S", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "8728311", "url": "https://glygen.org/publication/PubMed/8728311" } ] }, { "title": "New member of aldose reductase family proteins overexpressed in human hepatocellular carcinoma.", "journal": "Hepatology", "date": "1998", "authors": "Scuric Z, Stain S C, Anderson W F, Hwang J J", "evidence": [ { "database": "UniProtKB", "id": "O60218", "url": "https://www.uniprot.org/uniprot/O60218" } ], "reference": [ { "type": "PubMed", "id": "9537432", "url": "https://glygen.org/publication/PubMed/9537432" } ] }, { "title": "Identification and characterization of a novel human aldose reductase-like gene.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Cao D, Fan ST, Chung SS", "evidence": [ { "database": "UniProtKB", "id": "O60218", "url": "https://www.uniprot.org/uniprot/O60218" } ], "reference": [ { "type": "PubMed", "id": "9565553", "url": "https://glygen.org/publication/PubMed/9565553" } ] }, { "title": "Sequence and expression levels in human tissues of a new member of the aldo-keto reductase family.", "journal": "Biochim. Biophys. Acta", "date": "1998", "authors": "Hyndman DJ, Flynn TG", "evidence": [ { "database": "UniProtKB", "id": "O60218", "url": "https://www.uniprot.org/uniprot/O60218" } ], "reference": [ { "type": "PubMed", "id": "9765596", "url": "https://glygen.org/publication/PubMed/9765596" } ] }, { "title": "Phenotype in retinol deficiency due to a hereditary defect in retinol binding protein synthesis.", "journal": "Investigative ophthalmology & visual science", "date": "1999", "authors": "Seeliger MW, Biesalski HK, Wissinger B, Gollnick H, Gielen S, Frank J, Beck S, Zrenner E", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "9888420", "url": "https://glygen.org/publication/PubMed/9888420" } ] }, { "title": "Molecular and biochemical characterization of lecithin retinol acyltransferase.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Ruiz A, Winston A, Lim YH, Gilbert BA, Rando RR, Bok D", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "9920938", "url": "https://glygen.org/publication/PubMed/9920938" } ] }, { "title": "Retinyl esters are hydrolyzed in early endosomes of J774 macrophages.", "journal": "Journal of lipid research", "date": "1999", "authors": "Hagen E, Myhre AM, Tjelle TE, Berg T, Norum KR", "evidence": [ { "database": "Reactome", "id": "R-HSA-975634", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634" } ], "reference": [ { "type": "PubMed", "id": "9925661", "url": "https://glygen.org/publication/PubMed/9925661" } ] } ], "pathway": [ { "id": "hsa:57016", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:57016", "resource": "KEGG Pathway" }, { "id": "R-HSA-975634", "name": "Retinoid metabolism and transport", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-975634", "resource": "Reactome", "description": "Retinoid metabolism and transport" } ], "orthologs": [ { "uniprot_canonical_ac": "C9JRZ8-1", "protein_name": "Aldo-keto reductase family 1 member B15", "gene_name": "AKR1B15", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MATFVELSTKAKMPIVGLGTWRSLLGKVKEAVKVAIDAEYRHIDCAYFYENQHEVGEAIQEKIQEKAVMREDLFIVSKVWPTFFERPLVRKAFEKTLKDLKLSYLDVYLIHWPQGFKTGDDFFPKDDKGNMISGKGTFLDAWEAMEELVDEGLVKALGVSNFNHFQIERLLNKPGLKYKPVTNQVECHPYLTQEKLIQYCHSKGITVTAYSPLGSPDRPWAKPEDPSLLEDPKIKEIAAKHKKTTAQVLIRFHIQRNVTVIPKSMTPAHIVENIQVFDFKLSDEEMATILSFNRNWRAFDFKEFSHLEDFPFDAEY", "length": 316 }, "evidence": [ { "id": "45919720", "url": "http://www.informatics.jax.org/homology/45919720", "database": "MGI" }, { "id": "45919723", "url": "http://www.informatics.jax.org/homology/45919723", "database": "MGI" }, { "id": "45919722", "url": "http://www.informatics.jax.org/homology/45919722", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "G5E895-1", "protein_name": "Aldo-keto reductase family 1, member B10 (aldose reductase)", "gene_name": "Akr1b10", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAAFVTLLTGAKMPIVGLGTWKSPPAKVREAVKVAIDAGYRHIDCAYVYQNESEVGEAIQEKIQEKAVKREDLFIVSKLWSTFFEKSLVKKAFQNTLSDLKLDYLDLYLIHWPQGFQSGNVFLPTDDKGSILSSKYTFLDAWEAMEELVDQGLVKALGVSNFNHFQIERLLNKPGLKHKPVTNQVECHPYLTQEKLIQYCHSKGITITAYSPLGSPDRPSAKPEDPLLLEIPKIKEIAAKHKRTAAQVLIRFHIERNVVVIPKSVTPSRIQENIQVFDFQLSEEDMAAILSFNRNWRACGLFAASHNEDFPFHAEY", "length": 316 }, "evidence": [ { "id": "45919722", "url": "http://www.informatics.jax.org/homology/45919722", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P21300-1", "protein_name": "Aldo-keto reductase family 1 member B7", "gene_name": "Akr1b7", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MATFVELSTKAKMPLVGLGTWKSSPGQVKEAVKAAIDAGYRHIDCAYVYHNENEVGEAIQEKIKENAVKREDLFIVSKLWATFFEKSLVKKAFQNTLSDLKLDYLDLYLVHWPQGFQAGNALLPKDNKGKVLLSKSTFLDAWEAMEELVDQGLVKALGISNFNHFQIERLLNKPGLKHKPVTNQIESHPYLTQEKLIQYCQSKGIAVTAYSPLGSPDRPYAKPEDPVVMEIPKIKEIAAKHKKTVAQVLIRFHVQRNVVVIPKSVTPSRIQENLQVFDFQLSEEDMAAILSFNRNWRACDLLDARTEEDYPFHEEY", "length": 316 }, "evidence": [ { "id": "45919723", "url": "http://www.informatics.jax.org/homology/45919723", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "P45377-1", "protein_name": "Aldose reductase-related protein 2", "gene_name": "Akr1b8", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MATFVELSTKAKMPIVGLGTWKSPPNQVKEAVKAAIDAGYRHIDCAYAYCNENEVGEAIQEKIKEKAVQREDLFIVSKLWPTCFEKKLLKEAFQKTLTDLKLDYLDLYLIHWPQGLQPGKELFPKDDQGRILTSKTTFLEAWEGMEELVDQGLVKALGVSNFNHFQIERLLNKPGLKHKPVTNQVECHPYLTQEKLIQYCHSKGISVTAYSPLGSPDRPSAKPEDPSLLEDPKIKEIAAKHEKTSAQVLIRFHIQRNVVVIPKSVTPSRIQENIQVFDFQLSDEEMATILSFNRNWRACLLPETVNMEEYPYDAEY", "length": 316 }, "evidence": [ { "id": "45919720", "url": "http://www.informatics.jax.org/homology/45919720", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q5RJP0-1", "protein_name": "Aldo-keto reductase family 1 member B7", "gene_name": "Akr1b7", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MTTFVKLRTKAKMPLVGLGTWKSPPGQVKEAVKAAIDAGYRHFDCAYVYQNESEVGEAIQEKIKEKAVRREDLFIVSKLWSTFFEKSLMKEAFQKTLSDLKLDYLDLYLIHWPQGLQAGKEFLPKDSQGKVLMSKSTFLDAWEGMEELVDQGLVKALGVSNFNHFQIERLLNKPGLKHKPVTNQVECHPYLTQEKLIQYCHSKGIAVIAYSPLGSPDRPYAKPEDPVVLEIPKIKEIAAKHKKTIAQVLIRFHVQRNVAVIPKSVTLSHIKENIQVFDFQLSEEDMAAILSLNRNWRACGLFVTSDEEDFPFHEEY", "length": 316 }, "evidence": [ { "id": "45919723", "url": "http://www.informatics.jax.org/homology/45919723", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q6AY99-1", "protein_name": "Aldo-keto reductase family 1, member B8", "gene_name": "Akr1b10", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MAAFVKLSTKAKMPIVGLGTWKSPPDKVKEAVKAAIDAGYRHFDCAYVYQNESEVGEAIQEKIKEKAVRREDLFIVSKLWPTFFEKSLVKKAFQKTLLDLKLDYLDLYLIHWPQGFQSGNVFLPTDDKGNVLTSKYTFLDAWEGMEELVDQGLVKALGVSNFNHFQIERLLNKPGLKHKPVTNQVECHPYLTQEKLIQYCHSKGIVVTAYSPLGSPDRPSAKPEDPVLLEIPKIKEIASKHKKTAAQVLIRFHIERNVAVIPKSVTPSRIQENIQVFDFQLSEEDMAAILSFNRNWRACGLFAASRNEDFPFHSEY", "length": 316 }, "evidence": [ { "id": "45919720", "url": "http://www.informatics.jax.org/homology/45919720", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "retinoid metabolic process", "id": "GO:0001523", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001523", "evidence": [ { "database": "UniProtKB", "id": "O60218", "url": "https://www.uniprot.org/uniprot/O60218" } ], "pmid": "" }, { "name": "daunorubicin metabolic process", "id": "GO:0044597", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044597", "evidence": [ { "database": "UniProtKB", "id": "O60218", "url": "https://www.uniprot.org/uniprot/O60218" } ], "pmid": "" }, { "name": "doxorubicin metabolic process", "id": "GO:0044598", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044598", "evidence": [ { "database": "UniProtKB", "id": "O60218", "url": "https://www.uniprot.org/uniprot/O60218" } ], "pmid": "" }, { "name": "farnesol catabolic process", "id": "GO:0016488", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016488", "evidence": [ { "database": "UniProtKB", "id": "O60218", "url": "https://www.uniprot.org/uniprot/O60218" } ], "pmid": "" }, { "name": "cellular detoxification of aldehyde", "id": "GO:0110095", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0110095", "evidence": [ { "database": "UniProtKB", "id": "O60218", "url": "https://www.uniprot.org/uniprot/O60218" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "O60218", "url": "https://www.uniprot.org/uniprot/O60218" } ], "pmid": "" }, { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "O60218", "url": "https://www.uniprot.org/uniprot/O60218" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "O60218", "url": "https://www.uniprot.org/uniprot/O60218" } ], "pmid": "" }, { "name": "lysosome", "id": "GO:0005764", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005764", "evidence": [ { "database": "UniProtKB", "id": "O60218", "url": "https://www.uniprot.org/uniprot/O60218" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 8, "go_terms": [ { "name": "alditol:NADP+ 1-oxidoreductase activity", "id": "GO:0004032", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004032", "evidence": [ { "database": "UniProtKB", "id": "O60218", "url": "https://www.uniprot.org/uniprot/O60218" } ], "pmid": "" }, { "name": "retinal dehydrogenase activity", "id": "GO:0001758", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001758", "evidence": [ { "database": "UniProtKB", "id": "O60218", "url": "https://www.uniprot.org/uniprot/O60218" } ], "pmid": "" }, { "name": "aldo-keto reductase (NADP) activity", "id": "GO:0004033", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004033", "evidence": [ { "database": "UniProtKB", "id": "O60218", "url": "https://www.uniprot.org/uniprot/O60218" } ], "pmid": "" }, { "name": "alcohol dehydrogenase (NADP+) activity", "id": "GO:0008106", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008106", "evidence": [ { "database": "UniProtKB", "id": "O60218", "url": "https://www.uniprot.org/uniprot/O60218" } ], "pmid": "" }, { "name": "geranylgeranyl reductase activity", "id": "GO:0045550", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045550", "evidence": [ { "database": "UniProtKB", "id": "O60218", "url": "https://www.uniprot.org/uniprot/O60218" } ], "pmid": "" }, { "name": "indanol dehydrogenase activity", "id": "GO:0047718", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0047718", "evidence": [ { "database": "UniProtKB", "id": "O60218", "url": "https://www.uniprot.org/uniprot/O60218" } ], "pmid": "" }, { "name": "NADP-retinol dehydrogenase activity", "id": "GO:0052650", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0052650", "evidence": [ { "database": "UniProtKB", "id": "O60218", "url": "https://www.uniprot.org/uniprot/O60218" } ], "pmid": "" }, { "name": "allyl-alcohol dehydrogenase activity", "id": "GO:0047655", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0047655", "evidence": [ { "database": "UniProtKB", "id": "O60218", "url": "https://www.uniprot.org/uniprot/O60218" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 161, "end_pos": 163, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "12168", "name": "", "equation": "allyl alcohol + NADP(+) = acrolein + H(+) + NADPH", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P51635-1", "P07943-1", "C9JRZ8-1", "O60218-1", "P14550-1", "P15121-1", "P45376-1", "Q9JII6-1", "P00330-1" ], "evidence": [ { "id": "12168", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/12168" } ] }, { "id": "25033", "name": "", "equation": "all-trans-retinol + NADP(+) = all-trans-retinal + H(+) + NADPH", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q80ZF7-1", "P07943-1", "D4A8D2-1", "Q8VID1-1", "A0A8I6AEH6-1", "Q6AXX5-1", "D3ZEP9-1", "A0A8I6ASF1-1", "A0A8I6A068-1", "C9JRZ8-1", "O60218-1", "P15121-1", "O75911-1", "Q9NYR8-1", "Q96NR8-1", "Q9HBH5-1", "Q8TC12-1", "Q8IZV5-1", "Q8NBN7-1", "Q9Y394-1", "Q8VCH7-1", "P45376-1", "O88876-1", "Q8CEE7-1", "Q9ERI6-1", "Q8BYK4-1", "Q9QYF1-1", "D3Z6W3-1", "Q99LB2-1", "Q9CXR1-1", "Q9W3K9-1", "Q9VKB8-1" ], "evidence": [ { "id": "25033", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/25033" } ] }, { "id": "54916", "name": "", "equation": "9-cis-retinol + NADP(+) = 9-cis-retinal + H(+) + NADPH", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P07943-1", "A0A8I6AEH6-1", "Q6AXX5-1", "D3ZEP9-1", "A0A8I6ASF1-1", "A0A8I6A068-1", "C9JRZ8-1", "O60218-1", "P15121-1", "Q96NR8-1", "Q9HBH5-1", "Q8TC12-1", "P42330-1", "P45376-1", "Q9ERI6-1", "Q8BYK4-1", "Q9QYF1-1" ], "evidence": [ { "id": "54916", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/54916" } ] }, { "id": "54920", "name": "", "equation": "13-cis-retinol + NADP(+) = 13-cis-retinal + H(+) + NADPH", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P07943-1", "A0A8I6AEH6-1", "A0A8I6ASF1-1", "A0A8I6A068-1", "O60218-1", "P15121-1", "Q8TC12-1", "P45376-1", "Q9QYF1-1" ], "evidence": [ { "id": "54920", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/54920" } ] }, { "id": "58336", "name": "", "equation": "a 4-hydroxynonen-1-ol + NADP(+) = a 4-hydroxynonenal + H(+) + NADPH", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P07943-1", "A0A8I6AEH6-1", "A0A8I6ASF1-1", "A0A8I6A068-1", "O60218-1", "P14550-1", "P15121-1", "Q96NR8-1", "P45376-1", "Q8BYK4-1" ], "evidence": [ { "id": "58336", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/58336" } ] }, { "id": "58416", "name": "", "equation": "(E)-4-hydroxynon-2-en-1-ol + NADP(+) = (E)-4-hydroxynon-2-enal + H(+) + NADPH", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "C9JRZ8-1", "O60218-1" ], "evidence": [ { "id": "58416", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/58416" } ] }, { "id": "58420", "name": "", "equation": "NADP(+) + prenol = 3-methyl-2-butenal + H(+) + NADPH", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P07943-1", "A0A8I6AEH6-1", "A0A8I6ASF1-1", "A0A8I6A068-1", "O60218-1", "P15121-1", "P45376-1" ], "evidence": [ { "id": "58420", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/58420" } ] }, { "id": "58424", "name": "", "equation": "(E)-hex-2-en-1-ol + NADP(+) = (E)-hex-2-enal + H(+) + NADPH", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P07943-1", "A0A8I6AEH6-1", "A0A8I6ASF1-1", "A0A8I6A068-1", "C9JRZ8-1", "O60218-1", "P15121-1", "P45376-1" ], "evidence": [ { "id": "58424", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/58424" } ] }, { "id": "58428", "name": "", "equation": "(E,E)-2,4-hexadien-1-ol + NADP(+) = (E,E)-2,4-hexadienal + H(+) + NADPH", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P07943-1", "A0A8I6AEH6-1", "A0A8I6ASF1-1", "A0A8I6A068-1", "O60218-1", "P15121-1", "P45376-1" ], "evidence": [ { "id": "58428", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/58428" } ] }, { "id": "58432", "name": "", "equation": "(E)-4-oxonon-2-en-1-ol + NADP(+) = (E)-4-oxonon-2-enal + H(+) + NADPH", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O60218-1" ], "evidence": [ { "id": "58432", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/58432" } ] }, { "id": "58436", "name": "", "equation": "4-methylpentan-1-ol + NADP(+) = 4-methylpentanal + H(+) + NADPH", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O60218-1" ], "evidence": [ { "id": "58436", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/58436" } ] }, { "id": "R-HSA-2855252", "name": "AKRs reduce RBP2:atRAL to RBP2:atROL", "equation": "", "summary": "RDH11 is the best-characterised enzyme that reduces all-trans-retinal (atRAL) to all-trans-retinol (atROL). In addition, several aldo-keto reductase (AKR) enzymes from subfamilies 1B and 1C also show all-trans-retinal (atRAL) reductase activity. AKR1B10 shows high reductase activity towards atRAL (Gallego et al. 2007, Ruiz et al. 2009) whereas AKR1C1, 1C3 and 1C4 all show much lower reductase activity towards arRAL (Ruiz et al. 2011).", "cellular_location": "cytosol", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O60218-1", "P17516-1", "P42330-1", "Q04828-1" ], "evidence": [ { "id": "R-HSA-2855252", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2855252" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "A0A8I6A068", "gene_name": "Akr1b1-ps2", "activity": [ { "ec_number": "1.1.1.300", "activity": "all-trans-retinol + NADP(+) = all-trans-retinal + H(+) + NADPH.", "evidence": [ { "id": "A0A8I6A068", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6A068" } ] }, { "ec_number": "1.1.1.21", "activity": "an alditol + NADP(+) = an aldose + H(+) + NADPH.", "evidence": [ { "id": "A0A8I6A068", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6A068" } ] }, { "ec_number": "1.1.1.300", "activity": "", "evidence": [ { "id": "A0A8I6A068", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6A068" } ] }, { "ec_number": "1.1.1.21", "activity": "", "evidence": [ { "id": "A0A8I6A068", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6A068" } ] } ] }, { "uniprot_ac": "A0A8I6AEH6", "gene_name": "AC127963.2", "activity": [ { "ec_number": "1.1.1.300", "activity": "all-trans-retinol + NADP(+) = all-trans-retinal + H(+) + NADPH.", "evidence": [ { "id": "A0A8I6AEH6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6AEH6" } ] }, { "ec_number": "1.1.1.21", "activity": "an alditol + NADP(+) = an aldose + H(+) + NADPH.", "evidence": [ { "id": "A0A8I6AEH6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6AEH6" } ] }, { "ec_number": "1.1.1.300", "activity": "", "evidence": [ { "id": "A0A8I6AEH6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6AEH6" } ] }, { "ec_number": "1.1.1.21", "activity": "", "evidence": [ { "id": "A0A8I6AEH6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6AEH6" } ] } ] }, { "uniprot_ac": "A0A8I6ASF1", "gene_name": "Akr1b1-ps1", "activity": [ { "ec_number": "1.1.1.300", "activity": "all-trans-retinol + NADP(+) = all-trans-retinal + H(+) + NADPH.", "evidence": [ { "id": "A0A8I6ASF1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6ASF1" } ] }, { "ec_number": "1.1.1.21", "activity": "an alditol + NADP(+) = an aldose + H(+) + NADPH.", "evidence": [ { "id": "A0A8I6ASF1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6ASF1" } ] }, { "ec_number": "1.1.1.21", "activity": "", "evidence": [ { "id": "A0A8I6ASF1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6ASF1" } ] }, { "ec_number": "1.1.1.300", "activity": "", "evidence": [ { "id": "A0A8I6ASF1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6ASF1" } ] } ] }, { "uniprot_ac": "C9JRZ8", "gene_name": "AKR1B15", "activity": [ { "ec_number": "1.1.1.300", "activity": "all-trans-retinol + NADP(+) = all-trans-retinal + H(+) + NADPH.", "evidence": [ { "id": "C9JRZ8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/C9JRZ8" } ] }, { "ec_number": "1.1.1.-", "activity": "", "evidence": [ { "id": "C9JRZ8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/C9JRZ8" } ] }, { "ec_number": "1.1.1.64", "activity": "NADP(+) + testosterone = androst-4-ene-3,17-dione + H(+) + NADPH.", "evidence": [ { "id": "C9JRZ8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/C9JRZ8" } ] }, { "ec_number": "1.1.1.54", "activity": "allyl alcohol + NADP(+) = acrolein + H(+) + NADPH.", "evidence": [ { "id": "C9JRZ8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/C9JRZ8" } ] }, { "ec_number": "1.1.1.216", "activity": "(2E,6E)-farnesol + NADP(+) = (2E,6E)-farnesal + H(+) + NADPH.", "evidence": [ { "id": "C9JRZ8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/C9JRZ8" } ] }, { "ec_number": "1.1.1.300", "activity": "", "evidence": [ { "id": "C9JRZ8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/C9JRZ8" } ] }, { "ec_number": "1.1.1.54", "activity": "", "evidence": [ { "id": "C9JRZ8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/C9JRZ8" } ] } ] }, { "uniprot_ac": "D3Z6W3", "gene_name": "Rdh8", "activity": [ { "ec_number": "1.1.1.300", "activity": "all-trans-retinol + NADP(+) = all-trans-retinal + H(+) + NADPH.", "evidence": [ { "id": "D3Z6W3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3Z6W3" } ] }, { "ec_number": "1.1.1.300", "activity": "", "evidence": [ { "id": "D3Z6W3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3Z6W3" } ] } ] }, { "uniprot_ac": "D3ZEP9", "gene_name": "Rdh12", "activity": [ { "ec_number": "1.1.1.300", "activity": "all-trans-retinol + NADP(+) = all-trans-retinal + H(+) + NADPH.", "evidence": [ { "id": "D3ZEP9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZEP9" } ] }, { "ec_number": "1.1.1.300", "activity": "", "evidence": [ { "id": "D3ZEP9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZEP9" } ] } ] }, { "uniprot_ac": "D4A8D2", "gene_name": "Rdh8", "activity": [ { "ec_number": "1.1.1.300", "activity": "all-trans-retinol + NADP(+) = all-trans-retinal + H(+) + NADPH.", "evidence": [ { "id": "D4A8D2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4A8D2" } ] }, { "ec_number": "1.1.1.300", "activity": "", "evidence": [ { "id": "D4A8D2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4A8D2" } ] } ] }, { "uniprot_ac": "O60218", "gene_name": "AKR1B10", "activity": [ { "ec_number": "1.1.1.300", "activity": "all-trans-retinol + NADP(+) = all-trans-retinal + H(+) + NADPH.", "evidence": [ { "id": "O60218", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60218" } ] }, { "ec_number": "1.1.1.54", "activity": "allyl alcohol + NADP(+) = acrolein + H(+) + NADPH.", "evidence": [ { "id": "O60218", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60218" } ] }, { "ec_number": "1.1.1.300", "activity": "", "evidence": [ { "id": "O60218", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60218" } ] }, { "ec_number": "1.1.1.54", "activity": "", "evidence": [ { "id": "O60218", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O60218" } ] } ] }, { "uniprot_ac": "O75911", "gene_name": "DHRS3", "activity": [ { "ec_number": "1.1.1.300", "activity": "all-trans-retinol + NADP(+) = all-trans-retinal + H(+) + NADPH.", "evidence": [ { "id": "O75911", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75911" } ] }, { "ec_number": "1.1.1.300", "activity": "", "evidence": [ { "id": "O75911", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75911" } ] } ] }, { "uniprot_ac": "O88876", "gene_name": "Dhrs3", "activity": [ { "ec_number": "1.1.1.300", "activity": "all-trans-retinol + NADP(+) = all-trans-retinal + H(+) + NADPH.", "evidence": [ { "id": "O88876", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88876" } ] }, { "ec_number": "1.1.1.300", "activity": "", "evidence": [ { "id": "O88876", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O88876" } ] } ] }, { "uniprot_ac": "P00330", "gene_name": "ADH1", "activity": [ { "ec_number": "1.1.1.1", "activity": "ethanol + NAD(+) = acetaldehyde + H(+) + NADH.", "evidence": [ { "id": "P00330", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00330" } ] }, { "ec_number": "1.1.1.54", "activity": "allyl alcohol + NADP(+) = acrolein + H(+) + NADPH.", "evidence": [ { "id": "P00330", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00330" } ] }, { "ec_number": "1.1.1.78", "activity": "(R)-lactaldehyde + NAD(+) = H(+) + methylglyoxal + NADH.", "evidence": [ { "id": "P00330", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00330" } ] }, { "ec_number": "1.1.1.54", "activity": "", "evidence": [ { "id": "P00330", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00330" } ] }, { "ec_number": "1.1.1.1", "activity": "", "evidence": [ { "id": "P00330", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00330" } ] }, { "ec_number": "1.1.1.78", "activity": "", "evidence": [ { "id": "P00330", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00330" } ] } ] }, { "uniprot_ac": "P07943", "gene_name": "Akr1b1", "activity": [ { "ec_number": "1.1.1.300", "activity": "all-trans-retinol + NADP(+) = all-trans-retinal + H(+) + NADPH.", "evidence": [ { "id": "P07943", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07943" } ] }, { "ec_number": "1.1.1.21", "activity": "an alditol + NADP(+) = an aldose + H(+) + NADPH.", "evidence": [ { "id": "P07943", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07943" } ] }, { "ec_number": "1.1.1.372", "activity": "glycerol + NADP(+) = H(+) + L-glyceraldehyde + NADPH.", "evidence": [ { "id": "P07943", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07943" } ] }, { "ec_number": "1.1.1.54", "activity": "allyl alcohol + NADP(+) = acrolein + H(+) + NADPH.", "evidence": [ { "id": "P07943", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07943" } ] }, { "ec_number": "1.1.1.21", "activity": "", "evidence": [ { "id": "P07943", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07943" } ] }, { "ec_number": "1.1.1.372", "activity": "", "evidence": [ { "id": "P07943", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07943" } ] }, { "ec_number": "1.1.1.54", "activity": "", "evidence": [ { "id": "P07943", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07943" } ] }, { "ec_number": "1.1.1.300", "activity": "", "evidence": [ { "id": "P07943", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P07943" } ] } ] }, { "uniprot_ac": "P14550", "gene_name": "AKR1A1", "activity": [ { "ec_number": "1.1.1.2", "activity": "a secondary alcohol + NADP(+) = a ketone + H(+) + NADPH.", "evidence": [ { "id": "P14550", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14550" } ] }, { "ec_number": "1.1.1.19", "activity": "L-gulonate + NADP(+) = aldehydo-D-glucuronate + H(+) + NADPH.", "evidence": [ { "id": "P14550", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14550" } ] }, { "ec_number": "1.1.1.20", "activity": "L-gulono-1,4-lactone + NADP(+) = D-glucurono-3,6-lactone + H(+) + NADPH.", "evidence": [ { "id": "P14550", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14550" } ] }, { "ec_number": "1.1.1.372", "activity": "glycerol + NADP(+) = H(+) + L-glyceraldehyde + NADPH.", "evidence": [ { "id": "P14550", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14550" } ] }, { "ec_number": "1.1.1.54", "activity": "allyl alcohol + NADP(+) = acrolein + H(+) + NADPH.", "evidence": [ { "id": "P14550", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14550" } ] }, { "ec_number": "1.1.1.372", "activity": "", "evidence": [ { "id": "P14550", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14550" } ] }, { "ec_number": "1.1.1.2", "activity": "", "evidence": [ { "id": "P14550", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14550" } ] }, { "ec_number": "1.1.1.54", "activity": "", "evidence": [ { "id": "P14550", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P14550" } ] } ] }, { "uniprot_ac": "P15121", "gene_name": "AKR1B1", "activity": [ { "ec_number": "1.1.1.300", "activity": "all-trans-retinol + NADP(+) = all-trans-retinal + H(+) + NADPH.", "evidence": [ { "id": "P15121", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15121" } ] }, { "ec_number": "1.1.1.21", "activity": "an alditol + NADP(+) = an aldose + H(+) + NADPH.", "evidence": [ { "id": "P15121", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15121" } ] }, { "ec_number": "1.1.1.372", "activity": "glycerol + NADP(+) = H(+) + L-glyceraldehyde + NADPH.", "evidence": [ { "id": "P15121", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15121" } ] }, { "ec_number": "1.1.1.54", "activity": "allyl alcohol + NADP(+) = acrolein + H(+) + NADPH.", "evidence": [ { "id": "P15121", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15121" } ] }, { "ec_number": "1.1.1.372", "activity": "", "evidence": [ { "id": "P15121", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15121" } ] }, { "ec_number": "1.1.1.300", "activity": "", "evidence": [ { "id": "P15121", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15121" } ] }, { "ec_number": "1.1.1.54", "activity": "", "evidence": [ { "id": "P15121", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15121" } ] }, { "ec_number": "1.1.1.21", "activity": "", "evidence": [ { "id": "P15121", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P15121" } ] } ] }, { "uniprot_ac": "P17516", "gene_name": "AKR1C4", "activity": [ { "ec_number": "1.1.1.-", "activity": "", "evidence": [ { "id": "P17516", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17516" } ] }, { "ec_number": "1.1.1.225", "activity": "chlordecone alcohol + NADP(+) = chlordecone + H(+) + NADPH.", "evidence": [ { "id": "P17516", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17516" } ] }, { "ec_number": "1.1.1.357", "activity": "a 3alpha-hydroxysteroid + NADP(+) = a 3-oxosteroid + H(+) + NADPH.", "evidence": [ { "id": "P17516", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17516" } ] }, { "ec_number": "1.1.1.62", "activity": "17beta-estradiol + NAD(+) = estrone + H(+) + NADH.", "evidence": [ { "id": "P17516", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17516" } ] }, { "ec_number": "1.1.1.209", "activity": "androsterone + NADP(+) = 5alpha-androstan-3,17-dione + H(+) + NADPH.", "evidence": [ { "id": "P17516", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17516" } ] }, { "ec_number": "1.1.1.51", "activity": "NAD(+) + testosterone = androst-4-ene-3,17-dione + H(+) + NADH.", "evidence": [ { "id": "P17516", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17516" } ] }, { "ec_number": "1.1.1.210", "activity": "5alpha-androstane-3beta,17beta-diol + NADP(+) = 17beta-hydroxy-5alpha-androstan-3-one + H(+) + NADPH.", "evidence": [ { "id": "P17516", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17516" } ] }, { "ec_number": "1.1.1.53", "activity": "5alpha-androstane-3alpha,17beta-diol + NAD(+) = 17beta-hydroxy-5alpha-androstan-3-one + H(+) + NADH.", "evidence": [ { "id": "P17516", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17516" } ] }, { "ec_number": "1.1.1.62", "activity": "", "evidence": [ { "id": "P17516", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17516" } ] }, { "ec_number": "1.1.1.209", "activity": "", "evidence": [ { "id": "P17516", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17516" } ] }, { "ec_number": "1.1.1.53", "activity": "", "evidence": [ { "id": "P17516", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17516" } ] }, { "ec_number": "1.1.1.51", "activity": "", "evidence": [ { "id": "P17516", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17516" } ] }, { "ec_number": "1.1.1.210", "activity": "", "evidence": [ { "id": "P17516", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P17516" } ] } ] }, { "uniprot_ac": "P42330", "gene_name": "AKR1C3", "activity": [ { "ec_number": "1.1.1.-", "activity": "", "evidence": [ { "id": "P42330", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42330" } ] }, { "ec_number": "1.1.1.357", "activity": "a 3alpha-hydroxysteroid + NADP(+) = a 3-oxosteroid + H(+) + NADPH.", "evidence": [ { "id": "P42330", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42330" } ] }, { "ec_number": "1.1.1.62", "activity": "17beta-estradiol + NAD(+) = estrone + H(+) + NADH.", "evidence": [ { "id": "P42330", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42330" } ] }, { "ec_number": "1.1.1.188", "activity": "NADP(+) + prostaglandin F2alpha = H(+) + NADPH + prostaglandin D2.", "evidence": [ { "id": "P42330", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42330" } ] }, { "ec_number": "1.1.1.239", "activity": "NAD(+) + testosterone = androst-4-ene-3,17-dione + H(+) + NADH.", "evidence": [ { "id": "P42330", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42330" } ] }, { "ec_number": "1.1.1.64", "activity": "NADP(+) + testosterone = androst-4-ene-3,17-dione + H(+) + NADPH.", "evidence": [ { "id": "P42330", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42330" } ] }, { "ec_number": "1.1.1.210", "activity": "5alpha-androstane-3beta,17beta-diol + NADP(+) = 17beta-hydroxy-5alpha-androstan-3-one + H(+) + NADPH.", "evidence": [ { "id": "P42330", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42330" } ] }, { "ec_number": "1.1.1.53", "activity": "5alpha-androstane-3alpha,17beta-diol + NAD(+) = 17beta-hydroxy-5alpha-androstan-3-one + H(+) + NADH.", "evidence": [ { "id": "P42330", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42330" } ] }, { "ec_number": "1.1.1.210", "activity": "", "evidence": [ { "id": "P42330", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42330" } ] }, { "ec_number": "1.1.1.53", "activity": "", "evidence": [ { "id": "P42330", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42330" } ] }, { "ec_number": "1.1.1.62", "activity": "", "evidence": [ { "id": "P42330", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P42330" } ] } ] }, { "uniprot_ac": "P45376", "gene_name": "Akr1b1", "activity": [ { "ec_number": "1.1.1.300", "activity": "all-trans-retinol + NADP(+) = all-trans-retinal + H(+) + NADPH.", "evidence": [ { "id": "P45376", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P45376" } ] }, { "ec_number": "1.1.1.21", "activity": "an alditol + NADP(+) = an aldose + H(+) + NADPH.", "evidence": [ { "id": "P45376", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P45376" } ] }, { "ec_number": "1.1.1.21", "activity": "", "evidence": [ { "id": "P45376", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P45376" } ] }, { "ec_number": "1.1.1.300", "activity": "", "evidence": [ { "id": "P45376", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P45376" } ] }, { "ec_number": "1.1.1.372", "activity": "glycerol + NADP(+) = H(+) + L-glyceraldehyde + NADPH.", "evidence": [ { "id": "P45376", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P45376" } ] }, { "ec_number": "1.1.1.54", "activity": "allyl alcohol + NADP(+) = acrolein + H(+) + NADPH.", "evidence": [ { "id": "P45376", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P45376" } ] }, { "ec_number": "1.1.1.54", "activity": "", "evidence": [ { "id": "P45376", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P45376" } ] }, { "ec_number": "1.1.1.372", "activity": "", "evidence": [ { "id": "P45376", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P45376" } ] } ] }, { "uniprot_ac": "P51635", "gene_name": "Akr1a1", "activity": [ { "ec_number": "1.1.1.2", "activity": "a secondary alcohol + NADP(+) = a ketone + H(+) + NADPH.", "evidence": [ { "id": "P51635", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51635" } ] }, { "ec_number": "1.1.1.19", "activity": "L-gulonate + NADP(+) = aldehydo-D-glucuronate + H(+) + NADPH.", "evidence": [ { "id": "P51635", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51635" } ] }, { "ec_number": "1.1.1.20", "activity": "L-gulono-1,4-lactone + NADP(+) = D-glucurono-3,6-lactone + H(+) + NADPH.", "evidence": [ { "id": "P51635", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51635" } ] }, { "ec_number": "1.1.1.372", "activity": "glycerol + NADP(+) = H(+) + L-glyceraldehyde + NADPH.", "evidence": [ { "id": "P51635", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51635" } ] }, { "ec_number": "1.1.1.54", "activity": "allyl alcohol + NADP(+) = acrolein + H(+) + NADPH.", "evidence": [ { "id": "P51635", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51635" } ] }, { "ec_number": "1.1.1.54", "activity": "", "evidence": [ { "id": "P51635", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51635" } ] }, { "ec_number": "1.1.1.2", "activity": "", "evidence": [ { "id": "P51635", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51635" } ] }, { "ec_number": "1.1.1.20", "activity": "", "evidence": [ { "id": "P51635", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51635" } ] }, { "ec_number": "1.1.1.372", "activity": "", "evidence": [ { "id": "P51635", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51635" } ] }, { "ec_number": "1.1.1.19", "activity": "", "evidence": [ { "id": "P51635", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P51635" } ] } ] }, { "uniprot_ac": "Q04828", "gene_name": "AKR1C1", "activity": [ { "ec_number": "1.1.1.-", "activity": "", "evidence": [ { "id": "Q04828", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04828" } ] }, { "ec_number": "1.1.1.357", "activity": "a 3alpha-hydroxysteroid + NADP(+) = a 3-oxosteroid + H(+) + NADPH.", "evidence": [ { "id": "Q04828", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04828" } ] }, { "ec_number": "1.1.1.62", "activity": "17beta-estradiol + NAD(+) = estrone + H(+) + NADH.", "evidence": [ { "id": "Q04828", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04828" } ] }, { "ec_number": "1.1.1.112", "activity": "(S)-indan-1-ol + NAD(+) = H(+) + indan-1-one + NADH.", "evidence": [ { "id": "Q04828", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04828" } ] }, { "ec_number": "1.1.1.149", "activity": "(17R,20S)-17,20-dihydroxypregn-4-en-3-one + NAD(+) = 17alpha-hydroxyprogesterone + H(+) + NADH.", "evidence": [ { "id": "Q04828", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04828" } ] }, { "ec_number": "1.3.1.20", "activity": "(1R,2R)-1,2-dihydrobenzene-1,2-diol + NADP(+) = catechol + H(+) + NADPH.", "evidence": [ { "id": "Q04828", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04828" } ] }, { "ec_number": "1.1.1.209", "activity": "androsterone + NADP(+) = 5alpha-androstan-3,17-dione + H(+) + NADPH.", "evidence": [ { "id": "Q04828", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04828" } ] }, { "ec_number": "1.1.1.51", "activity": "NAD(+) + testosterone = androst-4-ene-3,17-dione + H(+) + NADH.", "evidence": [ { "id": "Q04828", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04828" } ] }, { "ec_number": "1.1.1.210", "activity": "5alpha-androstane-3beta,17beta-diol + NADP(+) = 17beta-hydroxy-5alpha-androstan-3-one + H(+) + NADPH.", "evidence": [ { "id": "Q04828", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04828" } ] }, { "ec_number": "1.1.1.53", "activity": "5alpha-androstane-3alpha,17beta-diol + NAD(+) = 17beta-hydroxy-5alpha-androstan-3-one + H(+) + NADH.", "evidence": [ { "id": "Q04828", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04828" } ] }, { "ec_number": "1.1.1.62", "activity": "", "evidence": [ { "id": "Q04828", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04828" } ] }, { "ec_number": "1.1.1.209", "activity": "", "evidence": [ { "id": "Q04828", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04828" } ] }, { "ec_number": "1.3.1.20", "activity": "", "evidence": [ { "id": "Q04828", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04828" } ] }, { "ec_number": "1.1.1.53", "activity": "", "evidence": [ { "id": "Q04828", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04828" } ] }, { "ec_number": "1.1.1.112", "activity": "", "evidence": [ { "id": "Q04828", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04828" } ] }, { "ec_number": "1.1.1.210", "activity": "", "evidence": [ { "id": "Q04828", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04828" } ] }, { "ec_number": "1.1.1.357", "activity": "", "evidence": [ { "id": "Q04828", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04828" } ] }, { "ec_number": "1.1.1.51", "activity": "", "evidence": [ { "id": "Q04828", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04828" } ] } ] }, { "uniprot_ac": "Q6AXX5", "gene_name": "Rdh11", "activity": [ { "ec_number": "1.1.1.300", "activity": "all-trans-retinol + NADP(+) = all-trans-retinal + H(+) + NADPH.", "evidence": [ { "id": "Q6AXX5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AXX5" } ] }, { "ec_number": "1.1.1.300", "activity": "", "evidence": [ { "id": "Q6AXX5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6AXX5" } ] } ] }, { "uniprot_ac": "Q80ZF7", "gene_name": "Rdh10", "activity": [ { "ec_number": "1.1.1.300", "activity": "all-trans-retinol + NADP(+) = all-trans-retinal + H(+) + NADPH.", "evidence": [ { "id": "Q80ZF7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80ZF7" } ] }, { "ec_number": "1.1.1.300", "activity": "", "evidence": [ { "id": "Q80ZF7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q80ZF7" } ] } ] }, { "uniprot_ac": "Q8BYK4", "gene_name": "Rdh12", "activity": [ { "ec_number": "1.1.1.300", "activity": "all-trans-retinol + NADP(+) = all-trans-retinal + H(+) + NADPH.", "evidence": [ { "id": "Q8BYK4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BYK4" } ] }, { "ec_number": "1.1.1.300", "activity": "", "evidence": [ { "id": "Q8BYK4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BYK4" } ] } ] }, { "uniprot_ac": "Q8CEE7", "gene_name": "Rdh13", "activity": [ { "ec_number": "1.1.1.300", "activity": "all-trans-retinol + NADP(+) = all-trans-retinal + H(+) + NADPH.", "evidence": [ { "id": "Q8CEE7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CEE7" } ] }, { "ec_number": "1.1.1.300", "activity": "", "evidence": [ { "id": "Q8CEE7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8CEE7" } ] } ] }, { "uniprot_ac": "Q8IZV5", "gene_name": "RDH10", "activity": [ { "ec_number": "1.1.1.300", "activity": "all-trans-retinol + NADP(+) = all-trans-retinal + H(+) + NADPH.", "evidence": [ { "id": "Q8IZV5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IZV5" } ] }, { "ec_number": "1.1.1.300", "activity": "", "evidence": [ { "id": "Q8IZV5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IZV5" } ] } ] }, { "uniprot_ac": "Q8NBN7", "gene_name": "RDH13", "activity": [ { "ec_number": "1.1.1.300", "activity": "all-trans-retinol + NADP(+) = all-trans-retinal + H(+) + NADPH.", "evidence": [ { "id": "Q8NBN7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NBN7" } ] }, { "ec_number": "1.1.1.300", "activity": "", "evidence": [ { "id": "Q8NBN7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NBN7" } ] } ] }, { "uniprot_ac": "Q8TC12", "gene_name": "RDH11", "activity": [ { "ec_number": "1.1.1.300", "activity": "all-trans-retinol + NADP(+) = all-trans-retinal + H(+) + NADPH.", "evidence": [ { "id": "Q8TC12", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8TC12" } ] }, { "ec_number": "1.1.1.300", "activity": "", "evidence": [ { "id": "Q8TC12", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8TC12" } ] } ] }, { "uniprot_ac": "Q8VCH7", "gene_name": "Rdh10", "activity": [ { "ec_number": "1.1.1.300", "activity": "all-trans-retinol + NADP(+) = all-trans-retinal + H(+) + NADPH.", "evidence": [ { "id": "Q8VCH7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VCH7" } ] }, { "ec_number": "1.1.1.300", "activity": "", "evidence": [ { "id": "Q8VCH7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VCH7" } ] } ] }, { "uniprot_ac": "Q8VID1", "gene_name": "Dhrs4", "activity": [ { "ec_number": "1.1.1.300", "activity": "all-trans-retinol + NADP(+) = all-trans-retinal + H(+) + NADPH.", "evidence": [ { "id": "Q8VID1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VID1" } ] }, { "ec_number": "1.1.1.184", "activity": "a secondary alcohol + NADP(+) = a ketone + H(+) + NADPH.", "evidence": [ { "id": "Q8VID1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VID1" } ] }, { "ec_number": "1.1.1.184", "activity": "", "evidence": [ { "id": "Q8VID1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VID1" } ] }, { "ec_number": "1.1.1.300", "activity": "", "evidence": [ { "id": "Q8VID1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8VID1" } ] } ] }, { "uniprot_ac": "Q96NR8", "gene_name": "RDH12", "activity": [ { "ec_number": "1.1.1.300", "activity": "all-trans-retinol + NADP(+) = all-trans-retinal + H(+) + NADPH.", "evidence": [ { "id": "Q96NR8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96NR8" } ] }, { "ec_number": "1.1.1.300", "activity": "", "evidence": [ { "id": "Q96NR8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q96NR8" } ] } ] }, { "uniprot_ac": "Q99LB2", "gene_name": "Dhrs4", "activity": [ { "ec_number": "1.1.1.300", "activity": "all-trans-retinol + NADP(+) = all-trans-retinal + H(+) + NADPH.", "evidence": [ { "id": "Q99LB2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99LB2" } ] }, { "ec_number": "1.1.1.184", "activity": "a secondary alcohol + NADP(+) = a ketone + H(+) + NADPH.", "evidence": [ { "id": "Q99LB2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99LB2" } ] }, { "ec_number": "1.1.1.300", "activity": "", "evidence": [ { "id": "Q99LB2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99LB2" } ] }, { "ec_number": "1.1.1.184", "activity": "", "evidence": [ { "id": "Q99LB2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99LB2" } ] } ] }, { "uniprot_ac": "Q9CXR1", "gene_name": "Dhrs7", "activity": [ { "ec_number": "1.1.1.-", "activity": "", "evidence": [ { "id": "Q9CXR1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9CXR1" } ] } ] }, { "uniprot_ac": "Q9ERI6", "gene_name": "Rdh14", "activity": [ { "ec_number": "1.1.1.300", "activity": "all-trans-retinol + NADP(+) = all-trans-retinal + H(+) + NADPH.", "evidence": [ { "id": "Q9ERI6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ERI6" } ] }, { "ec_number": "1.1.1.300", "activity": "", "evidence": [ { "id": "Q9ERI6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9ERI6" } ] } ] }, { "uniprot_ac": "Q9HBH5", "gene_name": "RDH14", "activity": [ { "ec_number": "1.1.1.300", "activity": "all-trans-retinol + NADP(+) = all-trans-retinal + H(+) + NADPH.", "evidence": [ { "id": "Q9HBH5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HBH5" } ] }, { "ec_number": "1.1.1.300", "activity": "", "evidence": [ { "id": "Q9HBH5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9HBH5" } ] } ] }, { "uniprot_ac": "Q9JII6", "gene_name": "Akr1a1", "activity": [ { "ec_number": "1.1.1.2", "activity": "a secondary alcohol + NADP(+) = a ketone + H(+) + NADPH.", "evidence": [ { "id": "Q9JII6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JII6" } ] }, { "ec_number": "1.1.1.19", "activity": "L-gulonate + NADP(+) = aldehydo-D-glucuronate + H(+) + NADPH.", "evidence": [ { "id": "Q9JII6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JII6" } ] }, { "ec_number": "1.1.1.20", "activity": "L-gulono-1,4-lactone + NADP(+) = D-glucurono-3,6-lactone + H(+) + NADPH.", "evidence": [ { "id": "Q9JII6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JII6" } ] }, { "ec_number": "1.1.1.372", "activity": "glycerol + NADP(+) = H(+) + L-glyceraldehyde + NADPH.", "evidence": [ { "id": "Q9JII6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JII6" } ] }, { "ec_number": "1.1.1.54", "activity": "allyl alcohol + NADP(+) = acrolein + H(+) + NADPH.", "evidence": [ { "id": "Q9JII6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JII6" } ] }, { "ec_number": "1.1.1.2", "activity": "", "evidence": [ { "id": "Q9JII6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JII6" } ] }, { "ec_number": "1.1.1.54", "activity": "", "evidence": [ { "id": "Q9JII6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JII6" } ] }, { "ec_number": "1.1.1.372", "activity": "", "evidence": [ { "id": "Q9JII6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JII6" } ] } ] }, { "uniprot_ac": "Q9NYR8", "gene_name": "RDH8", "activity": [ { "ec_number": "1.1.1.300", "activity": "all-trans-retinol + NADP(+) = all-trans-retinal + H(+) + NADPH.", "evidence": [ { "id": "Q9NYR8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NYR8" } ] }, { "ec_number": "1.1.1.300", "activity": "", "evidence": [ { "id": "Q9NYR8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NYR8" } ] } ] }, { "uniprot_ac": "Q9QYF1", "gene_name": "Rdh11", "activity": [ { "ec_number": "1.1.1.300", "activity": "all-trans-retinol + NADP(+) = all-trans-retinal + H(+) + NADPH.", "evidence": [ { "id": "Q9QYF1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QYF1" } ] }, { "ec_number": "1.1.1.300", "activity": "", "evidence": [ { "id": "Q9QYF1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9QYF1" } ] } ] }, { "uniprot_ac": "Q9VKB8", "gene_name": "firl", "activity": [ { "ec_number": "1.1.1.300", "activity": "all-trans-retinol + NADP(+) = all-trans-retinal + H(+) + NADPH.", "evidence": [ { "id": "Q9VKB8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VKB8" } ] }, { "ec_number": "1.1.1.300", "activity": "", "evidence": [ { "id": "Q9VKB8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VKB8" } ] } ] }, { "uniprot_ac": "Q9W3K9", "gene_name": "Ldsdh1", "activity": [ { "ec_number": "1.1.1.300", "activity": "all-trans-retinol + NADP(+) = all-trans-retinal + H(+) + NADPH.", "evidence": [ { "id": "Q9W3K9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W3K9" } ] }, { "ec_number": "1.1.1.300", "activity": "", "evidence": [ { "id": "Q9W3K9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9W3K9" } ] } ] }, { "uniprot_ac": "Q9Y394", "gene_name": "DHRS7", "activity": [ { "ec_number": "1.1.1.-", "activity": "", "evidence": [ { "id": "Q9Y394", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y394" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [ 23, 137, 288, 291 ], "sequon_annotation_sites": [ { "start_pos": 161, "end_pos": 163 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 57 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }