{ "uniprot_canonical_ac": "O44007-1", "uniprot_ac": "O44007", "uniprot_id": "O44007_DICDI", "mass": { "chemical_mass": 125000.0, "monoisotopic_mass": 125000.0 }, "refseq": { "ac": "XP_629703", "name": "U box domain-containing protein", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_629703" }, "gene_names": [ { "name": "nosA", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O44007", "id": "O44007" }, { "name": "DDB_G0292264", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O44007", "id": "O44007" }, { "name": "nosA", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_629703", "id": "XP_629703" } ], "protein_names": [ { "name": "NOSA", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O44007" }, { "name": "U box domain-containing protein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_629703", "id": "XP_629703" }, { "name": "U box domain-containing protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O44007" }, { "name": "ubiquitin-protein ligase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_629703", "id": "XP_629703" } ], "function": [], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Dictyostelium discoideum", "taxid": 44689, "evidence": [ { "database": "UniProtKB", "id": "O44007", "url": "https://www.uniprot.org/uniprot/O44007" } ], "common_name": "Cellular slime molds" } ], "gene": [ { "name": "nosA", "url": "https://www.uniprot.org/uniprot/O44007", "locus": {} } ], "crossref": [ { "id": "cd16657", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd16657", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "DDB_G0292264", "url": "http://dictybase.org/gene/DDB_G0292264", "database": "dictyBase", "categories": [ "Organism-specific" ] }, { "id": "8628617", "url": "https://www.ncbi.nlm.nih.gov/gene/8628617", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR003613", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003613", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013083", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013083", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR019474", "url": "https://www.ebi.ac.uk/interpro/entry/IPR019474", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR045132", "url": "https://www.ebi.ac.uk/interpro/entry/IPR045132", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "ddi:DDB_G0292264", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0292264", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "INKNAGR", "url": "https://omabrowser.org/oma/group/INKNAGR/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "PTHR13931", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13931", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR13931:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13931:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF04564", "url": "http://pfam.xfam.org/family/PF04564", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF10408", "url": "http://pfam.xfam.org/family/PF10408", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "R-DDI-983168", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-983168", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "XP_629703", "url": "https://www.ncbi.nlm.nih.gov/protein/XP_629703", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "O44007", "url": "https://www.uniprot.org/uniprot/O44007", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O44007-1", "url": "https://www.uniprot.org/uniprot/O44007-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKKMFLKFRGGGDDDGDDDNNNNDENNNNNDSNKDKMETDEQALAEERRRKRLEKFQINDEELIAAAAAQQQLQQQQQQSQQSQQQQKGNTSPVRTPNTTTTTTTTTTSPLKPVTPTPITTNKPVTPTPITTNKPVAPAPTTKDSIRQCDIPMTESNYYVLEKIFLIYLQPNNNLPEKSIYLPSVNEQIKEEIKDGQLKLDKPVLDRILVERLSTKVQGVPAVEYLISCFNRIQQTIKKKMAIDQQILKDSTELVLLYFGLVLTIPDMFQNTSSSYGIGPVQLMPYLCGETTEELTDEFIFKFLSEYQEDLTPIFEPIFLDLIKILSTTTLTGNVFPYYKVFSRLVQFKAVSDLVVTLQCWNSPNFNGKEMERNTILGSLFSPSSASDDGSTIKQYFSNASTMNKNTIGDAFISIRQIQMNIHNGLVDLLKGFLKVQQENKEAFLSWLASAVEKNLERNKLQVDRTKACSDGFALNLCAVLVLLCEAFVDIDCSKVSMVDTNFLLSGKRHDITKDTRLCATSEEADQWVKDGTIEKPLAHTNFITETFFSTLRALHIGINSTYEKLKLIGRNLQDIENNKRVLLDSKIKWQNTPQGRLFEGQLDLLTKKEDMLKGITYTIDAQLFEPTFLQKTASFLLFATNWILKVINPKNTPLPLPLPAPPQFAALPEFCIEDIVDFFTFVITNFSQVLQYIKLEQLMKFFITILATPEYVKNPYLKAKIIEIISQFVPSKYSKGNPILLECNQDVKDHMVLALMRFYVDIEFTGGHNQFYEKFSYRHYSSLILKYLWSIPDFRKKFTETPKDPIFIKFINMLINDSIYVLDEALAKLAKIKENQTLFDDPNWDKDLTPEQRKEKIEQNDLNERICKSNLSLANSNIDMMLFLSSDKTIISGFMRPELIDRISAMMNYFLALIVGPKCTNLKVREPEKYHFNPKVLLNQLTEIYVNFGRDPRFLQSVVRDGRSFKNSLFQTCEKILQRERLKNDHELDEFSKLVIKLEQVAKEEEQAEEDLGDIPDEFCDPILSTLMTDPVILPSSKTVIDRQTILRHLLSDQTDPFNRSHLTPEMLIDDVETKKKIDEWLASKKKQ", "length": 1089, "header": "tr|O44007-1|O44007_DICDI Isoform 1 of U box domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=nosA PE=2 SV=1 CANONICAL=O44007-1" }, "isoforms": [ { "isoform_ac": "O44007-1", "url": "", "sequence": { "sequence": "MKKMFLKFRGGGDDDGDDDNNNNDENNNNNDSNKDKMETDEQALAEERRRKRLEKFQINDEELIAAAAAQQQLQQQQQQSQQSQQQQKGNTSPVRTPNTTTTTTTTTTSPLKPVTPTPITTNKPVTPTPITTNKPVAPAPTTKDSIRQCDIPMTESNYYVLEKIFLIYLQPNNNLPEKSIYLPSVNEQIKEEIKDGQLKLDKPVLDRILVERLSTKVQGVPAVEYLISCFNRIQQTIKKKMAIDQQILKDSTELVLLYFGLVLTIPDMFQNTSSSYGIGPVQLMPYLCGETTEELTDEFIFKFLSEYQEDLTPIFEPIFLDLIKILSTTTLTGNVFPYYKVFSRLVQFKAVSDLVVTLQCWNSPNFNGKEMERNTILGSLFSPSSASDDGSTIKQYFSNASTMNKNTIGDAFISIRQIQMNIHNGLVDLLKGFLKVQQENKEAFLSWLASAVEKNLERNKLQVDRTKACSDGFALNLCAVLVLLCEAFVDIDCSKVSMVDTNFLLSGKRHDITKDTRLCATSEEADQWVKDGTIEKPLAHTNFITETFFSTLRALHIGINSTYEKLKLIGRNLQDIENNKRVLLDSKIKWQNTPQGRLFEGQLDLLTKKEDMLKGITYTIDAQLFEPTFLQKTASFLLFATNWILKVINPKNTPLPLPLPAPPQFAALPEFCIEDIVDFFTFVITNFSQVLQYIKLEQLMKFFITILATPEYVKNPYLKAKIIEIISQFVPSKYSKGNPILLECNQDVKDHMVLALMRFYVDIEFTGGHNQFYEKFSYRHYSSLILKYLWSIPDFRKKFTETPKDPIFIKFINMLINDSIYVLDEALAKLAKIKENQTLFDDPNWDKDLTPEQRKEKIEQNDLNERICKSNLSLANSNIDMMLFLSSDKTIISGFMRPELIDRISAMMNYFLALIVGPKCTNLKVREPEKYHFNPKVLLNQLTEIYVNFGRDPRFLQSVVRDGRSFKNSLFQTCEKILQRERLKNDHELDEFSKLVIKLEQVAKEEEQAEEDLGDIPDEFCDPILSTLMTDPVILPSSKTVIDRQTILRHLLSDQTDPFNRSHLTPEMLIDDVETKKKIDEWLASKKKQ", "length": 1089, "header": "tr|O44007-1|O44007_DICDI Isoform 1 of U box domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=nosA PE=2 SV=1 CANONICAL=O44007-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "The genome of the social amoeba Dictyostelium discoideum.", "journal": "Nature", "date": "2005", "authors": "Eichinger L, Pachebat J A, Gl\u00f6ckner G, Rajandream M-A, Sucgang R, Berriman M, Song J, Olsen R, Szafranski K, Xu Q, Tunggal B, Kummerfeld S, Madera M, Konfortov B A, Rivero F, Bankier A T, Lehmann R, Hamlin N, Davies R, Gaudet P, Fey P, Pilcher K, Chen G, Saunders D, Sodergren E, Davis P, Kerhornou A, Nie X, Hall N, Anjard C, Hemphill L, Bason N, Farbrother P, Desany B, Just E, Morio T, Rost R, Churcher C, Cooper J, Haydock S, van Driessche N, Cronin A, Goodhead I, Muzny D, Mourier T, Pain A, Lu M, Harper D, Lindsay R, Hauser H, James K, Quiles M, Madan Babu M, Saito T, Buchrieser C, Wardroper A, Felder M, Thangavelu M, Johnson D, Knights A, Loulseged H, Mungall K, Oliver K, Price C, Quail M A, Urushihara H, Hernandez J, Rabbinowitsch E, Steffen D, Sanders M, Ma J, Kohara Y, Sharp S, Simmonds M, Spiegler S, Tivey A, Sugano S, White B, Walker D, Woodward J, Winckler T, Tanaka Y, Shaulsky G, Schleicher M, Weinstock G, Rosenthal A, Cox E C, Chisholm R L, Gibbs R, Loomis W F, Platzer M, Kay R R, Williams J, Dear P H, Noegel A A, Barrell B, Kuspa A", "evidence": [ { "database": "UniProtKB", "id": "O44007", "url": "https://www.uniprot.org/uniprot/O44007" } ], "reference": [ { "type": "PubMed", "id": "15875012", "url": "https://glygen.org/publication/PubMed/15875012" } ] }, { "title": "A novel component involved in ubiquitination is required for development of Dictyostelium discoideum.", "journal": "J. Biol. Chem.", "date": "1998", "authors": "Pukatzki S, Tordilla N, Franke J, Kessin R H", "evidence": [ { "database": "UniProtKB", "id": "O44007", "url": "https://www.uniprot.org/uniprot/O44007" } ], "reference": [ { "type": "PubMed", "id": "9727034", "url": "https://glygen.org/publication/PubMed/9727034" } ] } ], "pathway": [ { "id": "ddi:DDB_G0292264", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0292264", "resource": "KEGG Pathway" }, { "id": "R-DDI-983168", "name": "Antigen processing: Ubiquitination & Proteasome degradation", "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-983168", "resource": "Reactome", "description": "Antigen processing: Ubiquitination & Proteasome degradation" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "O44007", "url": "https://www.uniprot.org/uniprot/O44007" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "O44007", "url": "https://www.uniprot.org/uniprot/O44007" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "O44007", "url": "https://www.uniprot.org/uniprot/O44007" } ], "pmid": "" }, { "name": "ubiquitin ligase complex", "id": "GO:0000151", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000151", "evidence": [ { "database": "UniProtKB", "id": "O44007", "url": "https://www.uniprot.org/uniprot/O44007" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "protein ubiquitination", "id": "GO:0016567", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016567", "evidence": [ { "database": "UniProtKB", "id": "O44007", "url": "https://www.uniprot.org/uniprot/O44007" } ], "pmid": "" }, { "name": "protein polyubiquitination", "id": "GO:0000209", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000209", "evidence": [ { "database": "UniProtKB", "id": "O44007", "url": "https://www.uniprot.org/uniprot/O44007" } ], "pmid": "" }, { "name": "ubiquitin-dependent ERAD pathway", "id": "GO:0030433", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030433", "evidence": [ { "database": "UniProtKB", "id": "O44007", "url": "https://www.uniprot.org/uniprot/O44007" } ], "pmid": "" }, { "name": "sorocarp development", "id": "GO:0030587", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030587", "evidence": [ { "database": "UniProtKB", "id": "O44007", "url": "https://www.uniprot.org/uniprot/O44007" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "ubiquitin-ubiquitin ligase activity", "id": "GO:0034450", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034450", "evidence": [ { "database": "UniProtKB", "id": "O44007", "url": "https://www.uniprot.org/uniprot/O44007" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 1060, "end_pos": 1062, "annotation": "n_glycosylation_sequon" }, { "start_pos": 271, "end_pos": 273, "annotation": "n_glycosylation_sequon" }, { "start_pos": 30, "end_pos": 32, "annotation": "n_glycosylation_sequon" }, { "start_pos": 399, "end_pos": 401, "annotation": "n_glycosylation_sequon" }, { "start_pos": 560, "end_pos": 562, "annotation": "n_glycosylation_sequon" }, { "start_pos": 686, "end_pos": 688, "annotation": "n_glycosylation_sequon" }, { "start_pos": 817, "end_pos": 819, "annotation": "n_glycosylation_sequon" }, { "start_pos": 836, "end_pos": 838, "annotation": "n_glycosylation_sequon" }, { "start_pos": 871, "end_pos": 873, "annotation": "n_glycosylation_sequon" }, { "start_pos": 90, "end_pos": 92, "annotation": "n_glycosylation_sequon" }, { "start_pos": 98, "end_pos": 100, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 1060, "end_pos": 1062 }, { "start_pos": 271, "end_pos": 273 }, { "start_pos": 30, "end_pos": 32 }, { "start_pos": 399, "end_pos": 401 }, { "start_pos": 560, "end_pos": 562 }, { "start_pos": 686, "end_pos": 688 }, { "start_pos": 817, "end_pos": 819 }, { "start_pos": 836, "end_pos": 838 }, { "start_pos": 871, "end_pos": 873 }, { "start_pos": 90, "end_pos": 92 }, { "start_pos": 98, "end_pos": 100 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }