{ "uniprot_canonical_ac": "O43808-1", "uniprot_ac": "O43808", "uniprot_id": "PM34_HUMAN", "mass": { "chemical_mass": 34567.0, "monoisotopic_mass": 34567.0 }, "refseq": { "ac": "NP_001269656", "name": "peroxisomal membrane protein PMP34 isoform 3", "summary": "This gene encodes a peroxisomal membrane protein that belongs to the family of mitochondrial solute carriers. It is expressed in the liver, and is likely involved in transport. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2013].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001269656" }, "gene_names": [ { "name": "SLC25A17", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O43808", "id": "O43808" }, { "name": "PMP34", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001269656", "id": "NP_001269656" }, { "name": "PMP34", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O43808", "id": "O43808" }, { "name": "SLC25A17", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001269656", "id": "NP_001269656" } ], "protein_names": [ { "name": "Peroxisomal membrane protein PMP34", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O43808" }, { "name": "34 kDa peroxisomal membrane protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O43808" }, { "name": "Solute carrier family 25 member 17", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O43808" }, { "name": "peroxisomal membrane protein PMP34 isoform 3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001269656", "id": "NP_001269656" }, { "name": "peroxisomal membrane protein PMP34; solute carrier family 25 (mitochondrial carrier; peroxisomal membrane protein, 34kDa), member 17", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001269656", "id": "NP_001269656" } ], "function": [ { "annotation": "Compares and contrasts all the known human SLC25A* genes and includes functional information. Review article", "evidence": [ { "database": "RefSeq", "id": "NP_001269656", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001269656" }, { "database": "PubMed", "id": "23266187", "url": "https://glygen.org/publication/PubMed/23266187" } ] }, { "annotation": "Multiomics data analyses to identify SLC25A17 as a novel biomarker to predict the prognosis and immune microenvironment in head and neck squamous cell carcinoma. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001269656", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001269656" }, { "database": "PubMed", "id": "37386359", "url": "https://glygen.org/publication/PubMed/37386359" } ] }, { "annotation": "PEX16 mediates the peroxisomal trafficking of two distinct peroxisomal membrane proteins, PEX3 and PMP34, via the endoplasmic reticulum", "evidence": [ { "database": "RefSeq", "id": "NP_001269656", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001269656" }, { "database": "PubMed", "id": "25002403", "url": "https://glygen.org/publication/PubMed/25002403" } ] }, { "annotation": "Peroxisomal transporter for multiple cofactors like coenzyme A (CoA), flavin adenine dinucleotide (FAD), flavin mononucleotide (FMN) and nucleotide adenosine monophosphate (AMP), and to a lesser extent for nicotinamide adenine dinucleotide (NAD(+)), adenosine diphosphate (ADP) and adenosine 3',5'-diphosphate (PAP). May catalyze the transport of free CoA, FAD and NAD(+) from the cytosol into the peroxisomal matrix by a counter-exchange mechanism.", "evidence": [ { "database": "UniProtKB", "id": "O43808", "url": "https://www.uniprot.org/uniprot/O43808#function" }, { "database": "PubMed", "id": "22185573", "url": "https://glygen.org/publication/PubMed/22185573" } ] }, { "annotation": "SLC25A17 is a transporter for CoA and FAD, and to a lesser extent NAD", "evidence": [ { "database": "RefSeq", "id": "NP_001269656", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001269656" }, { "database": "PubMed", "id": "22185573", "url": "https://glygen.org/publication/PubMed/22185573" } ] }, { "annotation": "This gene encodes a peroxisomal membrane protein that belongs to the family of mitochondrial solute carriers. It is expressed in the liver, and is likely involved in transport. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2013].", "evidence": [ { "database": "RefSeq", "id": "NP_001269656", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001269656" } ] } ], "disease": [], "snv": [], "mutagenesis": [ { "start_pos": 190, "end_pos": 199, "sequence_org": "KRQLLKKRMK", "sequence_mut": "AAQLLAAAMA", "comment": "Localizes in the cytoplasm.", "evidence": [ { "database": "UniProtKB", "id": "O43808", "url": "https://www.uniprot.org/uniprot/O43808" }, { "database": "PubMed", "id": "11121399", "url": "https://glygen.org/publication/PubMed/11121399" } ] }, { "start_pos": 283, "end_pos": 285, "sequence_org": "LMF", "sequence_mut": "KKK", "comment": "Impairs interaction with PEX19.", "evidence": [ { "database": "UniProtKB", "id": "O43808", "url": "https://www.uniprot.org/uniprot/O43808" }, { "database": "PubMed", "id": "14709540", "url": "https://glygen.org/publication/PubMed/14709540" } ] }, { "start_pos": 289, "end_pos": 290, "sequence_org": "EK", "sequence_mut": "LL", "comment": "Impairs interaction with PEX19.", "evidence": [ { "database": "UniProtKB", "id": "O43808", "url": "https://www.uniprot.org/uniprot/O43808" }, { "database": "PubMed", "id": "14709540", "url": "https://glygen.org/publication/PubMed/14709540" } ] }, { "start_pos": 302, "end_pos": 303, "sequence_org": "KR", "sequence_mut": "EE", "comment": "No effect on interaction with PEX19.", "evidence": [ { "database": "UniProtKB", "id": "O43808", "url": "https://www.uniprot.org/uniprot/O43808" }, { "database": "PubMed", "id": "14709540", "url": "https://glygen.org/publication/PubMed/14709540" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "79.79", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000100372", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000100372" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "75.06", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000100372", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000100372" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "75.65", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000100372", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000100372" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "66.72", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000100372", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000100372" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "85.88", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000100372", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000100372" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "85.73", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000100372", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000100372" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "64.34", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000100372", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000100372" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "79.36", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000100372", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000100372" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "84.14", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000100372", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000100372" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "65.44", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000100372", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000100372" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "82.88", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000100372", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000100372" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "84.35", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000100372", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000100372" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "85.54", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000100372", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000100372" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O43808", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43808" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O43808", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43808" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O43808", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43808" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O43808", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43808" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O43808", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43808" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O43808", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43808" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O43808", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43808" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O43808", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43808" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O43808", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43808" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O43808", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43808" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O43808", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43808" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O43808", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43808" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O43808", "url": "https://www.uniprot.org/uniprot/O43808" } ], "common_name": "Human" } ], "gene": [ { "name": "SLC25A17", "url": "https://www.uniprot.org/uniprot/O43808", "locus": { "chromosome": "22", "start_pos": 40769630, "end_pos": 40819399, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000100372", "url": "https://www.ensembl.org/id/ENSG00000100372" } ] } } ], "crossref": [ { "id": "ENSG00000100372", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000100372", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "SLC25A17", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=SLC25A17", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "10478", "url": "https://www.ncbi.nlm.nih.gov/gene/10478", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "10987", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=10987", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O43808", "url": "https://www.ebi.ac.uk/intact/interactors/id:O43808*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR002067", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002067", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002113", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002113", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018108", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018108", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR023395", "url": "https://www.ebi.ac.uk/interpro/entry/IPR023395", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:10478", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:10478", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "606795", "url": "http://www.omim.org/entry/606795", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O43808", "url": "https://www.nextprot.org/entry/NX_O43808", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "O43808", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O43808", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "QFMMYEL", "url": "https://omabrowser.org/oma/group/QFMMYEL/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3670854at2759", "url": "http://www.orthodb.org/?query=3670854at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR45939", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45939", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR45939:SF5", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR45939:SF5", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00153", "url": "http://pfam.xfam.org/family/PF00153", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O43808", "url": "https://pharos.nih.gov/targets/O43808", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O43808", "url": "http://purl.obolibrary.org/obo/PR_O43808", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-389599", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389599", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9603798", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9603798", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001269656", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001269656", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "65424", "url": "https://www.rhea-db.org/rhea/65424", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "72839", "url": "https://www.rhea-db.org/rhea/72839", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "72847", "url": "https://www.rhea-db.org/rhea/72847", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "72851", "url": "https://www.rhea-db.org/rhea/72851", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "73087", "url": "https://www.rhea-db.org/rhea/73087", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "73091", "url": "https://www.rhea-db.org/rhea/73091", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "73095", "url": "https://www.rhea-db.org/rhea/73095", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "73099", "url": "https://www.rhea-db.org/rhea/73099", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "73143", "url": "https://www.rhea-db.org/rhea/73143", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "73147", "url": "https://www.rhea-db.org/rhea/73147", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "73151", "url": "https://www.rhea-db.org/rhea/73151", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "73155", "url": "https://www.rhea-db.org/rhea/73155", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "73159", "url": "https://www.rhea-db.org/rhea/73159", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "73163", "url": "https://www.rhea-db.org/rhea/73163", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "73167", "url": "https://www.rhea-db.org/rhea/73167", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "73171", "url": "https://www.rhea-db.org/rhea/73171", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "73175", "url": "https://www.rhea-db.org/rhea/73175", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "73183", "url": "https://www.rhea-db.org/rhea/73183", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "73447", "url": "https://www.rhea-db.org/rhea/73447", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "73451", "url": "https://www.rhea-db.org/rhea/73451", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "B0QYW5", "url": "https://www.uniprot.org/uniprot/B0QYW5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B0QYW5-1", "url": "https://www.uniprot.org/uniprot/B0QYW5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B1AHN4", "url": "https://www.uniprot.org/uniprot/B1AHN4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B1AHN4-1", "url": "https://www.uniprot.org/uniprot/B1AHN4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F2Z2I9", "url": "https://www.uniprot.org/uniprot/F2Z2I9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F2Z2I9-1", "url": "https://www.uniprot.org/uniprot/F2Z2I9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F6RTR7", "url": "https://www.uniprot.org/uniprot/F6RTR7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F6RTR7-1", "url": "https://www.uniprot.org/uniprot/F6RTR7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8WA85", "url": "https://www.uniprot.org/uniprot/F8WA85", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8WA85-1", "url": "https://www.uniprot.org/uniprot/F8WA85-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8WBA4", "url": "https://www.uniprot.org/uniprot/F8WBA4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8WBA4-1", "url": "https://www.uniprot.org/uniprot/F8WBA4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8WCH6", "url": "https://www.uniprot.org/uniprot/F8WCH6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8WCH6-1", "url": "https://www.uniprot.org/uniprot/F8WCH6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8WCN9", "url": "https://www.uniprot.org/uniprot/F8WCN9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8WCN9-1", "url": "https://www.uniprot.org/uniprot/F8WCN9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8WE74", "url": "https://www.uniprot.org/uniprot/F8WE74", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8WE74-1", "url": "https://www.uniprot.org/uniprot/F8WE74-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8WEC6", "url": "https://www.uniprot.org/uniprot/F8WEC6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8WEC6-1", "url": "https://www.uniprot.org/uniprot/F8WEC6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8WF87", "url": "https://www.uniprot.org/uniprot/F8WF87", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8WF87-1", "url": "https://www.uniprot.org/uniprot/F8WF87-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O43808", "url": "https://www.uniprot.org/uniprot/O43808", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O43808-1", "url": "https://www.uniprot.org/uniprot/O43808-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MASVLSYESLVHAVAGAVGSVTAMTVFFPLDTARLRLQVDEKRKSKTTHMVLLEIIKEEGLLAPYRGWFPVISSLCCSNFVYFYTFNSLKALWVKGQHSTTGKDLVVGFVAGVVNVLLTTPLWVVNTRLKLQGAKFRNEDIVPTNYKGIIDAFHQIIRDEGISALWNGTFPSLLLVFNPAIQFMFYEGLKRQLLKKRMKLSSLDVFIIGAVAKAIATTVTYPLQTVQSILRFGRHRLNPENRTLGSLRNILYLLHQRVRRFGIMGLYKGLEAKLLQTVLTAALMFLVYEKLTAATFTVMGLKRAHQH", "length": 307, "header": "sp|O43808-1|PM34_HUMAN Isoform 1 of Peroxisomal membrane protein PMP34 OS=Homo sapiens OX=9606 GN=SLC25A17 PE=1 SV=1 CANONICAL=O43808-1" }, "isoforms": [ { "isoform_ac": "B0QYW5-1", "url": "", "sequence": { "sequence": "MEYWYVALKQQSLKADILPSLFLSIFLVKGVVNVLLTTPLWVVNTRLKLQGAKFRNEDIVPTNYKGIIDAFHQIIRDEGISALWNGTFPSLLLVFNPAIQFMFYEGLKRQLLKKRMKLSSLDVFIIGAVAKAIATTVTYPLQTVQSILRFGRHRLNPENRTLGSLRNILYLLHQRVRRFGIMGLYKGLEAKLLQTVLTAALMFLVYEKLTAATFTVMGLKRAHQH", "length": 225, "header": "tr|B0QYW5-1|PM34_HUMAN Computationally mapped isoform of Peroxisomal membrane protein PMP34 OS=Homo sapiens OX=9606 GN=SLC25A17 PE=1 SV=1 CANONICAL=O43808-1" }, "locus": { "chromosome": "22", "start_pos": 40779213, "end_pos": 40770837, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000402844.7", "url": "https://www.ensembl.org/id/ENST00000402844.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000385303.3", "url": "https://www.ensembl.org/id/ENSP00000385303.3" } ] } }, { "isoform_ac": "B1AHN4-1", "url": "", "sequence": { "sequence": "MGSVTAMTVFFPLDTARLRLQVDEKRKSKTTHMVLLEIIKEEGLLAPYRGWFPVISSLCCSNFVYFYTFNSLKALWVKGQHSTTGKDLVVGF", "length": 92, "header": "tr|B1AHN4-1|B1AHN4_HUMAN Computationally mapped isoform of Solute carrier family 25 member 17 OS=Homo sapiens OX=9606 GN=SLC25A17 PE=1 SV=1 CANONICAL=O43808-1" }, "locus": { "chromosome": "22", "start_pos": 40799563, "end_pos": 40792532, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000434185.1", "url": "https://www.ensembl.org/id/ENST00000434185.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000404200.1", "url": "https://www.ensembl.org/id/ENSP00000404200.1" } ] } }, { "isoform_ac": "F2Z2I9-1", "url": "", "sequence": { "sequence": "MASVLSYESLVHAVAGAVGSVTAMTVFFPLDTARLRLQDLFKLKL", "length": 45, "header": "tr|F2Z2I9-1|PM34_HUMAN Computationally mapped isoform of Peroxisomal membrane protein PMP34 OS=Homo sapiens OX=9606 GN=SLC25A17 PE=1 SV=1 CANONICAL=O43808-1" }, "locus": { "chromosome": "22", "start_pos": 40819248, "end_pos": 40797317, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000458600.5", "url": "https://www.ensembl.org/id/ENST00000458600.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000387478.1", "url": "https://www.ensembl.org/id/ENSP00000387478.1" } ] } }, { "isoform_ac": "F6RTR7-1", "url": "", "sequence": { "sequence": "MASVLSYESLVHAVAGAVGSVTAMTVFFPLDTARLRLQGVVNVLLTTPLWVVNTRLKLQGAKFRNEDIVPTNYKGIIDAFHQIIRDEGISALWNGTFPSLLLVFNPAIQFMFYEGLKRQLLKKRMKLSSLDVFIIGAVAKAIATTVTYPLQTVQSILRFGRHRLNPENRTLGSLRNILYLLHQRVRRFGIMGLYKGLEAKLLQTVLTAALMFLVYEKLTAATFTVMGLKRAHQH", "length": 234, "header": "tr|F6RTR7-1|F6RTR7_HUMAN Computationally mapped isoform of Solute carrier family 25 member 17 OS=Homo sapiens OX=9606 GN=SLC25A17 PE=1 SV=1 CANONICAL=O43808-1" }, "locus": { "chromosome": "22", "start_pos": 40819248, "end_pos": 40770837, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000544408.5", "url": "https://www.ensembl.org/id/ENST00000544408.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000438355.2", "url": "https://www.ensembl.org/id/ENSP00000438355.2" } ] } }, { "isoform_ac": "F8WA85-1", "url": "", "sequence": { "sequence": "MASVLSYESLVHAVAGAVGSVTAMTVFFPLDTARLRLQVDEKRKSKTTHMVLLEIIKEEGLSG", "length": 63, "header": "tr|F8WA85-1|F8WA85_HUMAN Computationally mapped isoform of Solute carrier family 25 member 17 OS=Homo sapiens OX=9606 GN=SLC25A17 PE=1 SV=1 CANONICAL=O43808-1" }, "locus": { "chromosome": "22", "start_pos": 40819248, "end_pos": 40779119, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000263255.10", "url": "https://www.ensembl.org/id/ENST00000263255.10" }, { "database": "Ensembl Peptide", "id": "ENSP00000263255.6", "url": "https://www.ensembl.org/id/ENSP00000263255.6" } ] } }, { "isoform_ac": "F8WBA4-1", "url": "", "sequence": { "sequence": "MASVLSYESLVHAVAGAVPGTISRVVSSDFQSLLLQFCLFLHF", "length": 43, "header": "tr|F8WBA4-1|PM34_HUMAN Computationally mapped isoform of Peroxisomal membrane protein PMP34 OS=Homo sapiens OX=9606 GN=SLC25A17 PE=1 SV=1 CANONICAL=O43808-1" }, "locus": { "chromosome": "22", "start_pos": 40819248, "end_pos": 40792602, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000447566.5", "url": "https://www.ensembl.org/id/ENST00000447566.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000390502.1", "url": "https://www.ensembl.org/id/ENSP00000390502.1" } ] } }, { "isoform_ac": "F8WCH6-1", "url": "", "sequence": { "sequence": "MASVLSYESLVHAVAGAVGSVTAMTVFFPLDTARLRLQAWHHIEGGFQ", "length": 48, "header": "tr|F8WCH6-1|F8WCH6_HUMAN Computationally mapped isoform of Solute carrier family 25 member 17 OS=Homo sapiens OX=9606 GN=SLC25A17 PE=1 SV=1 CANONICAL=O43808-1" }, "locus": { "chromosome": "22", "start_pos": 40819248, "end_pos": 40792648, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000412879.5", "url": "https://www.ensembl.org/id/ENST00000412879.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000400053.1", "url": "https://www.ensembl.org/id/ENSP00000400053.1" } ] } }, { "isoform_ac": "F8WCN9-1", "url": "", "sequence": { "sequence": "MASVLSYESLVHAVAGAVLDFDFRLMRKENPKLHTWCSWRSLKKKDSWHHIEGGFQ", "length": 56, "header": "tr|F8WCN9-1|PM34_HUMAN Computationally mapped isoform of Peroxisomal membrane protein PMP34 OS=Homo sapiens OX=9606 GN=SLC25A17 PE=1 SV=1 CANONICAL=O43808-1" }, "locus": { "chromosome": "22", "start_pos": 40819248, "end_pos": 40792648, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000427084.5", "url": "https://www.ensembl.org/id/ENST00000427084.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000416618.1", "url": "https://www.ensembl.org/id/ENSP00000416618.1" } ] } }, { "isoform_ac": "F8WE74-1", "url": "", "sequence": { "sequence": "MASVLSYESLVHAVAGAVGSVTAMTVFFPLDTARLRLQVDEKRKSKTTHMVLLEIIKEEGLLAPYRGWFPVISSLCCSNFVYFYTFNSLKALWVKGQHSTTGKDLVVGFVAGVVNVLLTTPLWVVNTRLKLQGAKFRNEDIVPTNYKGIIDAFHQIIRDEGISALWNGTFPSLLLVFNPAIQFMFYEGLKRQLLKKRMKLSSLDVFIIGAVAKAIATTVTYPLQTVQSILRLFIHSNIY", "length": 239, "header": "tr|F8WE74-1|F8WE74_HUMAN Computationally mapped isoform of Solute carrier family 25 member 17 OS=Homo sapiens OX=9606 GN=SLC25A17 PE=1 SV=1 CANONICAL=O43808-1" }, "locus": { "chromosome": "22", "start_pos": 40819248, "end_pos": 40776285, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000420970.5", "url": "https://www.ensembl.org/id/ENST00000420970.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000394539.1", "url": "https://www.ensembl.org/id/ENSP00000394539.1" } ] } }, { "isoform_ac": "F8WEC6-1", "url": "", "sequence": { "sequence": "MASVLSYESLVHAVAGAVGSVTAMTVFFPLDTARLRLQVDEKRKSKTTHMVLLEIIKEEGLLAPYRGWFPVISSLCCSNFVYFYTFNSLKALWVKGQHSTTGKDLVVGFVADGGLSVLPRLVSNPWPQEILLPRPSKVLGLQEWLMCC", "length": 148, "header": "tr|F8WEC6-1|F8WEC6_HUMAN Computationally mapped isoform of Solute carrier family 25 member 17 OS=Homo sapiens OX=9606 GN=SLC25A17 PE=1 SV=1 CANONICAL=O43808-1" }, "locus": { "chromosome": "22", "start_pos": 40819248, "end_pos": 40779108, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000426396.5", "url": "https://www.ensembl.org/id/ENST00000426396.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000388966.1", "url": "https://www.ensembl.org/id/ENSP00000388966.1" } ] } }, { "isoform_ac": "F8WF87-1", "url": "", "sequence": { "sequence": "MASVLSYESLVHAVAGAVLDFDFRPGTISRVVSSDFQSLLLQFCLFLHF", "length": 49, "header": "tr|F8WF87-1|F8WF87_HUMAN Computationally mapped isoform of Solute carrier family 25 member 17 OS=Homo sapiens OX=9606 GN=SLC25A17 PE=4 SV=1 CANONICAL=O43808-1" }, "locus": { "chromosome": "22", "start_pos": 40819248, "end_pos": 40792602, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000430221.5", "url": "https://www.ensembl.org/id/ENST00000430221.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000407096.1", "url": "https://www.ensembl.org/id/ENSP00000407096.1" } ] } }, { "isoform_ac": "O43808-1", "url": "", "sequence": { "sequence": "MASVLSYESLVHAVAGAVGSVTAMTVFFPLDTARLRLQVDEKRKSKTTHMVLLEIIKEEGLLAPYRGWFPVISSLCCSNFVYFYTFNSLKALWVKGQHSTTGKDLVVGFVAGVVNVLLTTPLWVVNTRLKLQGAKFRNEDIVPTNYKGIIDAFHQIIRDEGISALWNGTFPSLLLVFNPAIQFMFYEGLKRQLLKKRMKLSSLDVFIIGAVAKAIATTVTYPLQTVQSILRFGRHRLNPENRTLGSLRNILYLLHQRVRRFGIMGLYKGLEAKLLQTVLTAALMFLVYEKLTAATFTVMGLKRAHQH", "length": 307, "header": "sp|O43808-1|PM34_HUMAN Isoform 1 of Peroxisomal membrane protein PMP34 OS=Homo sapiens OX=9606 GN=SLC25A17 PE=1 SV=1 CANONICAL=O43808-1" }, "locus": { "chromosome": "22", "start_pos": 40819248, "end_pos": 40770837, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000435456.7", "url": "https://www.ensembl.org/id/ENST00000435456.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000390722.2", "url": "https://www.ensembl.org/id/ENSP00000390722.2" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "O43808", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O43808" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Human very-long-chain acyl-CoA synthetase: cloning, topography, and relevance to branched-chain fatty acid metabolism.", "journal": "Biochemical and biophysical research communications", "date": "1999", "authors": "Steinberg SJ, Wang SJ, Kim DG, Mihalik SJ, Watkins PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-389599", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389599" } ], "reference": [ { "type": "PubMed", "id": "10198260", "url": "https://glygen.org/publication/PubMed/10198260" } ] }, { "title": "Identification and characterization of the human peroxin PEX3.", "journal": "European journal of cell biology", "date": "1999", "authors": "Soukupova M, Sprenger C, Gorgas K, Kunau WH, Dodt G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9603798", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9603798" } ], "reference": [ { "type": "PubMed", "id": "10430017", "url": "https://glygen.org/publication/PubMed/10430017" } ] }, { "title": "Purification, molecular cloning, and expression of 2-hydroxyphytanoyl-CoA lyase, a peroxisomal thiamine pyrophosphate-dependent enzyme that catalyzes the carbon-carbon bond cleavage during alpha-oxidation of 3-methyl-branched fatty acids.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Foulon V, Antonenkov VD, Croes K, Waelkens E, Mannaerts GP, Van Veldhoven PP, Casteels M", "evidence": [ { "database": "Reactome", "id": "R-HSA-389599", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389599" } ], "reference": [ { "type": "PubMed", "id": "10468558", "url": "https://glygen.org/publication/PubMed/10468558" } ] }, { "title": "PEX19 binds multiple peroxisomal membrane proteins, is predominantly cytoplasmic, and is required for peroxisome membrane synthesis.", "journal": "J. Cell Biol.", "date": "2000", "authors": "Sacksteder KA, Jones JM, South ST, Li X, Liu Y, Gould SJ", "evidence": [ { "database": "UniProtKB", "id": "O43808", "url": "https://www.uniprot.org/uniprot/O43808" }, { "database": "Reactome", "id": "R-HSA-9603798", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9603798" } ], "reference": [ { "type": "PubMed", "id": "10704444", "url": "https://glygen.org/publication/PubMed/10704444" } ] }, { "title": "Molecular cloning and expression of mammalian peroxisomal trans-2-enoyl-coenzyme A reductase cDNAs.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Das AK, Uhler MD, Hajra AK", "evidence": [ { "database": "Reactome", "id": "R-HSA-389599", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389599" } ], "reference": [ { "type": "PubMed", "id": "10811639", "url": "https://glygen.org/publication/PubMed/10811639" } ] }, { "title": "Topogenesis of peroxisomal membrane protein requires a short, positively charged intervening-loop sequence and flanking hydrophobic segments. study using human membrane protein PMP34.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Honsho M, Fujiki Y", "evidence": [ { "database": "UniProtKB", "id": "O43808", "url": "https://www.uniprot.org/uniprot/O43808" } ], "reference": [ { "type": "PubMed", "id": "11121399", "url": "https://glygen.org/publication/PubMed/11121399" } ] }, { "title": "Human pex19p binds peroxisomal integral membrane proteins at regions distinct from their sorting sequences.", "journal": "Molecular and cellular biology", "date": "2001", "authors": "Fransen M, Wylin T, Brees C, Mannaerts GP, Van Veldhoven PP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9603798", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9603798" } ], "reference": [ { "type": "PubMed", "id": "11390669", "url": "https://glygen.org/publication/PubMed/11390669" } ] }, { "title": "Multiple distinct targeting signals in integral peroxisomal membrane proteins.", "journal": "J. Cell Biol.", "date": "2001", "authors": "Jones JM, Morrell JC, Gould SJ", "evidence": [ { "database": "UniProtKB", "id": "O43808", "url": "https://www.uniprot.org/uniprot/O43808" }, { "database": "Reactome", "id": "R-HSA-9603798", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9603798" } ], "reference": [ { "type": "PubMed", "id": "11402059", "url": "https://glygen.org/publication/PubMed/11402059" } ] }, { "title": "Targeting elements in the amino-terminal part direct the human 70-kDa peroxisomal integral membrane protein (PMP70) to peroxisomes.", "journal": "Biochemical and biophysical research communications", "date": "2001", "authors": "Biermanns M, Gartner J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9603798", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9603798" } ], "reference": [ { "type": "PubMed", "id": "11453642", "url": "https://glygen.org/publication/PubMed/11453642" } ] }, { "title": "Structure-function analysis of phytanoyl-CoA 2-hydroxylase mutations causing Refsum's disease.", "journal": "Human molecular genetics", "date": "2001", "authors": "Mukherji M, Chien W, Kershaw NJ, Clifton IJ, Schofield CJ, Wierzbicki AS, Lloyd MD", "evidence": [ { "database": "Reactome", "id": "R-HSA-389599", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389599" } ], "reference": [ { "type": "PubMed", "id": "11555634", "url": "https://glygen.org/publication/PubMed/11555634" } ] }, { "title": "Two different targeting signals direct human peroxisomal membrane protein 22 to peroxisomes.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Brosius U, Dehmel T, Gartner J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9603798", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9603798" } ], "reference": [ { "type": "PubMed", "id": "11590176", "url": "https://glygen.org/publication/PubMed/11590176" } ] }, { "title": "Two splice variants of human PEX19 exhibit distinct functions in peroxisomal assembly.", "journal": "Biochemical and biophysical research communications", "date": "2002", "authors": "Mayerhofer PU, Kattenfeld T, Roscher AA, Muntau AC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9603798", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9603798" } ], "reference": [ { "type": "PubMed", "id": "11883941", "url": "https://glygen.org/publication/PubMed/11883941" } ] }, { "title": "Identification of human PMP34 as a peroxisomal ATP transporter.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2002", "authors": "Visser WF, van Roermund CW, Waterham HR, Wanders RJ", "evidence": [ { "database": "UniProtKB", "id": "O43808", "url": "https://www.uniprot.org/uniprot/O43808" }, { "database": "Reactome", "id": "R-HSA-389599", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389599" } ], "reference": [ { "type": "PubMed", "id": "12445829", "url": "https://glygen.org/publication/PubMed/12445829" } ] }, { "title": "The peroxisomal membrane targeting elements of human peroxin 2 (PEX2).", "journal": "European journal of cell biology", "date": "2003", "authors": "Biermanns M, von Laar J, Brosius U, Gartner J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9603798", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9603798" } ], "reference": [ { "type": "PubMed", "id": "12751901", "url": "https://glygen.org/publication/PubMed/12751901" } ] }, { "title": "The interaction between human PEX3 and PEX19 characterized by fluorescence resonance energy transfer (FRET) analysis.", "journal": "European journal of cell biology", "date": "2003", "authors": "Muntau AC, Roscher AA, Kunau WH, Dodt G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9603798", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9603798" } ], "reference": [ { "type": "PubMed", "id": "12924628", "url": "https://glygen.org/publication/PubMed/12924628" } ] }, { "title": "PEX19 is a predominantly cytosolic chaperone and import receptor for class 1 peroxisomal membrane proteins.", "journal": "The Journal of cell biology", "date": "2004", "authors": "Jones JM, Morrell JC, Gould SJ", "evidence": [ { "database": "UniProtKB", "id": "O43808", "url": "https://www.uniprot.org/uniprot/O43808" }, { "database": "Reactome", "id": "R-HSA-9603798", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9603798" } ], "reference": [ { "type": "PubMed", "id": "14709540", "url": "https://glygen.org/publication/PubMed/14709540" } ] }, { "title": "PEX3 functions as a PEX19 docking factor in the import of class I peroxisomal membrane proteins.", "journal": "The Journal of cell biology", "date": "2004", "authors": "Fang Y, Morrell JC, Jones JM, Gould SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9603798", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9603798" } ], "reference": [ { "type": "PubMed", "id": "15007061", "url": "https://glygen.org/publication/PubMed/15007061" } ] }, { "title": "Analysis of human Pex19p's domain structure by pentapeptide scanning mutagenesis.", "journal": "Journal of molecular biology", "date": "2005", "authors": "Fransen M, Vastiau I, Brees C, Brys V, Mannaerts GP, Van Veldhoven PP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9603798", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9603798" } ], "reference": [ { "type": "PubMed", "id": "15713480", "url": "https://glygen.org/publication/PubMed/15713480" } ] }, { "title": "Function of the PEX19-binding site of human adrenoleukodystrophy protein as targeting motif in man and yeast. PMP targeting is evolutionarily conserved.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Halbach A, Lorenzen S, Landgraf C, Volkmer-Engert R, Erdmann R, Rottensteiner H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9603798", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9603798" } ], "reference": [ { "type": "PubMed", "id": "15781447", "url": "https://glygen.org/publication/PubMed/15781447" } ] }, { "title": "Structure of human phytanoyl-CoA 2-hydroxylase identifies molecular mechanisms of Refsum disease.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "McDonough MA, Kavanagh KL, Butler D, Searls T, Oppermann U, Schofield CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-389599", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389599" } ], "reference": [ { "type": "PubMed", "id": "16186124", "url": "https://glygen.org/publication/PubMed/16186124" } ] }, { "title": "In vitro transport of membrane proteins to peroxisomes by shuttling receptor Pex19p.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Matsuzono Y, Fujiki Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9603798", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9603798" } ], "reference": [ { "type": "PubMed", "id": "16280322", "url": "https://glygen.org/publication/PubMed/16280322" } ] }, { "title": "Peroxisomal trans-2-enoyl-CoA reductase is involved in phytol degradation.", "journal": "FEBS letters", "date": "2006", "authors": "Gloerich J, Ruiter JP, van den Brink DM, Ofman R, Ferdinandusse S, Wanders RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-389599", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389599" } ], "reference": [ { "type": "PubMed", "id": "16546181", "url": "https://glygen.org/publication/PubMed/16546181" } ] }, { "title": "Biochemistry of mammalian peroxisomes revisited.", "journal": "Annual review of biochemistry", "date": "2006", "authors": "Wanders RJ, Waterham HR", "evidence": [ { "database": "Reactome", "id": "R-HSA-389599", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389599" } ], "reference": [ { "type": "PubMed", "id": "16756494", "url": "https://glygen.org/publication/PubMed/16756494" } ] }, { "title": "Farnesylation of Pex19p is not essential for peroxisome biogenesis in yeast and mammalian cells.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2006", "authors": "Vastiau IM, Anthonio EA, Brams M, Brees C, Young SG, Van de Velde S, Wanders RJ, Mannaerts GP, Baes M, Van Veldhoven PP, Fransen M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9603798", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9603798" } ], "reference": [ { "type": "PubMed", "id": "16791427", "url": "https://glygen.org/publication/PubMed/16791427" } ] }, { "title": "Functional domain mapping of peroxin Pex19p: interaction with Pex3p is essential for function and translocation.", "journal": "Journal of cell science", "date": "2006", "authors": "Matsuzono Y, Matsuzaki T, Fujiki Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9603798", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9603798" } ], "reference": [ { "type": "PubMed", "id": "16895967", "url": "https://glygen.org/publication/PubMed/16895967" } ] }, { "title": "The import competence of a peroxisomal membrane protein is determined by Pex19p before the docking step.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Pinto MP, Grou CP, Alencastre IS, Oliveira ME, Sa-Miranda C, Fransen M, Azevedo JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9603798", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9603798" } ], "reference": [ { "type": "PubMed", "id": "16980692", "url": "https://glygen.org/publication/PubMed/16980692" } ] }, { "title": "Import of peroxisomal membrane proteins: the interplay of Pex3p- and Pex19p-mediated interactions.", "journal": "Biochimica et biophysica acta", "date": "2006", "authors": "Fujiki Y, Matsuzono Y, Matsuzaki T, Fransen M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9603798", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9603798" } ], "reference": [ { "type": "PubMed", "id": "17069900", "url": "https://glygen.org/publication/PubMed/17069900" } ] }, { "title": "Characterization of the interaction between recombinant human peroxin Pex3p and Pex19p: identification of TRP-104 IN Pex3p as a critical residue for the interaction.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Sato Y, Shibata H, Nakano H, Matsuzono Y, Kashiwayama Y, Kobayashi Y, Fujiki Y, Imanaka T, Kato H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9603798", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9603798" } ], "reference": [ { "type": "PubMed", "id": "18174172", "url": "https://glygen.org/publication/PubMed/18174172" } ] }, { "title": "Targeting of hFis1 to peroxisomes is mediated by Pex19p.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Delille HK, Schrader M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9603798", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9603798" } ], "reference": [ { "type": "PubMed", "id": "18782765", "url": "https://glygen.org/publication/PubMed/18782765" } ] }, { "title": "The peroxisomal receptor Pex19p forms a helical mPTS recognition domain.", "journal": "The EMBO journal", "date": "2010", "authors": "Schueller N, Holton SJ, Fodor K, Milewski M, Konarev P, Stanley WA, Wolf J, Erdmann R, Schliebs W, Song YH, Wilmanns M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9603798", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9603798" } ], "reference": [ { "type": "PubMed", "id": "20531392", "url": "https://glygen.org/publication/PubMed/20531392" } ] }, { "title": "Insights into peroxisome function from the structure of PEX3 in complex with a soluble fragment of PEX19.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Schmidt F, Treiber N, Zocher G, Bjelic S, Steinmetz MO, Kalbacher H, Stehle T, Dodt G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9603798", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9603798" } ], "reference": [ { "type": "PubMed", "id": "20554521", "url": "https://glygen.org/publication/PubMed/20554521" } ] }, { "title": "Biochemistry and genetics of inherited disorders of peroxisomal fatty acid metabolism.", "journal": "Journal of lipid research", "date": "2010", "authors": "Van Veldhoven PP", "evidence": [ { "database": "Reactome", "id": "R-HSA-389599", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389599" } ], "reference": [ { "type": "PubMed", "id": "20558530", "url": "https://glygen.org/publication/PubMed/20558530" } ] }, { "title": "Structural basis for docking of peroxisomal membrane protein carrier Pex19p onto its receptor Pex3p.", "journal": "The EMBO journal", "date": "2010", "authors": "Sato Y, Shibata H, Nakatsu T, Nakano H, Kashiwayama Y, Imanaka T, Kato H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9603798", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9603798" } ], "reference": [ { "type": "PubMed", "id": "21102411", "url": "https://glygen.org/publication/PubMed/21102411" } ] }, { "title": "The human gene SLC25A17 encodes a peroxisomal transporter of coenzyme A, FAD and NAD+.", "journal": "The Biochemical journal", "date": "2012", "authors": "Agrimi G, Russo A, Scarcia P, Palmieri F", "evidence": [ { "database": "UniProtKB", "id": "O43808", "url": "https://www.uniprot.org/uniprot/O43808" }, { "database": "RefSeq", "id": "NP_001269656", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001269656" } ], "reference": [ { "type": "PubMed", "id": "22185573", "url": "https://glygen.org/publication/PubMed/22185573" } ] }, { "title": "The role of conserved PEX3 regions in PEX19-binding and peroxisome biogenesis.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2012", "authors": "Schmidt F, Dietrich D, Eylenstein R, Groemping Y, Stehle T, Dodt G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9603798", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9603798" } ], "reference": [ { "type": "PubMed", "id": "22624858", "url": "https://glygen.org/publication/PubMed/22624858" } ] }, { "title": "The mitochondrial transporter family SLC25: identification, properties and physiopathology.", "journal": "Molecular aspects of medicine", "date": "2013", "authors": "Palmieri F", "evidence": [ { "database": "RefSeq", "id": "NP_001269656", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001269656" } ], "reference": [ { "type": "PubMed", "id": "23266187", "url": "https://glygen.org/publication/PubMed/23266187" } ] }, { "title": "Tail-anchored PEX26 targets peroxisomes via a PEX19-dependent and TRC40-independent class I pathway.", "journal": "The Journal of cell biology", "date": "2013", "authors": "Yagita Y, Hiromasa T, Fujiki Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9603798", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9603798" } ], "reference": [ { "type": "PubMed", "id": "23460677", "url": "https://glygen.org/publication/PubMed/23460677" } ] }, { "title": "Charcot-Marie-Tooth disease-associated mutants of GDAP1 dissociate its roles in peroxisomal and mitochondrial fission.", "journal": "EMBO reports", "date": "2013", "authors": "Huber N, Guimaraes S, Schrader M, Suter U, Niemann A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9603798", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9603798" } ], "reference": [ { "type": "PubMed", "id": "23628762", "url": "https://glygen.org/publication/PubMed/23628762" } ] }, { "title": "PEX16 contributes to peroxisome maintenance by constantly trafficking PEX3 via the ER.", "journal": "Journal of cell science", "date": "2014", "authors": "Aranovich A, Hua R, Rutenberg AD, Kim PK", "evidence": [ { "database": "RefSeq", "id": "NP_001269656", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001269656" } ], "reference": [ { "type": "PubMed", "id": "25002403", "url": "https://glygen.org/publication/PubMed/25002403" } ] }, { "title": "Association between the intrinsically disordered protein PEX19 and PEX3.", "journal": "PloS one", "date": "2014", "authors": "Hattula K, Hirschberg D, Kalkkinen N, Butcher SJ, Ora A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9603798", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9603798" } ], "reference": [ { "type": "PubMed", "id": "25062251", "url": "https://glygen.org/publication/PubMed/25062251" } ] }, { "title": "Hydrophobic handoff for direct delivery of peroxisome tail-anchored proteins.", "journal": "Nature communications", "date": "2014", "authors": "Chen Y, Pieuchot L, Loh RA, Yang J, Kari TM, Wong JY, Jedd G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9603798", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9603798" } ], "reference": [ { "type": "PubMed", "id": "25517356", "url": "https://glygen.org/publication/PubMed/25517356" } ] }, { "title": "Assembly of Peroxisomal Membrane Proteins via the Direct Pex19p-Pex3p Pathway.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2016", "authors": "Liu Y, Yagita Y, Fujiki Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9603798", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9603798" } ], "reference": [ { "type": "PubMed", "id": "26777132", "url": "https://glygen.org/publication/PubMed/26777132" } ] }, { "title": "Allosteric modulation of peroxisomal membrane protein recognition by farnesylation of the peroxisomal import receptor PEX19.", "journal": "Nature communications", "date": "2017", "authors": "Emmanouilidis L, Schutz U, Tripsianes K, Madl T, Radke J, Rucktaschel R, Wilmanns M, Schliebs W, Erdmann R, Sattler M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9603798", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9603798" } ], "reference": [ { "type": "PubMed", "id": "28281558", "url": "https://glygen.org/publication/PubMed/28281558" } ] }, { "title": "Predicting the targeting of tail-anchored proteins to subcellular compartments in mammalian cells.", "journal": "Journal of cell science", "date": "2017", "authors": "Costello JL, Castro IG, Camoes F, Schrader TA, McNeall D, Yang J, Giannopoulou EA, Gomes S, Pogenberg V, Bonekamp NA, Ribeiro D, Wilmanns M, Jedd G, Islinger M, Schrader M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9603798", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9603798" } ], "reference": [ { "type": "PubMed", "id": "28325759", "url": "https://glygen.org/publication/PubMed/28325759" } ] }, { "title": "Synthesis of a Highly Azide-Reactive and Thermosensitive Biofunctional Reagent for Efficient Enrichment and Large-Scale Identification of O-GlcNAc Proteins by Mass Spectrometry.", "journal": "Analytical chemistry", "date": "2017", "authors": "Zhang W, Liu T, Dong H, Bai H, Tian F, Shi Z, Chen M, Wang J, Qin W, Qian X", "evidence": [ { "database": "O-GlcNAc Database", "id": "O43808", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O43808" } ], "reference": [ { "type": "PubMed", "id": "28510447", "url": "https://glygen.org/publication/PubMed/28510447" } ] }, { "title": "Multiomics data analyses to identify SLC25A17 as a novel biomarker to predict the prognosis and immune microenvironment in head and neck squamous cell carcinoma.", "journal": "BMC bioinformatics", "date": "2023-06-29", "authors": "Shi Yunbin, Huang Juntao, Hu Yi, Shen Yi", "evidence": [ { "database": "RefSeq", "id": "NP_001269656", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001269656" } ], "reference": [ { "type": "PubMed", "id": "37386359", "url": "https://glygen.org/publication/PubMed/37386359" } ] }, { "title": "Production of formyl-CoA during peroxisomal alpha-oxidation of 3-methyl-branched fatty acids.", "journal": "FEBS letters", "date": "1997", "authors": "Croes K, Van Veldhoven PP, Mannaerts GP, Casteels M", "evidence": [ { "database": "Reactome", "id": "R-HSA-389599", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389599" } ], "reference": [ { "type": "PubMed", "id": "9166898", "url": "https://glygen.org/publication/PubMed/9166898" } ] }, { "title": "Pex19p, a farnesylated protein essential for peroxisome biogenesis.", "journal": "Molecular and cellular biology", "date": "1998", "authors": "Gotte K, Girzalsky W, Linkert M, Baumgart E, Kammerer S, Kunau WH, Erdmann R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9603798", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9603798" } ], "reference": [ { "type": "PubMed", "id": "9418908", "url": "https://glygen.org/publication/PubMed/9418908" } ] }, { "title": "Identification and characterization of human PMP34, a protein closely related to the peroxisomal integral membrane protein PMP47 of Candida boidinii.", "journal": "Eur. J. Biochem.", "date": "1998", "authors": "Wylin T, Baes M, Brees C, Mannaerts GP, Fransen M, Van Veldhoven PP", "evidence": [ { "database": "UniProtKB", "id": "O43808", "url": "https://www.uniprot.org/uniprot/O43808" }, { "database": "Reactome", "id": "R-HSA-389599", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389599" } ], "reference": [ { "type": "PubMed", "id": "9874197", "url": "https://glygen.org/publication/PubMed/9874197" } ] } ], "pathway": [ { "id": "hsa:10478", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:10478", "resource": "KEGG Pathway" }, { "id": "R-HSA-389599", "name": "Alpha-oxidation of phytanate", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389599", "resource": "Reactome", "description": "Alpha-oxidation of phytanate" }, { "id": "R-HSA-9603798", "name": "Class I peroxisomal membrane protein import", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9603798", "resource": "Reactome", "description": "Class I peroxisomal membrane protein import" } ], "orthologs": [ { "uniprot_canonical_ac": "O70579-1", "protein_name": "Peroxisomal membrane protein PMP34", "gene_name": "Slc25a17", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MASVLSYESLVHAVAGAVGSVTAMTVFFPLDTARLRLQVDEKRKSKTTHAVLLEIIKEEGLLAPYRGWFPVISSLCCSNFVYFYTFNSLKAVWVKGQRSSTGKDLVVGFVAGVVNVLLTTPLWVVNTRLKLQGAKFRNEDIIPTNYKGIIDAFHQIIRDEGILALWNGTFPSLLLVFNPAIQFMFYEGLKRQLLKKRMKLSSLDVFIIGAIAKAIATTVTYPMQTVQSILRFGRHRLNPENRTLGSLRNVLSLLHQRVKRFGIMGLYKGLEAKLLQTVLTAALMFLVYEKLTAATFTVMGLKSTHKH", "length": 307 }, "evidence": [ { "id": "45932517", "url": "http://www.informatics.jax.org/homology/45932517", "database": "MGI" }, { "id": "O43808", "url": "https://omabrowser.org/oma/group/O43808/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9VZD9-1", "protein_name": "Peroxisomal membrane protein 34, isoform A", "gene_name": "PMP34", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MVAPSKLSQVLSYQNFVHAVSGAAGGCIAMSTFYPLDTVRSRLQLEEAGDVRSTRQVIKEIVLGEGFQSLYRGLGPVLQSLCISNFVYFYTFHALKAVASGGSPSQHSALKDLLLGSIAGIINVLTTTPFWVVNTRLRMRNVAGTSDEVNKHYKNLLEGLKYVAEKEGIAGLWSGTIPSLMLVSNPALQFMMYEMLKRNIMRFTGGEMGSLSFFFIGAIAKAFATVLTYPLQLVQTKQRHRSKESDSKPSTSAGSTPRTESTLELMISILQHQGIRGLFRGLEAKILQTVLTAALMFMAYEKIAGTVGMLLKRN", "length": 314 }, "evidence": [ { "id": "O43808", "url": "https://omabrowser.org/oma/group/O43808/", "database": "OMA" } ], "common_name": "Fruit fly" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 5, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "O43808", "url": "https://www.uniprot.org/uniprot/O43808" } ], "pmid": "" }, { "name": "mitochondrial inner membrane", "id": "GO:0005743", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005743", "evidence": [ { "database": "UniProtKB", "id": "O43808", "url": "https://www.uniprot.org/uniprot/O43808" } ], "pmid": "" }, { "name": "peroxisome", "id": "GO:0005777", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005777", "evidence": [ { "database": "UniProtKB", "id": "O43808", "url": "https://www.uniprot.org/uniprot/O43808" } ], "pmid": "" }, { "name": "peroxisomal membrane", "id": "GO:0005778", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005778", "evidence": [ { "database": "UniProtKB", "id": "O43808", "url": "https://www.uniprot.org/uniprot/O43808" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "O43808", "url": "https://www.uniprot.org/uniprot/O43808" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 11, "go_terms": [ { "name": "ATP:ADP antiporter activity", "id": "GO:0005471", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005471", "evidence": [ { "database": "UniProtKB", "id": "O43808", "url": "https://www.uniprot.org/uniprot/O43808" } ], "pmid": "" }, { "name": "protein-folding chaperone binding", "id": "GO:0051087", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051087", "evidence": [ { "database": "UniProtKB", "id": "O43808", "url": "https://www.uniprot.org/uniprot/O43808" } ], "pmid": "" }, { "name": "antiporter activity", "id": "GO:0015297", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015297", "evidence": [ { "database": "UniProtKB", "id": "O43808", "url": "https://www.uniprot.org/uniprot/O43808" } ], "pmid": "" }, { "name": "adenine nucleotide transmembrane transporter activity", "id": "GO:0000295", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000295", "evidence": [ { "database": "UniProtKB", "id": "O43808", "url": "https://www.uniprot.org/uniprot/O43808" } ], "pmid": "" }, { "name": "ATP transmembrane transporter activity", "id": "GO:0005347", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005347", "evidence": [ { "database": "UniProtKB", "id": "O43808", "url": "https://www.uniprot.org/uniprot/O43808" } ], "pmid": "" }, { "name": "ADP transmembrane transporter activity", "id": "GO:0015217", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015217", "evidence": [ { "database": "UniProtKB", "id": "O43808", "url": "https://www.uniprot.org/uniprot/O43808" } ], "pmid": "" }, { "name": "coenzyme A transmembrane transporter activity", "id": "GO:0015228", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015228", "evidence": [ { "database": "UniProtKB", "id": "O43808", "url": "https://www.uniprot.org/uniprot/O43808" } ], "pmid": "" }, { "name": "FMN transmembrane transporter activity", "id": "GO:0044610", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044610", "evidence": [ { "database": "UniProtKB", "id": "O43808", "url": "https://www.uniprot.org/uniprot/O43808" } ], "pmid": "" }, { "name": "NAD transmembrane transporter activity", "id": "GO:0051724", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051724", "evidence": [ { "database": "UniProtKB", "id": "O43808", "url": "https://www.uniprot.org/uniprot/O43808" } ], "pmid": "" }, { "name": "AMP transmembrane transporter activity", "id": "GO:0080122", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0080122", "evidence": [ { "database": "UniProtKB", "id": "O43808", "url": "https://www.uniprot.org/uniprot/O43808" } ], "pmid": "" }, { "name": "FAD transmembrane transporter activity", "id": "GO:0015230", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015230", "evidence": [ { "database": "UniProtKB", "id": "O43808", "url": "https://www.uniprot.org/uniprot/O43808" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 7, "go_terms": [ { "name": "mitochondrial ADP transmembrane transport", "id": "GO:0140021", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140021", "evidence": [ { "database": "UniProtKB", "id": "O43808", "url": "https://www.uniprot.org/uniprot/O43808" } ], "pmid": "" }, { "name": "mitochondrial ATP transmembrane transport", "id": "GO:1990544", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990544", "evidence": [ { "database": "UniProtKB", "id": "O43808", "url": "https://www.uniprot.org/uniprot/O43808" } ], "pmid": "" }, { "name": "transmembrane transport", "id": "GO:0055085", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0055085", "evidence": [ { "database": "UniProtKB", "id": "O43808", "url": "https://www.uniprot.org/uniprot/O43808" } ], "pmid": "" }, { "name": "fatty acid beta-oxidation", "id": "GO:0006635", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006635", "evidence": [ { "database": "UniProtKB", "id": "O43808", "url": "https://www.uniprot.org/uniprot/O43808" } ], "pmid": "" }, { "name": "fatty acid transport", "id": "GO:0015908", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015908", "evidence": [ { "database": "UniProtKB", "id": "O43808", "url": "https://www.uniprot.org/uniprot/O43808" } ], "pmid": "" }, { "name": "fatty acid alpha-oxidation", "id": "GO:0001561", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001561", "evidence": [ { "database": "UniProtKB", "id": "O43808", "url": "https://www.uniprot.org/uniprot/O43808" } ], "pmid": "" }, { "name": "ATP transport", "id": "GO:0015867", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015867", "evidence": [ { "database": "UniProtKB", "id": "O43808", "url": "https://www.uniprot.org/uniprot/O43808" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 167, "end_pos": 169, "annotation": "n_glycosylation_sequon" }, { "start_pos": 241, "end_pos": 243, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "65424", "name": "", "equation": "AMP(in) + NAD(+)(out) = AMP(out) + NAD(+)(in)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "65424", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/65424" } ] }, { "id": "72839", "name": "", "equation": "ADP(out) + CoA(in) = ADP(in) + CoA(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "72839", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/72839" } ] }, { "id": "72847", "name": "", "equation": "adenosine 3',5'-bisphosphate(in) + ADP(out) = adenosine 3',5'-bisphosphate(out) + ADP(in)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "72847", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/72847" } ] }, { "id": "72851", "name": "", "equation": "ADP(out) + AMP(in) = ADP(in) + AMP(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "72851", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/72851" } ] }, { "id": "73087", "name": "", "equation": "AMP(out) + FAD(in) = AMP(in) + FAD(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "73087", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/73087" } ] }, { "id": "73091", "name": "", "equation": "AMP(out) + FMN(in) = AMP(in) + FMN(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "73091", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/73091" } ] }, { "id": "73095", "name": "", "equation": "AMP(out) + CoA(in) = AMP(in) + CoA(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "73095", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/73095" } ] }, { "id": "73099", "name": "", "equation": "3'-dephospho-CoA(in) + AMP(out) = 3'-dephospho-CoA(out) + AMP(in)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "73099", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/73099" } ] }, { "id": "73143", "name": "", "equation": "CoA(out) + FAD(in) = CoA(in) + FAD(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "73143", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/73143" } ] }, { "id": "73147", "name": "", "equation": "adenosine 3',5'-bisphosphate(out) + FAD(in) = adenosine 3',5'-bisphosphate(in) + FAD(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "73147", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/73147" } ] }, { "id": "73151", "name": "", "equation": "CoA(out) + FMN(in) = CoA(in) + FMN(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "73151", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/73151" } ] }, { "id": "73155", "name": "", "equation": "adenosine 3',5'-bisphosphate(out) + FMN(in) = adenosine 3',5'-bisphosphate(in) + FMN(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "73155", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/73155" } ] }, { "id": "73159", "name": "", "equation": "FMN(out) + NAD(+)(in) = FMN(in) + NAD(+)(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "73159", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/73159" } ] }, { "id": "73163", "name": "", "equation": "FAD(out) + NAD(+)(in) = FAD(in) + NAD(+)(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "73163", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/73163" } ] }, { "id": "73167", "name": "", "equation": "CoA(out) + NAD(+)(in) = CoA(in) + NAD(+)(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "73167", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/73167" } ] }, { "id": "73171", "name": "", "equation": "adenosine 3',5'-bisphosphate(out) + NAD(+)(in) = adenosine 3',5'-bisphosphate(in) + NAD(+)(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "73171", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/73171" } ] }, { "id": "73175", "name": "", "equation": "ADP(in) + FMN(out) = ADP(out) + FMN(in)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "73175", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/73175" } ] }, { "id": "73183", "name": "", "equation": "ADP(in) + FAD(out) = ADP(out) + FAD(in)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "73183", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/73183" } ] }, { "id": "73447", "name": "", "equation": "acetyl-CoA(in) + AMP(out) = acetyl-CoA(out) + AMP(in)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "73447", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/73447" } ] }, { "id": "73451", "name": "", "equation": "adenosine 3',5'-bisphosphate(in) + AMP(out) = adenosine 3',5'-bisphosphate(out) + AMP(in)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [], "evidence": [ { "id": "73451", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/73451" } ] } ], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 167, "end_pos": 169 }, { "start_pos": 241, "end_pos": 243 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 49 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }