{ "uniprot_canonical_ac": "O43889-2", "uniprot_ac": "O43889", "uniprot_id": "CREB3_HUMAN", "mass": { "chemical_mass": 41379.0, "monoisotopic_mass": 41379.0 }, "refseq": { "ac": "NP_006359", "name": "cyclic AMP-responsive element-binding protein 3", "summary": "This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds to the cAMP-response element and regulates cell proliferation. The protein interacts with host cell factor C1, which also associates with the herpes simplex virus (HSV) protein VP16 that induces transcription of HSV immediate-early genes. This protein and VP16 both bind to the same site on host cell factor C1. It is thought that the interaction between this protein and host cell factor C1 plays a role in the establishment of latency during HSV infection. This protein also plays a role in leukocyte migration, tumor suppression, and endoplasmic reticulum stress-associated protein degradation. Additional transcript variants have been identified, but their biological validity has not been determined.[provided by RefSeq, Nov 2009].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006359" }, "gene_names": [ { "name": "CREB3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O43889", "id": "O43889" }, { "name": "CREB3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006359", "id": "NP_006359" }, { "name": "LUMAN; LZIP; sLZIP", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006359", "id": "NP_006359" }, { "name": "LZIP", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O43889", "id": "O43889" } ], "protein_names": [ { "name": "Cyclic AMP-responsive element-binding protein 3", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O43889" }, { "name": "CREB-3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O43889" }, { "name": "Leucine zipper protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O43889" }, { "name": "Luman", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O43889" }, { "name": "Transcription factor LZIP-alpha", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O43889" }, { "name": "cAMP-responsive element-binding protein 3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O43889" }, { "name": "cyclic AMP response element (CRE)-binding protein/activating transcription factor 1; basic leucine zipper protein; small leucine zipper protein; transcription factor LZIP-alpha; leucin zipper proitein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006359", "id": "NP_006359" }, { "name": "cyclic AMP-responsive element-binding protein 3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006359", "id": "NP_006359" } ], "function": [ { "annotation": "(Microbial infection) Activates transcription of genes required for reactivation of the latent HSV-1 virus. It's transcriptional activity is inhibited by CREBZF in a HCFC1-dependent manner, by the viral transactivator protein VP16. Binds DNA to the cAMP response element (CRE) (consensus: 5'-GTGACGT[AG][AG]-3') and C/EBP sequences present in many viral promoters.", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889#function" }, { "database": "PubMed", "id": "10623756", "url": "https://glygen.org/publication/PubMed/10623756" } ] }, { "annotation": "(Microbial infection) It's transcriptional activity is inhibited by CREBZF in a HCFC1-dependent manner, by the viral transactivator HCV core protein.", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889#function" }, { "database": "PubMed", "id": "10675342", "url": "https://glygen.org/publication/PubMed/10675342" } ] }, { "annotation": "(Microbial infection) May play a role as a cellular tumor suppressor that is targeted by the hepatitis C virus (HCV) core protein.", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889#function" }, { "database": "PubMed", "id": "10675342", "url": "https://glygen.org/publication/PubMed/10675342" } ] }, { "annotation": "(Microbial infection) Plays a role in herpes simplex virus-1 (HSV-1) latent infection and reactivation from latency. Represses the VP16-mediated transactivation of immediate early genes of the HSV-1 virus by sequestering host cell factor-1 HCFC1 in the ER membrane of sensory neurons, thereby preventing the initiation of the replicative cascade leading to latent infection.", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889#function" }, { "database": "PubMed", "id": "15705566", "url": "https://glygen.org/publication/PubMed/15705566" }, { "database": "PubMed", "id": "10623756", "url": "https://glygen.org/publication/PubMed/10623756" } ] }, { "annotation": "(Microbial infection) Plays a role in human immunodeficiency virus type 1 (HIV-1) virus protein expression.", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889#function" }, { "database": "PubMed", "id": "17054986", "url": "https://glygen.org/publication/PubMed/17054986" } ] }, { "annotation": "CREB3 Plays an Important Role in HPSE-Facilitated HSV-1 Release in Human Corneal Epithelial Cells. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_006359", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006359" }, { "database": "PubMed", "id": "35746643", "url": "https://glygen.org/publication/PubMed/35746643" } ] }, { "annotation": "Comparative Analysis of CREB3 and CREB3L2 Protein Expression in HEK293 Cells. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_006359", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006359" }, { "database": "PubMed", "id": "33803345", "url": "https://glygen.org/publication/PubMed/33803345" } ] }, { "annotation": "Endoplasmic reticulum (ER)-bound sequence-specific transcription factor that directly binds DNA and activates transcription (PubMed:9271389, PubMed:19779205, PubMed:10984507, PubMed:15845366, PubMed:16940180). Plays a role in the unfolded protein response (UPR), promoting cell survival versus ER stress-induced apoptotic cell death (PubMed:15845366, PubMed:16940180). Also involved in cell proliferation, migration and differentiation, tumor suppression and inflammatory gene expression. Acts as a positive regulator of LKN-1/CCL15-induced chemotaxis signaling of leukocyte cell migration (PubMed:19779205, PubMed:15001559, PubMed:17296613). Associates with chromatin to the HERPUD1 promoter (PubMed:16940180). Also induces transcriptional activation of chemokine receptors (PubMed:18587271, PubMed:17296613).", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889#function" }, { "database": "PubMed", "id": "15001559", "url": "https://glygen.org/publication/PubMed/15001559" }, { "database": "PubMed", "id": "19779205", "url": "https://glygen.org/publication/PubMed/19779205" }, { "database": "PubMed", "id": "15845366", "url": "https://glygen.org/publication/PubMed/15845366" }, { "database": "PubMed", "id": "10984507", "url": "https://glygen.org/publication/PubMed/10984507" }, { "database": "PubMed", "id": "9271389", "url": "https://glygen.org/publication/PubMed/9271389" }, { "database": "PubMed", "id": "16940180", "url": "https://glygen.org/publication/PubMed/16940180" }, { "database": "PubMed", "id": "17296613", "url": "https://glygen.org/publication/PubMed/17296613" }, { "database": "PubMed", "id": "18587271", "url": "https://glygen.org/publication/PubMed/18587271" } ] }, { "annotation": "Functions as a negative transcriptional regulator in ligand-induced transcriptional activation of the glucocorticoid receptor NR3C1 by recruiting and activating histone deacetylases (HDAC1, HDAC2 and HDAC6). Also decreases the acetylation level of histone H4. Does not promote the chemotactic activity of leukocyte cells.", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889#function" }, { "database": "PubMed", "id": "19779205", "url": "https://glygen.org/publication/PubMed/19779205" } ] }, { "annotation": "Knockdown of CREB3 activates endoplasmic reticulum stress and induces apoptosis in glioblastoma.", "evidence": [ { "database": "RefSeq", "id": "NP_006359", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006359" }, { "database": "PubMed", "id": "31612863", "url": "https://glygen.org/publication/PubMed/31612863" } ] }, { "annotation": "Role of small leucine zipper protein in hepatic gluconeogenesis and metabolic disorder.", "evidence": [ { "database": "RefSeq", "id": "NP_006359", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006359" }, { "database": "PubMed", "id": "33355643", "url": "https://glygen.org/publication/PubMed/33355643" } ] }, { "annotation": "The stability of CREB3/Luman is regulated by protein kinase CK2 phosphorylation.", "evidence": [ { "database": "RefSeq", "id": "NP_006359", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006359" }, { "database": "PubMed", "id": "31941600", "url": "https://glygen.org/publication/PubMed/31941600" } ] }, { "annotation": "This gene encodes a transcription factor that is a member of the leucine zipper family of DNA binding proteins. This protein binds to the cAMP-response element and regulates cell proliferation. The protein interacts with host cell factor C1, which also associates with the herpes simplex virus (HSV) protein VP16 that induces transcription of HSV immediate-early genes. This protein and VP16 both bind to the same site on host cell factor C1. It is thought that the interaction between this protein and host cell factor C1 plays a role in the establishment of latency during HSV infection. This protein also plays a role in leukocyte migration, tumor suppression, and endoplasmic reticulum stress-associated protein degradation. Additional transcript variants have been identified, but their biological validity has not been determined.[provided by RefSeq, Nov 2009].", "evidence": [ { "database": "RefSeq", "id": "NP_006359", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006359" } ] }, { "annotation": "This is the transcriptionally active form that translocates to the nucleus and activates unfolded protein response (UPR) target genes during endoplasmic reticulum (ER) stress response. Binds the cAMP response element (CRE) (consensus: 5'-GTGACGT[AG][AG]-3') and C/EBP sequences present in many promoters to activate transcription of the genes. Binds to the unfolded protein response element (UPRE) consensus sequences sites. Binds DNA to the 5'-CCAC[GA]-3'half of ERSE II (5'-ATTGG-N-CCACG-3').", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889#function" }, { "database": "PubMed", "id": "16940180", "url": "https://glygen.org/publication/PubMed/16940180" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs1587999450", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1587999450" }, { "id": "rs1587999450", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1587999450" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 308, "end_pos": 308, "sequence_org": "T", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->NPS).", "chr_id": "9", "chr_pos": "35736532", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T308", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1391876351", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1391876351" }, { "id": "rs1391876351", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1391876351" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 309, "end_pos": 309, "sequence_org": "S", "sequence_mut": "C", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->NTC).", "chr_id": "9", "chr_pos": "35736536", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S309", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs374358651", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs374358651" }, { "id": "rs374358651", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs374358651" }, { "id": "rs374358651", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs374358651#frequency_tab" }, { "id": "rs374358651", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs374358651" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 80, "end_pos": 80, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (TYS->NYS).", "chr_id": "9", "chr_pos": "35733105", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T80", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1217343833", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1217343833" }, { "id": "rs1217343833", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1217343833#frequency_tab" }, { "id": "rs1217343833", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1217343833" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 94, "end_pos": 94, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SES->NES).", "chr_id": "9", "chr_pos": "35733218", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S94", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [ { "start_pos": 12, "end_pos": 13, "sequence_org": "LL", "sequence_mut": "AA", "comment": "Does not inhibit interaction with HCFC1. Reduces transcriptional activation. Inhibits strongly transcriptional activation; when associated with 56-A-A-57 and 78-A--A-81 (isoform 1).", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" }, { "database": "PubMed", "id": "10984507", "url": "https://glygen.org/publication/PubMed/10984507" } ] }, { "start_pos": 160, "end_pos": 160, "sequence_org": "N", "sequence_mut": "G", "comment": "Does not bind to DNA but retains its ability to interact with HCFC1. Reduces transcriptional activation of unfolded protein response elements (UPRE)-containing promoter. Colocalizes with HCFC1 in the ER membrane.", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" }, { "database": "PubMed", "id": "15705566", "url": "https://glygen.org/publication/PubMed/15705566" } ] }, { "start_pos": 16, "end_pos": 17, "sequence_org": "LL", "sequence_mut": "AA", "comment": "Does not affect the transcriptional activation of the glucocorticoid receptor NR3C1; when associated with 57-A-A-58 (isoform 2).", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" }, { "database": "PubMed", "id": "19779205", "url": "https://glygen.org/publication/PubMed/19779205" }, { "database": "PubMed", "id": "10984507", "url": "https://glygen.org/publication/PubMed/10984507" } ] }, { "start_pos": 252, "end_pos": 252, "sequence_org": "R", "sequence_mut": "A", "comment": "Does not inhibit proteolytic cleavage and transcriptional activation.", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" }, { "database": "PubMed", "id": "12138176", "url": "https://glygen.org/publication/PubMed/12138176" } ] }, { "start_pos": 264, "end_pos": 264, "sequence_org": "R", "sequence_mut": "G", "comment": "Inhibits proteolytic cleavage and transcriptional activation.", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" }, { "database": "PubMed", "id": "12138176", "url": "https://glygen.org/publication/PubMed/12138176" } ] }, { "start_pos": 267, "end_pos": 267, "sequence_org": "R", "sequence_mut": "G", "comment": "Inhibits proteolytic cleavage and transcriptional activation.", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" }, { "database": "PubMed", "id": "12138176", "url": "https://glygen.org/publication/PubMed/12138176" } ] }, { "start_pos": 57, "end_pos": 58, "sequence_org": "LL", "sequence_mut": "AA", "comment": "Does not affect the transcriptional activation of the glucocorticoid receptor NR3C1; when associated with 16-A-A-17 (isoform 2).", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" }, { "database": "PubMed", "id": "19779205", "url": "https://glygen.org/publication/PubMed/19779205" } ] }, { "start_pos": 57, "end_pos": 58, "sequence_org": "LL", "sequence_mut": "AA", "comment": "Does not inhibit interaction with HCFC1. Reduces transcriptional activation. Inhibits strongly transcriptional activation; when associated with 12-A-A-13 and 78-A--A-81 (isoform 1).", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" }, { "database": "PubMed", "id": "19779205", "url": "https://glygen.org/publication/PubMed/19779205" } ] }, { "start_pos": 78, "end_pos": 81, "sequence_org": "DHTY", "sequence_mut": "AAAA", "comment": "Inhibits interaction with HCFC1. Reduces transcriptional activation. Inhibits strongly transcriptional activation; when associated with 12-A-A-13 and 56-A-A-57. Colocalizes with HCFC1 in the nucleus (isoform 1).", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" }, { "database": "PubMed", "id": "10984507", "url": "https://glygen.org/publication/PubMed/10984507" }, { "database": "PubMed", "id": "15705566", "url": "https://glygen.org/publication/PubMed/15705566" } ] }, { "start_pos": 81, "end_pos": 81, "sequence_org": "Y", "sequence_mut": "A", "comment": "Does not retain HCFC1 in the cytoplasm, does not interact with HCFC1, does not activate promoter and fail to protect cells from a productive infection by HSV-1.", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" }, { "database": "PubMed", "id": "10623756", "url": "https://glygen.org/publication/PubMed/10623756" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "87.87", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000107175", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000107175" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "74.33", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000107175", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000107175" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "87.01", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000107175", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000107175" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "85.25", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000107175", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000107175" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "94.81", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000107175", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000107175" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "90.56", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000107175", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000107175" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "87.4", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000107175", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000107175" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "89.18", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000107175", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000107175" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "91.04", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000107175", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000107175" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "81.8", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000107175", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000107175" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "84.84", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000107175", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000107175" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "95.77", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000107175", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000107175" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "90.67", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000107175", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000107175" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O43889", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43889" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O43889", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43889" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O43889", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43889" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O43889", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43889" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O43889", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43889" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O43889", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43889" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O43889", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43889" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O43889", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43889" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O43889", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43889" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O43889", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43889" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O43889", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43889" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O43889", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43889" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" } ], "common_name": "Human" } ], "gene": [ { "name": "CREB3", "url": "https://www.uniprot.org/uniprot/O43889", "locus": { "chromosome": "9", "start_pos": 35736999, "end_pos": 35732598, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000107175", "url": "https://www.ensembl.org/id/ENSG00000107175" } ] } } ], "crossref": [ { "id": "ENSG00000107175", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000107175", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd14689", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd14689", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CREB3", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=CREB3", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "10488", "url": "https://www.ncbi.nlm.nih.gov/gene/10488", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "2347", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=2347", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O43889", "url": "https://www.ebi.ac.uk/intact/interactors/id:O43889*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR004827", "url": "https://www.ebi.ac.uk/interpro/entry/IPR004827", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR046347", "url": "https://www.ebi.ac.uk/interpro/entry/IPR046347", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:10488", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:10488", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "606443", "url": "http://www.omim.org/entry/606443", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O43889", "url": "https://www.nextprot.org/entry/NX_O43889", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "O43889", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O43889", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "CLLYHMP", "url": "https://omabrowser.org/oma/group/CLLYHMP/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5362396at2759", "url": "http://www.orthodb.org/?query=5362396at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR45996", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45996", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR45996:SF4", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45996:SF4", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00170", "url": "http://pfam.xfam.org/family/PF00170", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O43889", "url": "https://pharos.nih.gov/targets/O43889", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O43889", "url": "http://purl.obolibrary.org/obo/PR_O43889", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-8874211", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8874211", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_006359", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006359", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O43889-2", "url": "https://www.uniprot.org/uniprot/O43889-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O43889-3", "url": "https://www.uniprot.org/uniprot/O43889-3", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MELELDAGDQDLLAFLLEESGDLGTAPDEAVRAPLDWALPLSEVPSDWEVDDLLCSLLSPPASLNILSSSNPCLVHHDHTYSLPRETVSMDLESESCRKEGTQMTPQHMEELAEQEIARLVLTDEEKSLLEKEGLILPETLPLTKTEEQILKRVRRKIRNKRSAQESRRKKKVYVGGLESRVLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTSSSSTCILVLLVSFCLLLVPAMYSSDTRGSLPAEHGVLSRQLRALPSEDPYQLELPALQSEVPKDSTHQWLDGSDCVLQAPGNTSCLLHYMPQAPSAEPPLEWPFPDLFSEPLCRGPILPLQANLTRKGGWLPTGSPSVILQDRYSG", "length": 371, "header": "sp|O43889-2|CREB3_HUMAN Isoform 2 of Cyclic AMP-responsive element-binding protein 3 OS=Homo sapiens OX=9606 GN=CREB3 PE=1 SV=2 CANONICAL=O43889-2" }, "isoforms": [ { "isoform_ac": "O43889-2", "url": "", "sequence": { "sequence": "MELELDAGDQDLLAFLLEESGDLGTAPDEAVRAPLDWALPLSEVPSDWEVDDLLCSLLSPPASLNILSSSNPCLVHHDHTYSLPRETVSMDLESESCRKEGTQMTPQHMEELAEQEIARLVLTDEEKSLLEKEGLILPETLPLTKTEEQILKRVRRKIRNKRSAQESRRKKKVYVGGLESRVLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTSSSSTCILVLLVSFCLLLVPAMYSSDTRGSLPAEHGVLSRQLRALPSEDPYQLELPALQSEVPKDSTHQWLDGSDCVLQAPGNTSCLLHYMPQAPSAEPPLEWPFPDLFSEPLCRGPILPLQANLTRKGGWLPTGSPSVILQDRYSG", "length": 371, "header": "sp|O43889-2|CREB3_HUMAN Isoform 2 of Cyclic AMP-responsive element-binding protein 3 OS=Homo sapiens OX=9606 GN=CREB3 PE=1 SV=2 CANONICAL=O43889-2" }, "locus": { "chromosome": "9", "start_pos": 35736723, "end_pos": 35732773, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000353704.3", "url": "https://www.ensembl.org/id/ENST00000353704.3" }, { "database": "Ensembl Peptide", "id": "ENSP00000342136.2", "url": "https://www.ensembl.org/id/ENSP00000342136.2" } ] } }, { "isoform_ac": "O43889-3", "url": "", "sequence": { "sequence": "MELELDAGDQDLLAFLLEESGDLGTAPDEAVRAPLDWALPLSEVPSDWEVDDLLCSLLSPPASLNILSSSNPCLVHHDHTYSLPRETVSMDLESESCRKEGTQMTPQHMEELAEQEIARLVLTDEEKSLLEKEGLILPETLPLTKTEEQILKRVRRKIRNKRSAQESRRKKKVYVGGLESRVLKYTAQNMELQNKVQLLEEQNLSLLDQLRKLQAMVIEISNKTSSSSMYSSDTRGSLPAEHGVLSRQLRALPSEDPYQLELPALQSEVPKDSTHQWLDGSDCVLQAPGNTSCLLHYMPQAPSAEPPLEWPFPDLFSEPLCRGPILPLQANLTRKGGWLPTGSPSVILQDRYSG", "length": 354, "header": "sp|O43889-3|CREB3_HUMAN Isoform 3 of Cyclic AMP-responsive element-binding protein 3 OS=Homo sapiens OX=9606 GN=CREB3 PE=1 SV=2 CANONICAL=O43889-2" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 307, "start_aa": "Asn", "end_pos": 307, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn307", "evidence": [ { "id": "O43889", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43889#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 348, "start_aa": "Asn", "end_pos": 348, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn348", "evidence": [ { "id": "O43889", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43889#ptm_processing" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "O43889", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O43889" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted", "glycoprotein_reported", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Potential role for luman, the cellular homologue of herpes simplex virus VP16 (alpha gene trans-inducing factor), in herpesvirus latency.", "journal": "Journal of virology", "date": "2000", "authors": "Lu R, Misra V", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" } ], "reference": [ { "type": "PubMed", "id": "10623756", "url": "https://glygen.org/publication/PubMed/10623756" } ] }, { "title": "Mutations in host cell factor 1 separate its role in cell proliferation from recruitment of VP16 and LZIP.", "journal": "Mol. Cell. Biol.", "date": "2000", "authors": "Mahajan SS, Wilson AC", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" } ], "reference": [ { "type": "PubMed", "id": "10629049", "url": "https://glygen.org/publication/PubMed/10629049" } ] }, { "title": "Hepatitis C virus core protein-induced loss of LZIP function correlates with cellular transformation.", "journal": "The EMBO journal", "date": "2000-02-15", "authors": "Jin D Y, Wang H L, Zhou Y, Chun A C, Kibler K V, Hou Y D, Kung H, Jeang K T", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" } ], "reference": [ { "type": "PubMed", "id": "10675342", "url": "https://glygen.org/publication/PubMed/10675342" } ] }, { "title": "N-terminal transcriptional activation domain of LZIP comprises two LxxLL motifs and the host cell factor-1 binding motif.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2000", "authors": "Luciano RL, Wilson AC", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" } ], "reference": [ { "type": "PubMed", "id": "10984507", "url": "https://glygen.org/publication/PubMed/10984507" } ] }, { "title": "CREB-H: a novel mammalian transcription factor belonging to the CREB/ATF family and functioning via the box-B element with a liver-specific expression.", "journal": "Nucleic acids research", "date": "2001", "authors": "Omori Y, Imai J, Watanabe M, Komatsu T, Suzuki Y, Kataoka K, Watanabe S, Tanigami A, Sugano S", "evidence": [ { "database": "Reactome", "id": "R-HSA-8874211", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8874211" } ], "reference": [ { "type": "PubMed", "id": "11353085", "url": "https://glygen.org/publication/PubMed/11353085" } ] }, { "title": "AIbZIP, a novel bZIP gene located on chromosome 1q21.3 that is highly expressed in prostate tumors and of which the expression is up-regulated by androgens in LNCaP human prostate cancer cells.", "journal": "Cancer research", "date": "2002", "authors": "Qi H, Fillion C, Labrie Y, Grenier J, Fournier A, Berger L, El-Alfy M, Labrie C", "evidence": [ { "database": "Reactome", "id": "R-HSA-8874211", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8874211" } ], "reference": [ { "type": "PubMed", "id": "11830526", "url": "https://glygen.org/publication/PubMed/11830526" } ] }, { "title": "Luman, the cellular counterpart of herpes simplex virus VP16, is processed by regulated intramembrane proteolysis.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Raggo C, Rapin N, Stirling J, Gobeil P, Smith-Windsor E, O'Hare P, Misra V", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" }, { "database": "Reactome", "id": "R-HSA-8874211", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8874211" } ], "reference": [ { "type": "PubMed", "id": "12138176", "url": "https://glygen.org/publication/PubMed/12138176" } ] }, { "title": "Human LZIP binds to CCR1 and differentially affects the chemotactic activities of CCR1-dependent chemokines.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2004-05", "authors": "Ko Jesang, Jang Sung-Wuk, Kim Yoon Suk, Kim In Sik, Sung Ho Joong, Kim Hong-Hee, Park Joong-Yeol, Lee Young Han, Kim Jiyoung, Na Doe Sun", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" } ], "reference": [ { "type": "PubMed", "id": "15001559", "url": "https://glygen.org/publication/PubMed/15001559" } ] }, { "title": "Zhangfei is a potent and specific inhibitor of the host cell factor-binding transcription factor Luman.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Misra V, Rapin N, Akhova O, Bainbridge M, Korchinski P", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" } ], "reference": [ { "type": "PubMed", "id": "15705566", "url": "https://glygen.org/publication/PubMed/15705566" } ] }, { "title": "Luman is capable of binding and activating transcription from the unfolded protein response element.", "journal": "Biochemical and biophysical research communications", "date": "2005-05-27", "authors": "DenBoer Lisa M, Hardy-Smith Philip W, Hogan Melissa R, Cockram Gregory P, Audas Timothy E, Lu Rui", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" } ], "reference": [ { "type": "PubMed", "id": "15845366", "url": "https://glygen.org/publication/PubMed/15845366" } ] }, { "title": "CREB4, a transmembrane bZip transcription factor and potential new substrate for regulation and cleavage by S1P.", "journal": "Molecular biology of the cell", "date": "2006", "authors": "Stirling J, O'hare P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8874211", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8874211" } ], "reference": [ { "type": "PubMed", "id": "16236796", "url": "https://glygen.org/publication/PubMed/16236796" } ] }, { "title": "Endoplasmic reticulum stress activates cleavage of CREBH to induce a systemic inflammatory response.", "journal": "Cell", "date": "2006", "authors": "Zhang K, Shen X, Wu J, Sakaki K, Saunders T, Rutkowski DT, Back SH, Kaufman RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-8874211", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8874211" } ], "reference": [ { "type": "PubMed", "id": "16469704", "url": "https://glygen.org/publication/PubMed/16469704" } ] }, { "title": "Luman/CREB3 induces transcription of the endoplasmic reticulum (ER) stress response protein Herp through an ER stress response element.", "journal": "Molecular and cellular biology", "date": "2006", "authors": "Liang G, Audas TE, Li Y, Cockram GP, Dean JD, Martyn AC, Kokame K, Lu R", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" }, { "database": "Reactome", "id": "R-HSA-8874211", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8874211" } ], "reference": [ { "type": "PubMed", "id": "16940180", "url": "https://glygen.org/publication/PubMed/16940180" } ] }, { "title": "Luman, a new partner of HIV-1 TMgp41, interferes with Tat-mediated transcription of the HIV-1 LTR.", "journal": "Journal of molecular biology", "date": "2006", "authors": "Blot G, Lopez-Verges S, Treand C, Kubat NJ, Delcroix-Genete D, Emiliani S, Benarous R, Berlioz-Torrent C", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" } ], "reference": [ { "type": "PubMed", "id": "17054986", "url": "https://glygen.org/publication/PubMed/17054986" } ] }, { "title": "Characterization of the native CREB3L2 transcription factor and the FUS/CREB3L2 chimera.", "journal": "Genes, chromosomes & cancer", "date": "2007", "authors": "Panagopoulos I, Moller E, Dahlen A, Isaksson M, Mandahl N, Vlamis-Gardikas A, Mertens F", "evidence": [ { "database": "Reactome", "id": "R-HSA-8874211", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8874211" } ], "reference": [ { "type": "PubMed", "id": "17117415", "url": "https://glygen.org/publication/PubMed/17117415" } ] }, { "title": "Regulation of human LZIP expression by NF-kappaB and its involvement in monocyte cell migration induced by Lkn-1.", "journal": "The Journal of biological chemistry", "date": "2007-04-13", "authors": "Jang Sung-Wuk, Kim Yoon Suk, Kim Yoon Rim, Sung Ho Joong, Ko Jesang", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" } ], "reference": [ { "type": "PubMed", "id": "17296613", "url": "https://glygen.org/publication/PubMed/17296613" } ] }, { "title": "Transcriptional profiling of genes that are regulated by the endoplasmic reticulum-bound transcription factor AIbZIP/CREB3L4 in prostate cells.", "journal": "Physiological genomics", "date": "2007", "authors": "Ben Aicha S, Lessard J, Pelletier M, Fournier A, Calvo E, Labrie C", "evidence": [ { "database": "Reactome", "id": "R-HSA-8874211", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8874211" } ], "reference": [ { "type": "PubMed", "id": "17712038", "url": "https://glygen.org/publication/PubMed/17712038" } ] }, { "title": "Trafficking of the bZIP transmembrane transcription factor CREB-H into alternate pathways of ERAD and stress-regulated intramembrane proteolysis.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2007", "authors": "Bailey D, Barreca C, O'Hare P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8874211", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8874211" } ], "reference": [ { "type": "PubMed", "id": "17875199", "url": "https://glygen.org/publication/PubMed/17875199" } ] }, { "title": "A novel protein, Luman/CREB3 recruitment factor, inhibits Luman activation of the unfolded protein response.", "journal": "Molecular and cellular biology", "date": "2008", "authors": "Audas TE, Li Y, Liang G, Lu R", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" }, { "database": "Reactome", "id": "R-HSA-8874211", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8874211" } ], "reference": [ { "type": "PubMed", "id": "18391022", "url": "https://glygen.org/publication/PubMed/18391022" } ] }, { "title": "Human LZIP induces monocyte CC chemokine receptor 2 expression leading to enhancement of monocyte chemoattractant protein 1/CCL2-induced cell migration.", "journal": "Experimental & molecular medicine", "date": "2008-06-30", "authors": "Sung Ho Joong, Kim Yoon Suk, Kang Hyereen, Ko Jesang", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" } ], "reference": [ { "type": "PubMed", "id": "18587271", "url": "https://glygen.org/publication/PubMed/18587271" } ] }, { "title": "A novel isoform of human LZIP negatively regulates the transactivation of the glucocorticoid receptor.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2009", "authors": "Kang H, Kim YS, Ko J", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" } ], "reference": [ { "type": "PubMed", "id": "19779205", "url": "https://glygen.org/publication/PubMed/19779205" } ] }, { "title": "Different mechanisms of recognition and ER retention by transmembrane transcription factors CREB-H and ATF6.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2010", "authors": "Llarena M, Bailey D, Curtis H, O'Hare P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8874211", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8874211" } ], "reference": [ { "type": "PubMed", "id": "19883396", "url": "https://glygen.org/publication/PubMed/19883396" } ] }, { "title": "DC-STAMP interacts with ER-resident transcription factor LUMAN which becomes activated during DC maturation.", "journal": "Molecular immunology", "date": "2010", "authors": "Eleveld-Trancikova D, Sanecka A, van Hout-Kuijer MA, Looman MW, Hendriks IA, Jansen BJ, Adema GJ", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" }, { "database": "Reactome", "id": "R-HSA-8874211", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8874211" } ], "reference": [ { "type": "PubMed", "id": "20546900", "url": "https://glygen.org/publication/PubMed/20546900" } ] }, { "title": "The membrane-bound transcription factor CREB3L1 is activated in response to virus infection to inhibit proliferation of virus-infected cells.", "journal": "Cell host & microbe", "date": "2011", "authors": "Denard B, Seemann J, Chen Q, Gay A, Huang H, Chen Y, Ye J", "evidence": [ { "database": "Reactome", "id": "R-HSA-8874211", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8874211" } ], "reference": [ { "type": "PubMed", "id": "21767813", "url": "https://glygen.org/publication/PubMed/21767813" } ] }, { "title": "Activation of OASIS family, ER stress transducers, is dependent on its stabilization.", "journal": "Cell death and differentiation", "date": "2012", "authors": "Kondo S, Hino SI, Saito A, Kanemoto S, Kawasaki N, Asada R, Izumi S, Iwamoto H, Oki M, Miyagi H, Kaneko M, Nomura Y, Urano F, Imaizumi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-8874211", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8874211" } ], "reference": [ { "type": "PubMed", "id": "22705851", "url": "https://glygen.org/publication/PubMed/22705851" } ] }, { "title": "Doxorubicin blocks proliferation of cancer cells through proteolytic activation of CREB3L1.", "journal": "eLife", "date": "2012", "authors": "Denard B, Lee C, Ye J", "evidence": [ { "database": "Reactome", "id": "R-HSA-8874211", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8874211" } ], "reference": [ { "type": "PubMed", "id": "23256041", "url": "https://glygen.org/publication/PubMed/23256041" } ] }, { "title": "CREB3L1 is a metastasis suppressor that represses expression of genes regulating metastasis, invasion, and angiogenesis.", "journal": "Molecular and cellular biology", "date": "2013", "authors": "Mellor P, Deibert L, Calvert B, Bonham K, Carlsen SA, Anderson DH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8874211", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8874211" } ], "reference": [ { "type": "PubMed", "id": "24126059", "url": "https://glygen.org/publication/PubMed/24126059" } ] }, { "title": "N-linked glycosylation enrichment for in-depth cell surface proteomics of diffuse large B-cell lymphoma subtypes.", "journal": "Molecular & cellular proteomics : MCP", "date": "2014", "authors": "Deeb SJ, Cox J, Schmidt-Supprian M, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "24190977", "url": "https://glygen.org/publication/PubMed/24190977" } ] }, { "title": "OASIS/CREB3L1 is epigenetically silenced in human bladder cancer facilitating tumor cell spreading and migration in vitro.", "journal": "Epigenetics", "date": "2014", "authors": "Rose M, Schubert C, Dierichs L, Gaisa NT, Heer M, Heidenreich A, Knuchel R, Dahl E", "evidence": [ { "database": "Reactome", "id": "R-HSA-8874211", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8874211" } ], "reference": [ { "type": "PubMed", "id": "25625847", "url": "https://glygen.org/publication/PubMed/25625847" } ] }, { "title": "Promotion of Cancer Cell Proliferation by Cleaved and Secreted Luminal Domains of ER Stress Transducer BBF2H7.", "journal": "PloS one", "date": "2015", "authors": "Iwamoto H, Matsuhisa K, Saito A, Kanemoto S, Asada R, Hino K, Takai T, Cui M, Cui X, Kaneko M, Arihiro K, Sugiyama K, Kurisu K, Matsubara A, Imaizumi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-8874211", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8874211" } ], "reference": [ { "type": "PubMed", "id": "25955804", "url": "https://glygen.org/publication/PubMed/25955804" } ] }, { "title": "Epigenetic silencing of CREB3L1 by DNA methylation is associated with high-grade metastatic breast cancers with poor prognosis and is prevalent in triple negative breast cancers.", "journal": "Breast cancer research : BCR", "date": "2016", "authors": "Ward AK, Mellor P, Smith SE, Kendall S, Just NA, Vizeacoumar FS, Sarker S, Phillips Z, Alvi R, Saxena A, Vizeacoumar FJ, Carlsen SA, Anderson DH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8874211", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8874211" } ], "reference": [ { "type": "PubMed", "id": "26810754", "url": "https://glygen.org/publication/PubMed/26810754" } ] }, { "title": "A triarylphosphine-trimethylpiperidine reagent for the one-step derivatization and enrichment of protein post-translational modifications and identification by mass spectrometry.", "journal": "Chemical communications (Cambridge, England)", "date": "2018", "authors": "Huo B, Zhang W, Zhao X, Dong H, Yu Y, Wang J, Qian X, Qin W", "evidence": [ { "database": "O-GlcNAc Database", "id": "O43889", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O43889" } ], "reference": [ { "type": "PubMed", "id": "30379171", "url": "https://glygen.org/publication/PubMed/30379171" } ] }, { "title": "Knockdown of CREB3 activates endoplasmic reticulum stress and induces apoptosis in glioblastoma.", "journal": "Aging", "date": "2019", "authors": "Hu Y, Chu L, Liu J, Yu L, Song SB, Yang H, Han F", "evidence": [ { "database": "RefSeq", "id": "NP_006359", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006359" } ], "reference": [ { "type": "PubMed", "id": "31612863", "url": "https://glygen.org/publication/PubMed/31612863" } ] }, { "title": "The stability of CREB3/Luman is regulated by protein kinase CK2 phosphorylation.", "journal": "Biochemical and biophysical research communications", "date": "2020", "authors": "Schmitt BM, Ampofo E, Stumpf H, Montenarh M, Gotz C", "evidence": [ { "database": "RefSeq", "id": "NP_006359", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006359" } ], "reference": [ { "type": "PubMed", "id": "31941600", "url": "https://glygen.org/publication/PubMed/31941600" } ] }, { "title": "Role of small leucine zipper protein in hepatic gluconeogenesis and metabolic disorder.", "journal": "Journal of molecular cell biology", "date": "2021", "authors": "Kang M, Han SK, Kim S, Park S, Jo Y, Kang H, Ko J", "evidence": [ { "database": "RefSeq", "id": "NP_006359", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006359" } ], "reference": [ { "type": "PubMed", "id": "33355643", "url": "https://glygen.org/publication/PubMed/33355643" } ] }, { "title": "Comparative Analysis of CREB3 and CREB3L2 Protein Expression in HEK293 Cells.", "journal": "International journal of molecular sciences", "date": "2021", "authors": "Oh-Hashi K, Yamamoto A, Murase R, Hirata Y", "evidence": [ { "database": "RefSeq", "id": "NP_006359", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006359" } ], "reference": [ { "type": "PubMed", "id": "33803345", "url": "https://glygen.org/publication/PubMed/33803345" } ] }, { "title": "CREB3 Plays an Important Role in HPSE-Facilitated HSV-1 Release in Human Corneal Epithelial Cells.", "journal": "Viruses", "date": "2022", "authors": "Yadavalli T, Sharma P, Wu D, Kapoor D, Shukla D", "evidence": [ { "database": "RefSeq", "id": "NP_006359", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006359" } ], "reference": [ { "type": "PubMed", "id": "35746643", "url": "https://glygen.org/publication/PubMed/35746643" } ] }, { "title": "Luman, a new member of the CREB/ATF family, binds to herpes simplex virus VP16-associated host cellular factor.", "journal": "Molecular and cellular biology", "date": "1997", "authors": "Lu R, Yang P, O'Hare P, Misra V", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" }, { "database": "Reactome", "id": "R-HSA-8874211", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8874211" } ], "reference": [ { "type": "PubMed", "id": "9271389", "url": "https://glygen.org/publication/PubMed/9271389" } ] }, { "title": "Viral mimicry: common mode of association with HCF by VP16 and the cellular protein LZIP.", "journal": "Genes Dev.", "date": "1997", "authors": "Freiman R N, Herr W", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" } ], "reference": [ { "type": "PubMed", "id": "9389645", "url": "https://glygen.org/publication/PubMed/9389645" } ] } ], "pathway": [ { "id": "hsa:10488", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:10488", "resource": "KEGG Pathway" }, { "id": "R-HSA-8874211", "name": "CREB3 factors activate genes", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8874211", "resource": "Reactome", "description": "CREB3 factors activate genes" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A0G2K331-1", "protein_name": "Uncharacterized protein", "gene_name": "Creb3", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MDPGGQDLLALDPGDQDLLALDPGDQDLLGFLLEESGDLWAATEQDIETPLDLELSPSENSVQELSDWEVEDLLSSLLSPSSSPDVLNSSSSSILHDHNYSLPQEHVSIDLDPGSFEKEGFRMNPLRVEETAAEQELSTLILTEEEKRLLEKEGLTLPSTLPLTKVEEQVLKRVRRKIRNKRAAQESRKKKKVYVVGLESRVLKYTAQNQELQNKVQHLEEQNLSLLDQLRKLQAMVTEIANKTSSGSTCVLVLLLSFCLLLVPAMYSSDVRGSVPAEYVVLHRKLRALPSEDQHQPKLSALQPELPMGSTNQLESSEHTFLAPSNVSCLNHMAQTEQPPHWPLLDLSSEMPFSGSDLLLQANLTESGGWLSTHSPSSIILQENGRKLILDILGPTQNGHLDHHSHSCQPQPSAPREG", "length": 418 }, "evidence": [ { "id": "O43889", "url": "https://omabrowser.org/oma/group/O43889/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q61817-1", "protein_name": "Cyclic AMP-responsive element-binding protein 3", "gene_name": "Creb3", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MDPGGQDLLALDPGDQDLLGFLLEESGDLWAATEPDVKASLDLELSPSENSVQELSDWEVEDLLSSLLSPSVSRDVLGSSSSSILHDHNYSLPQEHVSIDLGECEMISCRGRRELTGLAGSTFPFADTESFEKEGFHVTPLPGEERAAEQEMSRLILTEEEKKLLEKEGLTLPSTLPLTKVEEQVLKRVRRKIRNKRAAQESRKKKKVYVVGLESRVLKYTAQNRELQNKVQRLEEQNLSLLDQLRKLQAMVIEIANKTSSGSTCVLVLVFSFCLLLVPAMYSSDARGSVPAEYVVLHRKLRALPSEDDHQPKPSALSSELPMDSTHQSLDSSEHMFLVSSNFSCVLYHAPQAEQPLHWPLWDLSSEMLFSDSNLLLQANLSESEGWQPNHSPSLVIFQGRYSG", "length": 404 }, "evidence": [ { "id": "45930059", "url": "http://www.informatics.jax.org/homology/45930059", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 21, "go_terms": [ { "name": "establishment of viral latency", "id": "GO:0019043", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019043", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" } ], "pmid": "" }, { "name": "release from viral latency", "id": "GO:0019046", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019046", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" } ], "pmid": "" }, { "name": "cytoplasmic sequestering of transcription factor", "id": "GO:0042994", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042994", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" } ], "pmid": "" }, { "name": "positive regulation of deacetylase activity", "id": "GO:0090045", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090045", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" } ], "pmid": "" }, { "name": "DNA-templated transcription", "id": "GO:0006351", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006351", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" } ], "pmid": "" }, { "name": "regulation of transcription by RNA polymerase II", "id": "GO:0006357", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006357", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" } ], "pmid": "" }, { "name": "chemotaxis", "id": "GO:0006935", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006935", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" } ], "pmid": "" }, { "name": "positive regulation of cell migration", "id": "GO:0030335", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030335", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" } ], "pmid": "" }, { "name": "regulation of cell population proliferation", "id": "GO:0042127", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042127", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" } ], "pmid": "" }, { "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" } ], "pmid": "" }, { "name": "positive regulation of monocyte chemotaxis", "id": "GO:0090026", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090026", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" } ], "pmid": "" }, { "name": "positive regulation of DNA-templated transcription", "id": "GO:0045893", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045893", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" } ], "pmid": "" }, { "name": "regulation of cell growth", "id": "GO:0001558", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001558", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" } ], "pmid": "" }, { "name": "positive regulation of defense response to virus by host", "id": "GO:0002230", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002230", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" } ], "pmid": "" }, { "name": "regulation of apoptotic process", "id": "GO:0042981", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042981", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" } ], "pmid": "" }, { "name": "endoplasmic reticulum unfolded protein response", "id": "GO:0030968", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030968", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" } ], "pmid": "" }, { "name": "negative regulation of cell cycle", "id": "GO:0045786", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045786", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" } ], "pmid": "" }, { "name": "positive regulation of calcium ion transport", "id": "GO:0051928", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051928", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" } ], "pmid": "" }, { "name": "induction of positive chemotaxis", "id": "GO:0050930", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050930", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" } ], "pmid": "" }, { "name": "negative regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway", "id": "GO:1902236", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902236", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" } ], "pmid": "" }, { "name": "integrated stress response signaling", "id": "GO:0140467", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140467", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 13, "go_terms": [ { "name": "Golgi membrane", "id": "GO:0000139", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000139", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" } ], "pmid": "" }, { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" } ], "pmid": "" }, { "name": "endoplasmic reticulum", "id": "GO:0005783", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" } ], "pmid": "" }, { "name": "Golgi apparatus", "id": "GO:0005794", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005794", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" } ], "pmid": "" }, { "name": "neuronal cell body", "id": "GO:0043025", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043025", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" } ], "pmid": "" }, { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" } ], "pmid": "" }, { "name": "nuclear body", "id": "GO:0016604", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016604", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" } ], "pmid": "" }, { "name": "chromatin", "id": "GO:0000785", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000785", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" } ], "pmid": "" }, { "name": "RNA polymerase II transcription regulator complex", "id": "GO:0090575", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090575", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 14, "go_terms": [ { "name": "DNA binding", "id": "GO:0003677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" } ], "pmid": "" }, { "name": "chromatin binding", "id": "GO:0003682", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003682", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" } ], "pmid": "" }, { "name": "DNA-binding transcription factor activity", "id": "GO:0003700", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003700", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" } ], "pmid": "" }, { "name": "protein homodimerization activity", "id": "GO:0042803", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042803", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" } ], "pmid": "" }, { "name": "protein dimerization activity", "id": "GO:0046983", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046983", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" } ], "pmid": "" }, { "name": "RNA polymerase II transcription regulatory region sequence-specific DNA binding", "id": "GO:0000977", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000977", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" } ], "pmid": "" }, { "name": "RNA polymerase II cis-regulatory region sequence-specific DNA binding", "id": "GO:0000978", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000978", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" } ], "pmid": "" }, { "name": "DNA-binding transcription factor activity, RNA polymerase II-specific", "id": "GO:0000981", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000981", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" } ], "pmid": "" }, { "name": "DNA-binding transcription activator activity, RNA polymerase II-specific", "id": "GO:0001228", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001228", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" } ], "pmid": "" }, { "name": "cAMP response element binding protein binding", "id": "GO:0008140", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008140", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" } ], "pmid": "" }, { "name": "CCR1 chemokine receptor binding", "id": "GO:0031726", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031726", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" } ], "pmid": "" }, { "name": "transcription coregulator binding", "id": "GO:0001221", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001221", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" } ], "pmid": "" }, { "name": "sequence-specific double-stranded DNA binding", "id": "GO:1990837", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990837", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 203, "end_pos": 205, "annotation": "n_glycosylation_sequon" }, { "start_pos": 222, "end_pos": 224, "annotation": "n_glycosylation_sequon" }, { "start_pos": 307, "end_pos": 309, "annotation": "n_glycosylation_sequon" }, { "start_pos": 348, "end_pos": 350, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "First proteolytically cleaved by site-1 protease (S1P) that generates membrane-associated N-terminus and a luminal C-terminus forms. The membrane-associated N-terminus form is further proteolytically processed probably by the site-2 protease (S2P) through a regulated intramembrane proteolysis (RIP), releasing the transcriptional active processed cyclic AMP-responsive element-binding protein 3 form, which is transported to the nucleus. The proteolytic cleavage is strongly induced during dendritic cell (DC) maturation and inhibited by DCSTAMP. That form is rapidly degraded.", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" }, { "database": "PubMed", "id": "20546900", "url": "https://glygen.org/publication/PubMed/20546900" }, { "database": "PubMed", "id": "17054986", "url": "https://glygen.org/publication/PubMed/17054986" }, { "database": "PubMed", "id": "16940180", "url": "https://glygen.org/publication/PubMed/16940180" }, { "database": "PubMed", "id": "18391022", "url": "https://glygen.org/publication/PubMed/18391022" }, { "database": "PubMed", "id": "12138176", "url": "https://glygen.org/publication/PubMed/12138176" } ] }, { "annotation": "N-glycosylated.", "evidence": [ { "database": "UniProtKB", "id": "O43889", "url": "https://www.uniprot.org/uniprot/O43889" }, { "database": "PubMed", "id": "16940180", "url": "https://glygen.org/publication/PubMed/16940180" }, { "database": "PubMed", "id": "12138176", "url": "https://glygen.org/publication/PubMed/12138176" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [ 307, 348 ], "o_linked_sites": [], "snv_sites": [ 80, 94, 308, 309 ], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 203, "end_pos": 205 }, { "start_pos": 222, "end_pos": 224 }, { "start_pos": 307, "end_pos": 309 }, { "start_pos": 348, "end_pos": 350 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 39 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }