{ "uniprot_canonical_ac": "O43663-1", "uniprot_ac": "O43663", "uniprot_id": "PRC1_HUMAN", "mass": { "chemical_mass": 71607.0, "monoisotopic_mass": 71607.0 }, "refseq": { "ac": "NP_001254509", "name": "protein regulator of cytokinesis 1 isoform 4", "summary": "This gene encodes a protein that is involved in cytokinesis. The protein is present at high levels during the S and G2/M phases of mitosis but its levels drop dramatically when the cell exits mitosis and enters the G1 phase. It is located in the nucleus during interphase, becomes associated with mitotic spindles in a highly dynamic manner during mitosis, and localizes to the cell mid-body during cytokinesis. This protein has been shown to be a substrate of several cyclin-dependent kinases (CDKs). It is necessary for polarizing parallel microtubules and concentrating the factors responsible for contractile ring assembly. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2012].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001254509" }, "gene_names": [ { "name": "PRC1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O43663", "id": "O43663" }, { "name": "ASE1; MAP65", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001254509", "id": "NP_001254509" }, { "name": "PRC1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001254509", "id": "NP_001254509" } ], "protein_names": [ { "name": "Protein regulator of cytokinesis 1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O43663" }, { "name": "protein regulating cytokinesis 1; anaphase spindle elongation 1 homolog", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001254509", "id": "NP_001254509" }, { "name": "protein regulator of cytokinesis 1 isoform 4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001254509", "id": "NP_001254509" } ], "function": [ { "annotation": "CircKDM1B promotes hepatocellular carcinoma progression through regulating miR-1322/PRC1 axis.", "evidence": [ { "database": "RefSeq", "id": "NP_001254509", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001254509" }, { "database": "PubMed", "id": "37227723", "url": "https://glygen.org/publication/PubMed/37227723" } ] }, { "annotation": "Contributes to the correct formation of the spindle during the metaphase", "evidence": [ { "database": "RefSeq", "id": "NP_001254509", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001254509" }, { "database": "PubMed", "id": "14744859", "url": "https://glygen.org/publication/PubMed/14744859" } ] }, { "annotation": "Genetic associations of TMEM154, PRC1 and ZFAND6 loci with type 2 diabetes in an endogamous business community of North India. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001254509", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001254509" }, { "database": "PubMed", "id": "37738238", "url": "https://glygen.org/publication/PubMed/37738238" } ] }, { "annotation": "Key regulator of cytokinesis that cross-links antiparrallel microtubules at an average distance of 35 nM. Essential for controlling the spatiotemporal formation of the midzone and successful cytokinesis. Required for KIF14 localization to the central spindle and midbody. Required to recruit PLK1 to the spindle. Stimulates PLK1 phosphorylation of RACGAP1 to allow recruitment of ECT2 to the central spindle. Acts as an oncogene for promoting bladder cancer cells proliferation, apoptosis inhibition and carcinogenic progression (PubMed:17409436).", "evidence": [ { "database": "UniProtKB", "id": "O43663", "url": "https://www.uniprot.org/uniprot/O43663#function" }, { "database": "PubMed", "id": "15297875", "url": "https://glygen.org/publication/PubMed/15297875" }, { "database": "PubMed", "id": "12082078", "url": "https://glygen.org/publication/PubMed/12082078" }, { "database": "PubMed", "id": "16431929", "url": "https://glygen.org/publication/PubMed/16431929" }, { "database": "PubMed", "id": "20691902", "url": "https://glygen.org/publication/PubMed/20691902" }, { "database": "PubMed", "id": "15625105", "url": "https://glygen.org/publication/PubMed/15625105" }, { "database": "PubMed", "id": "19468300", "url": "https://glygen.org/publication/PubMed/19468300" }, { "database": "PubMed", "id": "9885575", "url": "https://glygen.org/publication/PubMed/9885575" }, { "database": "PubMed", "id": "17409436", "url": "https://glygen.org/publication/PubMed/17409436" } ] }, { "annotation": "Kinesin family member 4 and its binding partner PRC1 play essential roles in the organization of central spindles and midzone formation", "evidence": [ { "database": "RefSeq", "id": "NP_001254509", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001254509" }, { "database": "PubMed", "id": "15297875", "url": "https://glygen.org/publication/PubMed/15297875" } ] }, { "annotation": "PRC1 is a microtubule-associated protein required to maintain the spindle midzone, and that distinct functions are associated with modular elements of the primary sequence.", "evidence": [ { "database": "RefSeq", "id": "NP_001254509", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001254509" }, { "database": "PubMed", "id": "12082078", "url": "https://glygen.org/publication/PubMed/12082078" } ] }, { "annotation": "PRC1 plays an important role in lung adenocarcinoma and is potentially targeted by fostamatinib.", "evidence": [ { "database": "RefSeq", "id": "NP_001254509", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001254509" }, { "database": "PubMed", "id": "36524512", "url": "https://glygen.org/publication/PubMed/36524512" } ] }, { "annotation": "Phosphorylation controls spatial and temporal activities of motor-PRC1 complexes to complete mitosis.", "evidence": [ { "database": "RefSeq", "id": "NP_001254509", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001254509" }, { "database": "PubMed", "id": "37592895", "url": "https://glygen.org/publication/PubMed/37592895" } ] }, { "annotation": "Protein regulator of cytokinesis 1: a potential oncogenic driver. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001254509", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001254509" }, { "database": "PubMed", "id": "37563591", "url": "https://glygen.org/publication/PubMed/37563591" } ] }, { "annotation": "This gene encodes a protein that is involved in cytokinesis. The protein is present at high levels during the S and G2/M phases of mitosis but its levels drop dramatically when the cell exits mitosis and enters the G1 phase. It is located in the nucleus during interphase, becomes associated with mitotic spindles in a highly dynamic manner during mitosis, and localizes to the cell mid-body during cytokinesis. This protein has been shown to be a substrate of several cyclin-dependent kinases (CDKs). It is necessary for polarizing parallel microtubules and concentrating the factors responsible for contractile ring assembly. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2012].", "evidence": [ { "database": "RefSeq", "id": "NP_001254509", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001254509" } ] } ], "disease": [], "snv": [], "mutagenesis": [ { "start_pos": 470, "end_pos": 470, "sequence_org": "T", "sequence_mut": "A", "comment": "No effect. Abolishes CDK1-mediated phosphorylation, leading to prematurely recruit PLK1 to the spindle during prometaphase and blocking mitotic progression; when associated with A-481.", "evidence": [ { "database": "UniProtKB", "id": "O43663", "url": "https://www.uniprot.org/uniprot/O43663" }, { "database": "PubMed", "id": "17351640", "url": "https://glygen.org/publication/PubMed/17351640" }, { "database": "PubMed", "id": "12082078", "url": "https://glygen.org/publication/PubMed/12082078" }, { "database": "PubMed", "id": "9885575", "url": "https://glygen.org/publication/PubMed/9885575" } ] }, { "start_pos": 481, "end_pos": 481, "sequence_org": "T", "sequence_mut": "A", "comment": "No effect. Reduces in vitro cyclin E-CDK2 phosphorylation and causes extensive bundling of microtubules to the mitotic spindle; when associated with A-470.", "evidence": [ { "database": "UniProtKB", "id": "O43663", "url": "https://www.uniprot.org/uniprot/O43663" }, { "database": "PubMed", "id": "17351640", "url": "https://glygen.org/publication/PubMed/17351640" }, { "database": "PubMed", "id": "12082078", "url": "https://glygen.org/publication/PubMed/12082078" }, { "database": "PubMed", "id": "9885575", "url": "https://glygen.org/publication/PubMed/9885575" } ] }, { "start_pos": 577, "end_pos": 578, "sequence_org": "ST", "sequence_mut": "AA", "comment": "Weakly reduces binding to the POLO box domains of PLK1.", "evidence": [ { "database": "UniProtKB", "id": "O43663", "url": "https://www.uniprot.org/uniprot/O43663" }, { "database": "PubMed", "id": "17351640", "url": "https://glygen.org/publication/PubMed/17351640" } ] }, { "start_pos": 615, "end_pos": 616, "sequence_org": "ST", "sequence_mut": "AA", "comment": "Impairs binding to the POLO box domains of PLK1, preventing phosphorylation by PLK1 and recruitment of PLK1 to the spindle.", "evidence": [ { "database": "UniProtKB", "id": "O43663", "url": "https://www.uniprot.org/uniprot/O43663" }, { "database": "PubMed", "id": "17351640", "url": "https://glygen.org/publication/PubMed/17351640" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "60.68", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000198901", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198901" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "77.74", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000198901", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198901" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "75.66", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000198901", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198901" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "49.96", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000198901", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198901" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "80.93", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000198901", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198901" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "91.53", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000198901", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198901" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "78.65", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000198901", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198901" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "64.11", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000198901", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198901" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "73.79", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000198901", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198901" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "56.05", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000198901", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198901" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "64.94", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000198901", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198901" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "79.79", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000198901", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198901" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "82.49", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000198901", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198901" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O43663", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43663" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O43663", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43663" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O43663", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43663" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O43663", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43663" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O43663", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43663" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O43663", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43663" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O43663", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43663" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O43663", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43663" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O43663", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43663" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O43663", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43663" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O43663", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43663" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O43663", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43663" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O43663", "url": "https://www.uniprot.org/uniprot/O43663" } ], "common_name": "Human" } ], "gene": [ { "name": "PRC1", "url": "https://www.uniprot.org/uniprot/O43663", "locus": { "chromosome": "15", "start_pos": 90966040, "end_pos": 90995629, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000198901", "url": "https://www.ensembl.org/id/ENSG00000198901" } ] } } ], "crossref": [ { "id": "ENSG00000198901", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000198901", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "PRC1", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=PRC1", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "9055", "url": "https://www.ncbi.nlm.nih.gov/gene/9055", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "9341", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=9341", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O43663", "url": "https://www.ebi.ac.uk/intact/interactors/id:O43663*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR007145", "url": "https://www.ebi.ac.uk/interpro/entry/IPR007145", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:9055", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:9055", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "603484", "url": "http://www.omim.org/entry/603484", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O43663", "url": "https://www.nextprot.org/entry/NX_O43663", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "O43663", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O43663", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "KIPPRSK", "url": "https://omabrowser.org/oma/group/KIPPRSK/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "619921at2759", "url": "http://www.orthodb.org/?query=619921at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR19321", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR19321", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR19321:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR19321:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "3NRX", "url": "https://www.rcsb.org/structure/3NRX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3NRY", "url": "https://www.rcsb.org/structure/3NRY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4L3I", "url": "https://www.rcsb.org/structure/4L3I", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4L6Y", "url": "https://www.rcsb.org/structure/4L6Y", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5KMG", "url": "https://www.rcsb.org/structure/5KMG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7VBG", "url": "https://www.rcsb.org/structure/7VBG", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF03999", "url": "http://pfam.xfam.org/family/PF03999", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O43663", "url": "https://pharos.nih.gov/targets/O43663", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O43663", "url": "http://purl.obolibrary.org/obo/PR_O43663", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-5625900", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625900", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001254509", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001254509", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "G3V3N7", "url": "https://www.uniprot.org/uniprot/G3V3N7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "G3V3N7-1", "url": "https://www.uniprot.org/uniprot/G3V3N7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YL53", "url": "https://www.uniprot.org/uniprot/H0YL53", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YL53-1", "url": "https://www.uniprot.org/uniprot/H0YL53-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YLA0", "url": "https://www.uniprot.org/uniprot/H0YLA0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YLA0-1", "url": "https://www.uniprot.org/uniprot/H0YLA0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YM42", "url": "https://www.uniprot.org/uniprot/H0YM42", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YM42-1", "url": "https://www.uniprot.org/uniprot/H0YM42-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YNE4", "url": "https://www.uniprot.org/uniprot/H0YNE4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YNE4-1", "url": "https://www.uniprot.org/uniprot/H0YNE4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H3BSJ8", "url": "https://www.uniprot.org/uniprot/H3BSJ8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H3BSJ8-1", "url": "https://www.uniprot.org/uniprot/H3BSJ8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O43663", "url": "https://www.uniprot.org/uniprot/O43663", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O43663-1", "url": "https://www.uniprot.org/uniprot/O43663-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O43663-2", "url": "https://www.uniprot.org/uniprot/O43663-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O43663-3", "url": "https://www.uniprot.org/uniprot/O43663-3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O43663-4", "url": "https://www.uniprot.org/uniprot/O43663-4", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MRRSEVLAEESIVCLQKALNHLREIWELIGIPEDQRLQRTEVVKKHIKELLDMMIAEEESLKERLIKSISVCQKELNTLCSELHVEPFQEEGETTILQLEKDLRTQVELMRKQKKERKQELKLLQEQDQELCEILCMPHYDIDSASVPSLEELNQFRQHVTTLRETKASRREEFVSIKRQIILCMEALDHTPDTSFERDVVCEDEDAFCLSLENIATLQKLLRQLEMQKSQNEAVCEGLRTQIRELWDRLQIPEEEREAVATIMSGSKAKVRKALQLEVDRLEELKMQNMKKVIEAIRVELVQYWDQCFYSQEQRQAFAPFCAEDYTESLLQLHDAEIVRLKNYYEVHKELFEGVQKWEETWRLFLEFERKASDPNRFTNRGGNLLKEEKQRAKLQKMLPKLEEELKARIELWEQEHSKAFMVNGQKFMEYVAEQWEMHRLEKERAKQERQLKNKKQTETEMLYGSAPRTPSKRRGLAPNTPGKARKLNTTTMSNATANSSIRPIFGGTVYHSPVSRLPPSGSKPVAASTCSGKKTPRTGRHGANKENLELNGSILSGGYPGSAPLQRNFSINSVASTYSEFAKDPSLSDSSTVGLQRELSKASKSDATSGILNSTNIQS", "length": 620, "header": "sp|O43663-1|PRC1_HUMAN Isoform 1 of Protein regulator of cytokinesis 1 OS=Homo sapiens OX=9606 GN=PRC1 PE=1 SV=2 CANONICAL=O43663-1" }, "isoforms": [ { "isoform_ac": "G3V3N7-1", "url": "", "sequence": { "sequence": "XLLKEEKQRAKLQKMLPKLEEELKARIELWEQEHSKAFMVNGQKFMEYVAEQWEMHRLEKERAKQERQLKNKKQTETEMLYGSAPRTPSKRRGLAPNTPGKARKLNTTTMSNATANSSIRPIFGGTVYHSPVSRLPPSGSKPVAASTCSGKKTPRTGRHGANKENLELNGSILSGGYPGSAPLQRNFSINSVASTYSEFAKDPSLSDSSTVGLQDSLPPEENVFVCPKLRWPALLPKR", "length": 238, "header": "tr|G3V3N7-1|PRC1_HUMAN Computationally mapped isoform of Protein regulator of cytokinesis 1 OS=Homo sapiens OX=9606 GN=PRC1 PE=1 SV=2 CANONICAL=O43663-1" }, "locus": { "chromosome": "15", "start_pos": 90976728, "end_pos": 90966581, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000555455.5", "url": "https://www.ensembl.org/id/ENST00000555455.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000451344.1", "url": "https://www.ensembl.org/id/ENSP00000451344.1" } ] } }, { "isoform_ac": "H0YL53-1", "url": "", "sequence": { "sequence": "XYSQEQRQAFAPFCAEDYTESLLQLHDAEIVRLKNYYEVHKELFEGVQKWEETWRLFLEFERKASDPNRFTNRGGNLLKEEKQRAKLQKMLPKLEEELKARIELWEQEHSKAFMVNGQKFMEYVAEQWEMHRLEKERAKQERQLKNKKQTETEMLYGSAPRTPSKRRGLAPNTPGKARKPVAASTCSGKKTPRTG", "length": 195, "header": "tr|H0YL53-1|H0YL53_HUMAN Computationally mapped isoform of Protein regulator of cytokinesis 1 OS=Homo sapiens OX=9606 GN=PRC1 PE=1 SV=1 CANONICAL=O43663-1" }, "locus": { "chromosome": "15", "start_pos": 90980286, "end_pos": 90969576, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000559828.1", "url": "https://www.ensembl.org/id/ENST00000559828.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000453063.1", "url": "https://www.ensembl.org/id/ENSP00000453063.1" } ] } }, { "isoform_ac": "H0YLA0-1", "url": "", "sequence": { "sequence": "MRRSEVLAEESIVCLQKALNHLREIWELIGIPEDQRLQRTEVVKKHIKELLDMMIAEEESLKERLIKSISVCQKELNTLCSELHVEPFQEFTWNLITVVRCLIQEEGETT", "length": 110, "header": "tr|H0YLA0-1|H0YLA0_HUMAN Computationally mapped isoform of Protein regulator of cytokinesis 1 OS=Homo sapiens OX=9606 GN=PRC1 PE=1 SV=1 CANONICAL=O43663-1" }, "locus": { "chromosome": "15", "start_pos": 90994417, "end_pos": 90981964, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000559811.1", "url": "https://www.ensembl.org/id/ENST00000559811.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000453117.1", "url": "https://www.ensembl.org/id/ENSP00000453117.1" } ] } }, { "isoform_ac": "H0YM42-1", "url": "", "sequence": { "sequence": "MRRSEVLAEESIVCLQKALNHLREIWELIGIPEDQRLQRTEVVKKHIKEEGETTILQLEKDLRTQVELMRKQKKERKQELKLLQEQDQELCEILCMPHYDIDSASVPSLEELNQFRQHVTTLRETKASRREEFVSIKRQIILCMEALDHTPDTS", "length": 154, "header": "tr|H0YM42-1|H0YM42_HUMAN Computationally mapped isoform of Protein regulator of cytokinesis 1 OS=Homo sapiens OX=9606 GN=PRC1 PE=1 SV=1 CANONICAL=O43663-1" }, "locus": { "chromosome": "15", "start_pos": 90994417, "end_pos": 90981586, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000557905.5", "url": "https://www.ensembl.org/id/ENST00000557905.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000453455.1", "url": "https://www.ensembl.org/id/ENSP00000453455.1" } ] } }, { "isoform_ac": "H0YNE4-1", "url": "", "sequence": { "sequence": "XSIRPIFGGTVYHSPVSRLPPSGSKPVAASTCSGKKTPRTGRHGANKENLELNGSILSEGSVPL", "length": 64, "header": "tr|H0YNE4-1|H0YNE4_HUMAN Computationally mapped isoform of Protein regulator of cytokinesis 1 OS=Homo sapiens OX=9606 GN=PRC1 PE=1 SV=1 CANONICAL=O43663-1" }, "locus": { "chromosome": "15", "start_pos": 90970477, "end_pos": 90969103, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000560423.5", "url": "https://www.ensembl.org/id/ENST00000560423.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000453977.1", "url": "https://www.ensembl.org/id/ENSP00000453977.1" } ] } }, { "isoform_ac": "H3BSJ8-1", "url": "", "sequence": { "sequence": "RLPPSGSKPVAASTCSGKKTPRTGRHGANKENLELNGSILSGQPSS", "length": 46, "header": "tr|H3BSJ8-1|PRC1_HUMAN Computationally mapped isoform of Protein regulator of cytokinesis 1 OS=Homo sapiens OX=9606 GN=PRC1 PE=1 SV=1 CANONICAL=O43663-1" }, "locus": { "chromosome": "15", "start_pos": 90970427, "end_pos": 90966640, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000556972.6", "url": "https://www.ensembl.org/id/ENST00000556972.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000456737.1", "url": "https://www.ensembl.org/id/ENSP00000456737.1" } ] } }, { "isoform_ac": "O43663-1", "url": "", "sequence": { "sequence": "MRRSEVLAEESIVCLQKALNHLREIWELIGIPEDQRLQRTEVVKKHIKELLDMMIAEEESLKERLIKSISVCQKELNTLCSELHVEPFQEEGETTILQLEKDLRTQVELMRKQKKERKQELKLLQEQDQELCEILCMPHYDIDSASVPSLEELNQFRQHVTTLRETKASRREEFVSIKRQIILCMEALDHTPDTSFERDVVCEDEDAFCLSLENIATLQKLLRQLEMQKSQNEAVCEGLRTQIRELWDRLQIPEEEREAVATIMSGSKAKVRKALQLEVDRLEELKMQNMKKVIEAIRVELVQYWDQCFYSQEQRQAFAPFCAEDYTESLLQLHDAEIVRLKNYYEVHKELFEGVQKWEETWRLFLEFERKASDPNRFTNRGGNLLKEEKQRAKLQKMLPKLEEELKARIELWEQEHSKAFMVNGQKFMEYVAEQWEMHRLEKERAKQERQLKNKKQTETEMLYGSAPRTPSKRRGLAPNTPGKARKLNTTTMSNATANSSIRPIFGGTVYHSPVSRLPPSGSKPVAASTCSGKKTPRTGRHGANKENLELNGSILSGGYPGSAPLQRNFSINSVASTYSEFAKDPSLSDSSTVGLQRELSKASKSDATSGILNSTNIQS", "length": 620, "header": "sp|O43663-1|PRC1_HUMAN Isoform 1 of Protein regulator of cytokinesis 1 OS=Homo sapiens OX=9606 GN=PRC1 PE=1 SV=2 CANONICAL=O43663-1" }, "locus": { "chromosome": "15", "start_pos": 90994417, "end_pos": 90967134, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000394249.8", "url": "https://www.ensembl.org/id/ENST00000394249.8" }, { "database": "Ensembl Peptide", "id": "ENSP00000377793.3", "url": "https://www.ensembl.org/id/ENSP00000377793.3" } ] } }, { "isoform_ac": "O43663-2", "url": "", "sequence": { "sequence": "MRRSEVLAEESIVCLQKALNHLREIWELIGIPEDQRLQRTEVVKKHIKELLDMMIAEEESLKERLIKSISVCQKELNTLCSELHVEPFQEEGETTILQLEKDLRTQVELMRKQKKERKQELKLLQEQDQELCEILCMPHYDIDSASVPSLEELNQFRQHVTTLRETKASRREEFVSIKRQIILCMEALDHTPDTSFERDVVCEDEDAFCLSLENIATLQKLLRQLEMQKSQNEAVCEGLRTQIRELWDRLQIPEEEREAVATIMSGSKAKVRKALQLEVDRLEELKMQNMKKVIEAIRVELVQYWDQCFYSQEQRQAFAPFCAEDYTESLLQLHDAEIVRLKNYYEVHKELFEGVQKWEETWRLFLEFERKASDPNRFTNRGGNLLKEEKQRAKLQKFMEYVAEQWEMHRLEKERAKQERQLKNKKQTETEMLYGSAPRTPSKRRGLAPNTPGKARKLNTTTMSNATANSSIRPIFGGTVYHSPVSRLPPSGSKPVAASTCSGKKTPRTGRHGANKENLELNGSILSGGYPGSAPLQRNFSINSVASTYSEFARELSKASKSDATSGILNSTNIQS", "length": 576, "header": "sp|O43663-2|PRC1_HUMAN Isoform 2 of Protein regulator of cytokinesis 1 OS=Homo sapiens OX=9606 GN=PRC1 PE=1 SV=2 CANONICAL=O43663-1" }, "locus": {} }, { "isoform_ac": "O43663-3", "url": "", "sequence": { "sequence": "MRRSEVLAEESIVCLQKALNHLREIWELIGIPEDQRLQRTEVVKKHIKEEGETTILQLEKDLRTQVELMRKQKKERKQELKLLQEQDQELCEILCMPHYDIDSASVPSLEELNQFRQHVTTLRETKASRREEFVSIKRQIILCMEALDHTPDTSFERDVVCEDEDAFCLSLENIATLQKLLRQLEMQKSQNEAVCEGLRTQIRELWDRLQIPEEEREAVATIMSGSKAKVRKALQLEVDRLEELKMQNMKKVIEAIRVELVQYWDQCFYSQEQRQAFAPFCAEDYTESLLQLHDAEIVRLKNYYEVHKELFEGVQKWEETWRLFLEFERKASDPNRFTNRGGNLLKEEKQRAKLQKMLPKLEEELKARIELWEQEHSKAFMVNGQKFMEYVAEQWEMHRLEKERAKQERQLKNKKQTETEMLYGSAPRTPSKRRGLAPNTPGKARKLNTTTMSNATANSSIRPIFGGTVYHSPVSRLPPSGSKPVAASTCSGKKTPRTGRHGANKENLELNGSILSARTFKGFQI", "length": 525, "header": "sp|O43663-3|PRC1_HUMAN Isoform 3 of Protein regulator of cytokinesis 1 OS=Homo sapiens OX=9606 GN=PRC1 PE=1 SV=2 CANONICAL=O43663-1" }, "locus": { "chromosome": "15", "start_pos": 90994417, "end_pos": 90967177, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000442656.6", "url": "https://www.ensembl.org/id/ENST00000442656.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000409549.2", "url": "https://www.ensembl.org/id/ENSP00000409549.2" } ] } }, { "isoform_ac": "O43663-4", "url": "", "sequence": { "sequence": "MRRSEVLAEESIVCLQKALNHLREIWELIGIPEDQRLQRTEVVKKHIKELLDMMIAEEESLKERLIKSISVCQKELNTLCSELHVEPFQEEGETTILQLEKDLRTQVELMRKQKKERKQELKLLQEQDQELCEILCMPHYDIDSASVPSLEELNQFRQHVTTLRETKASRREEFVSIKRQIILCMEALDHTPDTSFERDVVCEDEDAFCLSLENIATLQKLLRQLEMQKSQNEAVCEGLRTQIRELWDRLQIPEEEREAVATIMSGSKAKVRKALQLEVDRLEELKMQNMKKVIEAIRVELVQYWDQCFYSQEQRQAFAPFCAEDYTESLLQLHDAEIVRLKNYYEVHKELFEGVQKWEETWRLFLEFERKASDPNRFTNRGGNLLKEEKQRAKLQKMLPKLEEELKARIELWEQEHSKAFMVNGQKFMEYVAEQWEMHRLEKERAKQERQLKNKKQTETEMLYGSAPRTPSKRRGLAPNTPGKARKLNTTTMSNATANSSIRPIFGGTVYHSPVSRLPPSGSKPVAASTCSGKKTPRTGRHGANKENLELNGSILSGGYPGSAPLQRNFSINSVASTYSEFARELSKASKSDATSGILNSTNIQS", "length": 606, "header": "sp|O43663-4|PRC1_HUMAN Isoform 4 of Protein regulator of cytokinesis 1 OS=Homo sapiens OX=9606 GN=PRC1 PE=1 SV=2 CANONICAL=O43663-1" }, "locus": { "chromosome": "15", "start_pos": 90994417, "end_pos": 90967134, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000361188.9", "url": "https://www.ensembl.org/id/ENST00000361188.9" }, { "database": "Ensembl Peptide", "id": "ENSP00000354679.5", "url": "https://www.ensembl.org/id/ENSP00000354679.5" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "O43663", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O43663" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" } ] } ], "phosphorylation": [ { "start_pos": 191, "end_pos": 191, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O43663", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43663" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ], "site_lbl": "Thr191" }, { "start_pos": 194, "end_pos": 194, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O43663", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43663" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Thr194" }, { "start_pos": 195, "end_pos": 195, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O43663", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43663" }, { "database": "PubMed", "id": "16565220", "url": "https://glygen.org/publication/PubMed/16565220" }, { "database": "phospho.ELM", "id": "O43663", "url": "http://phospho.elm.eu.org/byAccession/O43663.html" } ], "site_lbl": "Ser195" }, { "start_pos": 265, "end_pos": 265, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O43663", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43663" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser265" }, { "start_pos": 267, "end_pos": 267, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O43663", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43663" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" } ], "site_lbl": "Ser267" }, { "start_pos": 464, "end_pos": 464, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O43663", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43663" }, { "database": "PubMed", "id": "33510346", "url": "https://glygen.org/publication/PubMed/33510346" } ], "site_lbl": "Tyr464" }, { "start_pos": 470, "end_pos": 470, "kinase_uniprot_canonical_ac": "P24941-1", "kinase_gene_name": "CDK2", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O43663", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43663" }, { "database": "PubMed", "id": "20068230", "url": "https://glygen.org/publication/PubMed/20068230" }, { "database": "PubMed", "id": "9885575", "url": "https://glygen.org/publication/PubMed/9885575" } ], "site_lbl": "Thr470" }, { "start_pos": 470, "end_pos": 470, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by CDK1", "evidence": [ { "database": "UniProtKB", "id": "O43663", "url": "https://www.uniprot.org/uniprot/O43663" }, { "database": "iPTMnet", "id": "O43663", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43663" }, { "database": "PubMed", "id": "9885575", "url": "https://glygen.org/publication/PubMed/9885575" }, { "database": "PubMed", "id": "17438553", "url": "https://glygen.org/publication/PubMed/17438553" }, { "database": "PubMed", "id": "22621898", "url": "https://glygen.org/publication/PubMed/22621898" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "17351640", "url": "https://glygen.org/publication/PubMed/17351640" } ], "site_lbl": "Thr470" }, { "start_pos": 481, "end_pos": 481, "kinase_uniprot_canonical_ac": "P24941-1", "kinase_gene_name": "CDK2", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O43663", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43663" }, { "database": "PubMed", "id": "18212344", "url": "https://glygen.org/publication/PubMed/18212344" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "PubMed", "id": "9885575", "url": "https://glygen.org/publication/PubMed/9885575" } ], "site_lbl": "Thr481" }, { "start_pos": 481, "end_pos": 481, "kinase_uniprot_canonical_ac": "Q00536-1", "kinase_gene_name": "CDK16", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O43663", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43663" }, { "database": "PubMed", "id": "35449080", "url": "https://glygen.org/publication/PubMed/35449080" } ], "site_lbl": "Thr481" }, { "start_pos": 481, "end_pos": 481, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by CDK1", "evidence": [ { "database": "UniProtKB", "id": "O43663", "url": "https://www.uniprot.org/uniprot/O43663" }, { "database": "iPTMnet", "id": "O43663", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43663" }, { "database": "PubMed", "id": "16603632", "url": "https://glygen.org/publication/PubMed/16603632" }, { "database": "PubMed", "id": "9885575", "url": "https://glygen.org/publication/PubMed/9885575" }, { "database": "phospho.ELM", "id": "O43663", "url": "http://phospho.elm.eu.org/byAccession/O43663.html" }, { "database": "PubMed", "id": "16964243", "url": "https://glygen.org/publication/PubMed/16964243" }, { "database": "PubMed", "id": "17438553", "url": "https://glygen.org/publication/PubMed/17438553" }, { "database": "PubMed", "id": "17512944", "url": "https://glygen.org/publication/PubMed/17512944" }, { "database": "PubMed", "id": "22621898", "url": "https://glygen.org/publication/PubMed/22621898" }, { "database": "PubMed", "id": "23940115", "url": "https://glygen.org/publication/PubMed/23940115" }, { "database": "PubMed", "id": "26423135", "url": "https://glygen.org/publication/PubMed/26423135" }, { "database": "PubMed", "id": "30992425", "url": "https://glygen.org/publication/PubMed/30992425" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "17351640", "url": "https://glygen.org/publication/PubMed/17351640" } ], "site_lbl": "Thr481" }, { "start_pos": 501, "end_pos": 501, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O43663", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43663" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" } ], "site_lbl": "Ser501" }, { "start_pos": 513, "end_pos": 513, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O43663", "url": "https://www.uniprot.org/uniprot/O43663" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "iPTMnet", "id": "O43663", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43663" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" } ], "site_lbl": "Ser513" }, { "start_pos": 536, "end_pos": 536, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O43663", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43663" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Thr536" }, { "start_pos": 541, "end_pos": 541, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Arg", "comment": "", "evidence": [ { "database": "UniProtKB", "id": "O43663", "url": "https://www.uniprot.org/uniprot/O43663" }, { "database": "iPTMnet", "id": "O43663", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43663" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ], "site_lbl": "Arg541" }, { "start_pos": 560, "end_pos": 560, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O43663", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43663" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Tyr560" }, { "start_pos": 571, "end_pos": 571, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O43663", "url": "https://www.uniprot.org/uniprot/O43663" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "iPTMnet", "id": "O43663", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43663" } ], "site_lbl": "Ser571" }, { "start_pos": 578, "end_pos": 578, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "O43663", "url": "https://www.uniprot.org/uniprot/O43663" }, { "database": "PubMed", "id": "17351640", "url": "https://glygen.org/publication/PubMed/17351640" }, { "database": "iPTMnet", "id": "O43663", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43663" } ], "site_lbl": "Thr578" }, { "start_pos": 587, "end_pos": 587, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O43663", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43663" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" } ], "site_lbl": "Ser587" }, { "start_pos": 589, "end_pos": 589, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O43663", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43663" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" } ], "site_lbl": "Ser589" }, { "start_pos": 592, "end_pos": 592, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O43663", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43663" }, { "database": "PubMed", "id": "16565220", "url": "https://glygen.org/publication/PubMed/16565220" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" }, { "database": "phospho.ELM", "id": "O43663", "url": "http://phospho.elm.eu.org/byAccession/O43663.html" } ], "site_lbl": "Ser592" }, { "start_pos": 615, "end_pos": 615, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O43663", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43663" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" } ], "site_lbl": "Ser615" }, { "start_pos": 616, "end_pos": 616, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by PLK1", "evidence": [ { "database": "UniProtKB", "id": "O43663", "url": "https://www.uniprot.org/uniprot/O43663" }, { "database": "iPTMnet", "id": "O43663", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43663" }, { "database": "PubMed", "id": "17351640", "url": "https://glygen.org/publication/PubMed/17351640" } ], "site_lbl": "Thr616" }, { "start_pos": 620, "end_pos": 620, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O43663", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43663" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" } ], "site_lbl": "Ser620" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "PRC1 is a microtubule binding and bundling protein essential to maintain the mitotic spindle midzone.", "journal": "The Journal of cell biology", "date": "2002", "authors": "Mollinari C, Kleman JP, Jiang W, Schoehn G, Hunter T, Margolis RL", "evidence": [ { "database": "UniProtKB", "id": "O43663", "url": "https://www.uniprot.org/uniprot/O43663" }, { "database": "RefSeq", "id": "NP_001254509", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001254509" } ], "reference": [ { "type": "PubMed", "id": "12082078", "url": "https://glygen.org/publication/PubMed/12082078" } ] }, { "title": "Citron kinase, a Rho-dependent kinase, induces di-phosphorylation of regulatory light chain of myosin II.", "journal": "Molecular biology of the cell", "date": "2003", "authors": "Yamashiro S, Totsukawa G, Yamakita Y, Sasaki Y, Madaule P, Ishizaki T, Narumiya S, Matsumura F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625900", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625900" } ], "reference": [ { "type": "PubMed", "id": "12802051", "url": "https://glygen.org/publication/PubMed/12802051" } ] }, { "title": "Human mitotic spindle-associated protein PRC1 inhibits MgcRacGAP activity toward Cdc42 during the metaphase.", "journal": "J. Biol. Chem.", "date": "2004", "authors": "Ban R, Irino Y, Fukami K, Tanaka H", "evidence": [ { "database": "UniProtKB", "id": "O43663", "url": "https://www.uniprot.org/uniprot/O43663" }, { "database": "RefSeq", "id": "NP_001254509", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001254509" } ], "reference": [ { "type": "PubMed", "id": "14744859", "url": "https://glygen.org/publication/PubMed/14744859" } ] }, { "title": "Essential roles of KIF4 and its binding partner PRC1 in organized central spindle midzone formation.", "journal": "The EMBO journal", "date": "2004", "authors": "Kurasawa Y, Earnshaw WC, Mochizuki Y, Dohmae N, Todokoro K", "evidence": [ { "database": "UniProtKB", "id": "O43663", "url": "https://www.uniprot.org/uniprot/O43663" }, { "database": "RefSeq", "id": "NP_001254509", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001254509" } ], "reference": [ { "type": "PubMed", "id": "15297875", "url": "https://glygen.org/publication/PubMed/15297875" } ] }, { "title": "Cell cycle-dependent translocation of PRC1 on the spindle by Kif4 is essential for midzone formation and cytokinesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005-01-11", "authors": "Zhu Changjun, Jiang Wei", "evidence": [ { "database": "UniProtKB", "id": "O43663", "url": "https://www.uniprot.org/uniprot/O43663" } ], "reference": [ { "type": "PubMed", "id": "15625105", "url": "https://glygen.org/publication/PubMed/15625105" } ] }, { "title": "Targeting and clustering citron to synapses.", "journal": "Molecular and cellular neurosciences", "date": "2006", "authors": "Zhang W, Benson DL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625900", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625900" } ], "reference": [ { "type": "PubMed", "id": "16202622", "url": "https://glygen.org/publication/PubMed/16202622" } ] }, { "title": "KIF14 and citron kinase act together to promote efficient cytokinesis.", "journal": "The Journal of cell biology", "date": "2006", "authors": "Gruneberg U, Neef R, Li X, Chan EH, Chalamalasetty RB, Nigg EA, Barr FA", "evidence": [ { "database": "UniProtKB", "id": "O43663", "url": "https://www.uniprot.org/uniprot/O43663" }, { "database": "Reactome", "id": "R-HSA-5625900", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625900" } ], "reference": [ { "type": "PubMed", "id": "16431929", "url": "https://glygen.org/publication/PubMed/16431929" } ] }, { "title": "Phosphoproteome analysis of the human mitotic spindle.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Nousiainen M, Sillje HH, Sauer G, Nigg EA, Korner R", "evidence": [ { "database": "iPTMnet", "id": "O43663-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43663-1" } ], "reference": [ { "type": "PubMed", "id": "16565220", "url": "https://glygen.org/publication/PubMed/16565220" } ] }, { "title": "Spatiotemporal control of spindle midzone formation by PRC1 in human cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Zhu C, Lau E, Schwarzenbacher R, Bossy-Wetzel E, Jiang W", "evidence": [ { "database": "iPTMnet", "id": "O43663", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43663" } ], "reference": [ { "type": "PubMed", "id": "16603632", "url": "https://glygen.org/publication/PubMed/16603632" } ] }, { "title": "A probability-based approach for high-throughput protein phosphorylation analysis and site localization.", "journal": "Nature biotechnology", "date": "2006", "authors": "Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP", "evidence": [ { "database": "iPTMnet", "id": "O43663", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43663" } ], "reference": [ { "type": "PubMed", "id": "16964243", "url": "https://glygen.org/publication/PubMed/16964243" } ] }, { "title": "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.", "journal": "Cell", "date": "2006", "authors": "Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M", "evidence": [ { "database": "iPTMnet", "id": "O43663-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43663-1" } ], "reference": [ { "type": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ] }, { "title": "Choice of Plk1 docking partners during mitosis and cytokinesis is controlled by the activation state of Cdk1.", "journal": "Nature cell biology", "date": "2007", "authors": "Neef R, Gruneberg U, Kopajtich R, Li X, Nigg EA, Sillje H, Barr FA", "evidence": [ { "database": "UniProtKB", "id": "O43663", "url": "https://www.uniprot.org/uniprot/O43663" }, { "database": "iPTMnet", "id": "O43663", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43663" } ], "reference": [ { "type": "PubMed", "id": "17351640", "url": "https://glygen.org/publication/PubMed/17351640" } ] }, { "title": "Oncogenic role of MPHOSPH1, a cancer-testis antigen specific to human bladder cancer.", "journal": "Cancer research", "date": "2007-04-01", "authors": "Kanehira Mitsugu, Katagiri Toyomasa, Shimo Arata, Takata Ryo, Shuin Taro, Miki Tsuneharu, Fujioka Tomoaki, Nakamura Yusuke", "evidence": [ { "database": "UniProtKB", "id": "O43663", "url": "https://www.uniprot.org/uniprot/O43663" } ], "reference": [ { "type": "PubMed", "id": "17409436", "url": "https://glygen.org/publication/PubMed/17409436" } ] }, { "title": "Mitotic phosphorylation of PRC1 at Thr470 is required for PRC1 oligomerization and proper central spindle organization.", "journal": "Cell research", "date": "2007", "authors": "Fu C, Yan F, Wu F, Wu Q, Whittaker J, Hu H, Hu R, Yao X", "evidence": [ { "database": "UniProtKB", "id": "O43663", "url": "https://www.uniprot.org/uniprot/O43663" }, { "database": "iPTMnet", "id": "O43663", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43663" } ], "reference": [ { "type": "PubMed", "id": "17438553", "url": "https://glygen.org/publication/PubMed/17438553" } ] }, { "title": "A mitotic kinase TOPK enhances Cdk1/cyclin B1-dependent phosphorylation of PRC1 and promotes cytokinesis.", "journal": "Journal of molecular biology", "date": "2007", "authors": "Abe Y, Takeuchi T, Kagawa-Miki L, Ueda N, Shigemoto K, Yasukawa M, Kito K", "evidence": [ { "database": "iPTMnet", "id": "O43663", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43663" } ], "reference": [ { "type": "PubMed", "id": "17512944", "url": "https://glygen.org/publication/PubMed/17512944" } ] }, { "title": "Hydrophilic interaction chromatography reduces the complexity of the phosphoproteome and improves global phosphopeptide isolation and detection.", "journal": "Molecular & cellular proteomics : MCP", "date": "2008", "authors": "McNulty DE, Annan RS", "evidence": [ { "database": "iPTMnet", "id": "O43663-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43663-1" } ], "reference": [ { "type": "PubMed", "id": "18212344", "url": "https://glygen.org/publication/PubMed/18212344" } ] }, { "title": "Motif-specific sampling of phosphoproteomes.", "journal": "Journal of proteome research", "date": "2008", "authors": "Ruse CI, McClatchy DB, Lu B, Cociorva D, Motoyama A, Park SK, Yates JR 3rd", "evidence": [ { "database": "iPTMnet", "id": "O43663-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43663-1" } ], "reference": [ { "type": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" } ] }, { "title": "A quantitative atlas of mitotic phosphorylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "O43663", "url": "https://www.uniprot.org/uniprot/O43663" }, { "database": "iPTMnet", "id": "O43663", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43663" } ], "reference": [ { "type": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ] }, { "title": "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.", "journal": "Mol. Cell", "date": "2008", "authors": "Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M", "evidence": [ { "database": "UniProtKB", "id": "O43663", "url": "https://www.uniprot.org/uniprot/O43663" }, { "database": "iPTMnet", "id": "O43663-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43663-1" } ], "reference": [ { "type": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" } ] }, { "title": "Evaluation of the low-specificity protease elastase for large-scale phosphoproteome analysis.", "journal": "Analytical chemistry", "date": "2008", "authors": "Wang B, Malik R, Nigg EA, Korner R", "evidence": [ { "database": "iPTMnet", "id": "O43663-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43663-1" } ], "reference": [ { "type": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" } ] }, { "title": "Polo-like kinase 1 directs assembly of the HsCyk-4 RhoGAP/Ect2 RhoGEF complex to initiate cleavage furrow formation.", "journal": "PLoS biology", "date": "2009", "authors": "Wolfe BA, Takaki T, Petronczki M, Glotzer M", "evidence": [ { "database": "UniProtKB", "id": "O43663", "url": "https://www.uniprot.org/uniprot/O43663" } ], "reference": [ { "type": "PubMed", "id": "19468300", "url": "https://glygen.org/publication/PubMed/19468300" } ] }, { "title": "Quantitative analysis of the human spindle phosphoproteome at distinct mitotic stages.", "journal": "Journal of proteome research", "date": "2009", "authors": "Malik R, Lenobel R, Santamaria A, Ries A, Nigg EA, Korner R", "evidence": [ { "database": "iPTMnet", "id": "O43663-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43663-1" } ], "reference": [ { "type": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" } ] }, { "title": "Extensive crosstalk between O-GlcNAcylation and phosphorylation regulates cytokinesis.", "journal": "Science signaling", "date": "2010", "authors": "Wang Z, Udeshi ND, Slawson C, Compton PD, Sakabe K, Cheung WD, Shabanowitz J, Hunt DF, Hart GW", "evidence": [ { "database": "iPTMnet", "id": "O43663-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43663-1" } ], "reference": [ { "type": "PubMed", "id": "20068230", "url": "https://glygen.org/publication/PubMed/20068230" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "UniProtKB", "id": "O43663", "url": "https://www.uniprot.org/uniprot/O43663" }, { "database": "iPTMnet", "id": "O43663-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43663-1" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "Insights into antiparallel microtubule crosslinking by PRC1, a conserved nonmotor microtubule binding protein.", "journal": "Cell", "date": "2010", "authors": "Subramanian R, Wilson-Kubalek EM, Arthur CP, Bick MJ, Campbell EA, Darst SA, Milligan RA, Kapoor TM", "evidence": [ { "database": "UniProtKB", "id": "O43663", "url": "https://www.uniprot.org/uniprot/O43663" } ], "reference": [ { "type": "PubMed", "id": "20691902", "url": "https://glygen.org/publication/PubMed/20691902" } ] }, { "title": "p27(Kip1) controls cytokinesis via the regulation of citron kinase activation.", "journal": "The Journal of clinical investigation", "date": "2012", "authors": "Serres MP, Kossatz U, Chi Y, Roberts JM, Malek NP, Besson A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625900", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625900" } ], "reference": [ { "type": "PubMed", "id": "22293177", "url": "https://glygen.org/publication/PubMed/22293177" } ] }, { "title": "Plk1 negatively regulates PRC1 to prevent premature midzone formation before cytokinesis.", "journal": "Molecular biology of the cell", "date": "2012", "authors": "Hu CK, Ozlu N, Coughlin M, Steen JJ, Mitchison TJ", "evidence": [ { "database": "iPTMnet", "id": "O43663", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43663" } ], "reference": [ { "type": "PubMed", "id": "22621898", "url": "https://glygen.org/publication/PubMed/22621898" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "O43663", "url": "https://www.uniprot.org/uniprot/O43663" }, { "database": "iPTMnet", "id": "O43663", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43663" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "Citron kinase mediates transition from constriction to abscission through its coiled-coil domain.", "journal": "Journal of cell science", "date": "2013", "authors": "Watanabe S, De Zan T, Ishizaki T, Narumiya S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625900", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625900" } ], "reference": [ { "type": "PubMed", "id": "23444367", "url": "https://glygen.org/publication/PubMed/23444367" } ] }, { "title": "Citron kinase controls a molecular network required for midbody formation in cytokinesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2013", "authors": "Bassi ZI, Audusseau M, Riparbelli MG, Callaini G, D'Avino PP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625900", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625900" } ], "reference": [ { "type": "PubMed", "id": "23716662", "url": "https://glygen.org/publication/PubMed/23716662" } ] }, { "title": "Aurora B suppresses microtubule dynamics and limits central spindle size by locally activating KIF4A.", "journal": "The Journal of cell biology", "date": "2013", "authors": "Nunes Bastos R, Gandhi SR, Baron RD, Gruneberg U, Nigg EA, Barr FA", "evidence": [ { "database": "iPTMnet", "id": "O43663", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43663" } ], "reference": [ { "type": "PubMed", "id": "23940115", "url": "https://glygen.org/publication/PubMed/23940115" } ] }, { "title": "The lethal response to Cdk1 inhibition depends on sister chromatid alignment errors generated by KIF4 and isoform 1 of PRC1.", "journal": "Scientific reports", "date": "2015", "authors": "Voets E, Marsman J, Demmers J, Beijersbergen R, Wolthuis R", "evidence": [ { "database": "iPTMnet", "id": "O43663", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43663" } ], "reference": [ { "type": "PubMed", "id": "26423135", "url": "https://glygen.org/publication/PubMed/26423135" } ] }, { "title": "Phosphoregulation of the oncogenic protein regulator of cytokinesis 1 (PRC1) by the atypical CDK16/CCNY complex.", "journal": "Experimental & molecular medicine", "date": "2019", "authors": "Hernandez-Ortega S, Sanchez-Botet A, Quandt E, Masip N, Gasa L, Verde G, Jimenez J, Levin RS, Rutaganira FU, Burlingame AL, Wolfgeher D, Ribeiro MPC, Kron SJ, Shokat KM, Clotet J", "evidence": [ { "database": "iPTMnet", "id": "O43663", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43663" } ], "reference": [ { "type": "PubMed", "id": "30992425", "url": "https://glygen.org/publication/PubMed/30992425" } ] }, { "title": "Proteomic profiling and genome-wide mapping of O-GlcNAc chromatin-associated proteins reveal an O-GlcNAc-regulated genotoxic stress response.", "journal": "Nature communications", "date": "2020", "authors": "Liu Y, Chen Q, Zhang N, Zhang K, Dou T, Cao Y, Liu Y, Li K, Hao X, Xie X, Li W, Ren Y, Zhang J", "evidence": [ { "database": "O-GlcNAc Database", "id": "O43663", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O43663" } ], "reference": [ { "type": "PubMed", "id": "33214551", "url": "https://glygen.org/publication/PubMed/33214551" } ] }, { "title": "Src-mediated tyrosine phosphorylation of PRC1 and kinastrin/SKAP on the mitotic spindle.", "journal": "Scientific reports", "date": "2021", "authors": "Morii M, Kubota S, Hasegawa C, Takeda Y, Kometani S, Enomoto K, Suzuki T, Yanase S, Sato R, Akatsu A, Hirata K, Honda T, Kuga T, Tomonaga T, Nakayama Y, Yamaguchi N, Yamaguchi N", "evidence": [ { "database": "iPTMnet", "id": "O43663", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43663" } ], "reference": [ { "type": "PubMed", "id": "33510346", "url": "https://glygen.org/publication/PubMed/33510346" } ] }, { "title": "CDK16 promotes the progression and metastasis of triple-negative breast cancer by phosphorylating PRC1.", "journal": "Journal of experimental & clinical cancer research : CR", "date": "2022", "authors": "Li X, Li J, Xu L, Wei W, Cheng A, Zhang L, Zhang M, Wu G, Cai C", "evidence": [ { "database": "iPTMnet", "id": "O43663", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43663" } ], "reference": [ { "type": "PubMed", "id": "35449080", "url": "https://glygen.org/publication/PubMed/35449080" } ] }, { "title": "PRC1 plays an important role in lung adenocarcinoma and is potentially targeted by fostamatinib.", "journal": "European review for medical and pharmacological sciences", "date": "2022-12", "authors": "Zhu P, Cui N, Song Z-Y, Yong W-X, Luo X-X, Wang G-C, Wang X, Wu Y-N, Xu Q, Zhang L-M, Hao G-X, Liu Y, Zhang Z-M", "evidence": [ { "database": "RefSeq", "id": "NP_001254509", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001254509" } ], "reference": [ { "type": "PubMed", "id": "36524512", "url": "https://glygen.org/publication/PubMed/36524512" } ] }, { "title": "CircKDM1B promotes hepatocellular carcinoma progression through regulating miR-1322/PRC1 axis.", "journal": "Environmental toxicology", "date": "2023-08", "authors": "Yi Mo, Lv Samei, He Yu, Wu Youwei, Zhang Jian, Chen Qian", "evidence": [ { "database": "RefSeq", "id": "NP_001254509", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001254509" } ], "reference": [ { "type": "PubMed", "id": "37227723", "url": "https://glygen.org/publication/PubMed/37227723" } ] }, { "title": "Protein regulator of cytokinesis 1: a potential oncogenic driver.", "journal": "Molecular cancer", "date": "2023-08-10", "authors": "Li Sijing, Moti\u00f1o Omar, Lambertucci Flavia, Martins Isabelle, Sun Li, Kroemer Guido", "evidence": [ { "database": "RefSeq", "id": "NP_001254509", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001254509" } ], "reference": [ { "type": "PubMed", "id": "37563591", "url": "https://glygen.org/publication/PubMed/37563591" } ] }, { "title": "Phosphorylation controls spatial and temporal\u00a0activities of motor-PRC1 complexes to complete mitosis.", "journal": "The EMBO journal", "date": "2023-08-18", "authors": "Gluszek-Kustusz Agata, Craske Benjamin, Legal Thibault, McHugh Toni, Welburn Julie Pi", "evidence": [ { "database": "RefSeq", "id": "NP_001254509", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001254509" } ], "reference": [ { "type": "PubMed", "id": "37592895", "url": "https://glygen.org/publication/PubMed/37592895" } ] }, { "title": "Genetic associations of TMEM154, PRC1 and ZFAND6 loci with type 2 diabetes in an endogamous business community of North India.", "journal": "PloS one", "date": "2023", "authors": "Walia Gagandeep Kaur, Sharma Pratiksha, Agarwal Tripti, Lal Moti, Negandhi Himanshu, Prabhakaran Dorairaj, Khadgawat Rajesh, Sachdeva Mohinder Pal, Gupta Vipin", "evidence": [ { "database": "RefSeq", "id": "NP_001254509", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001254509" } ], "reference": [ { "type": "PubMed", "id": "37738238", "url": "https://glygen.org/publication/PubMed/37738238" } ] }, { "title": "A novel partner for the GTP-bound forms of rho and rac.", "journal": "FEBS letters", "date": "1995", "authors": "Madaule P, Furuyashiki T, Reid T, Ishizaki T, Watanabe G, Morii N, Narumiya S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625900", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625900" } ], "reference": [ { "type": "PubMed", "id": "8543060", "url": "https://glygen.org/publication/PubMed/8543060" } ] }, { "title": "Citron rho-interacting kinase, a novel tissue-specific ser/thr kinase encompassing the Rho-Rac-binding protein Citron.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Di Cunto F, Calautti E, Hsiao J, Ong L, Topley G, Turco E, Dotto GP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625900", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625900" } ], "reference": [ { "type": "PubMed", "id": "9792683", "url": "https://glygen.org/publication/PubMed/9792683" } ] }, { "title": "Citron binds to PSD-95 at glutamatergic synapses on inhibitory neurons in the hippocampus.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "1999", "authors": "Zhang W, Vazquez L, Apperson M, Kennedy MB", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625900", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625900" } ], "reference": [ { "type": "PubMed", "id": "9870942", "url": "https://glygen.org/publication/PubMed/9870942" } ] }, { "title": "Citron, a Rho-target, interacts with PSD-95/SAP-90 at glutamatergic synapses in the thalamus.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "1999", "authors": "Furuyashiki T, Fujisawa K, Fujita A, Madaule P, Uchino S, Mishina M, Bito H, Narumiya S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625900", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625900" } ], "reference": [ { "type": "PubMed", "id": "9870943", "url": "https://glygen.org/publication/PubMed/9870943" } ] }, { "title": "PRC1: a human mitotic spindle-associated CDK substrate protein required for cytokinesis.", "journal": "Molecular cell", "date": "1998", "authors": "Jiang W, Jimenez G, Wells NJ, Hope TJ, Wahl GM, Hunter T, Fukunaga R", "evidence": [ { "database": "UniProtKB", "id": "O43663", "url": "https://www.uniprot.org/uniprot/O43663" }, { "database": "iPTMnet", "id": "O43663-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43663-1" } ], "reference": [ { "type": "PubMed", "id": "9885575", "url": "https://glygen.org/publication/PubMed/9885575" } ] } ], "pathway": [ { "id": "hsa:9055", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:9055", "resource": "KEGG Pathway" }, { "id": "R-HSA-5625900", "name": "RHO GTPases activate CIT", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625900", "resource": "Reactome", "description": "RHO GTPases activate CIT" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A8I6APJ5-1", "protein_name": "Protein regulator of cytokinesis 1", "gene_name": "Prc1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MRRSEVLADESIVCLQKALTHLREIWGLIGIPEEQRLQRTEVVKKHIKDLLDKMIAEEENLRERLLKSISICRKELSTLCSELQVKPFEEDKEITVLQLEKDLRTQVELMRKQKKERKQELKLLQEQDQELREILCMPPCDVDSTSVPTLEELNLFRQRVATLRETKESRHEQFVNIKRQIILCMEELEHTPDTSFERDVVCEDESAFCLSLENIATLQKLLKQLEVKKSQNEAECEGLRAQIRELWDRLQIPEEEREPVAAIMTGSKTKIRNALKLEVDRLEELKMQNIKQVIETIRVELAQFWDQCFYSQEQRQAFAPYYSEDYTENLLHLHDVEVIRLRNYYEAHKELFEGVQKWEESWKLFLEFERKASDPSRFTNRGGNLLKEEKERAKLQKTLPKLEEELKARIEHWEQENSTAFVVNGQKFMEYVTEQWELHRLEKERAKQERQLKNKRQTETEMLYGSAPRTPSKRPGQTPNKCGKVRKMNTTTMSTATPNSSIRPVFGGSVYRSPMSRLPPSGSKSVVTSLCSGKKTPRAARLRANKENLDLNGSILSGGYSGSTPLQRNCSIKSVASTYSEFSKDPSLSDSSTVGLQRELSKASRSDATSRILNSTNIQS", "length": 620 }, "evidence": [ { "id": "45925166", "url": "http://www.informatics.jax.org/homology/45925166", "database": "MGI" }, { "id": "O43663", "url": "https://omabrowser.org/oma/group/O43663/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q99K43-1", "protein_name": "Protein regulator of cytokinesis 1", "gene_name": "Prc1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MRRSEVLADESITCLQKALTHLREIWELIGIPEEQRLQRTEVVKKHIKDLLDRMIAEEESLRERLLKSISICQKELSTLCSELQVKPFQEEKDTTILQLEKDLRTQVELMRKQKKERKQELKLLQEQEQELRDILCMPPCDVDSTSVPTLEELKLFRQRVATLRETKESRREEFVNIKKQIILCMEELEHSPDTSFERDVVCEDESAFCLSLENIATLQKLLKQLEMKKSQNEAECEGLRTQIRELWDRLQIPEEEREPVEAIMTGSKTKIRNALKLEVDRLEELKMQNIKQVIEKIRVELAQFWDQCFYSQEQRQAFAPYYSEDYTENLLHLHDAEIVRLRNYYDVHKELFQGVQKWEESWKLFLEFERKASDPGRFTNRGGNLLKEEKERAKLQKTLPKLEEELKARIEQWEQEHSTAFVVNGQKFMEYVTEQWELHRLEKERAKQERQLKNKKQTEAEMLYGSTPRTPSKRPGQTPKKSGKMNTTTMSSATPNSSIRPVFGGSVYRSPMSRLPPSGSKSVVTSLCSGKKTPRAAQLRANKENLDLNGSILSGGYPGSTPLQHNCSIKSVASTYSEFSRELSKASRSDATSRILNSTNIQS", "length": 603 }, "evidence": [ { "id": "45925166", "url": "http://www.informatics.jax.org/homology/45925166", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 15, "go_terms": [ { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "O43663", "url": "https://www.uniprot.org/uniprot/O43663" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "O43663", "url": "https://www.uniprot.org/uniprot/O43663" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "O43663", "url": "https://www.uniprot.org/uniprot/O43663" } ], "pmid": "" }, { "name": "microtubule cytoskeleton", "id": "GO:0015630", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015630", "evidence": [ { "database": "UniProtKB", "id": "O43663", "url": "https://www.uniprot.org/uniprot/O43663" } ], "pmid": "" }, { "name": "intercellular bridge", "id": "GO:0045171", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045171", "evidence": [ { "database": "UniProtKB", "id": "O43663", "url": "https://www.uniprot.org/uniprot/O43663" } ], "pmid": "" }, { "name": "midbody", "id": "GO:0030496", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030496", "evidence": [ { "database": "UniProtKB", "id": "O43663", "url": "https://www.uniprot.org/uniprot/O43663" } ], "pmid": "" }, { "name": "cytoskeleton", "id": "GO:0005856", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005856", "evidence": [ { "database": "UniProtKB", "id": "O43663", "url": "https://www.uniprot.org/uniprot/O43663" } ], "pmid": "" }, { "name": "spindle pole", "id": "GO:0000922", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000922", "evidence": [ { "database": "UniProtKB", "id": "O43663", "url": "https://www.uniprot.org/uniprot/O43663" } ], "pmid": "" }, { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "O43663", "url": "https://www.uniprot.org/uniprot/O43663" } ], "pmid": "" }, { "name": "spindle", "id": "GO:0005819", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005819", "evidence": [ { "database": "UniProtKB", "id": "O43663", "url": "https://www.uniprot.org/uniprot/O43663" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "O43663", "url": "https://www.uniprot.org/uniprot/O43663" } ], "pmid": "" }, { "name": "chromosome", "id": "GO:0005694", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005694", "evidence": [ { "database": "UniProtKB", "id": "O43663", "url": "https://www.uniprot.org/uniprot/O43663" } ], "pmid": "" }, { "name": "contractile ring", "id": "GO:0070938", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070938", "evidence": [ { "database": "UniProtKB", "id": "O43663", "url": "https://www.uniprot.org/uniprot/O43663" } ], "pmid": "" }, { "name": "spindle microtubule", "id": "GO:0005876", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005876", "evidence": [ { "database": "UniProtKB", "id": "O43663", "url": "https://www.uniprot.org/uniprot/O43663" } ], "pmid": "" }, { "name": "mitotic spindle midzone", "id": "GO:1990023", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990023", "evidence": [ { "database": "UniProtKB", "id": "O43663", "url": "https://www.uniprot.org/uniprot/O43663" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "microtubule binding", "id": "GO:0008017", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008017", "evidence": [ { "database": "UniProtKB", "id": "O43663", "url": "https://www.uniprot.org/uniprot/O43663" } ], "pmid": "" }, { "name": "protein kinase binding", "id": "GO:0019901", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019901", "evidence": [ { "database": "UniProtKB", "id": "O43663", "url": "https://www.uniprot.org/uniprot/O43663" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "O43663", "url": "https://www.uniprot.org/uniprot/O43663" } ], "pmid": "" }, { "name": "kinesin binding", "id": "GO:0019894", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019894", "evidence": [ { "database": "UniProtKB", "id": "O43663", "url": "https://www.uniprot.org/uniprot/O43663" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 6, "go_terms": [ { "name": "microtubule cytoskeleton organization", "id": "GO:0000226", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000226", "evidence": [ { "database": "UniProtKB", "id": "O43663", "url": "https://www.uniprot.org/uniprot/O43663" } ], "pmid": "" }, { "name": "positive regulation of cell population proliferation", "id": "GO:0008284", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008284", "evidence": [ { "database": "UniProtKB", "id": "O43663", "url": "https://www.uniprot.org/uniprot/O43663" } ], "pmid": "" }, { "name": "cell division", "id": "GO:0051301", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051301", "evidence": [ { "database": "UniProtKB", "id": "O43663", "url": "https://www.uniprot.org/uniprot/O43663" } ], "pmid": "" }, { "name": "regulation of cytokinesis", "id": "GO:0032465", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032465", "evidence": [ { "database": "UniProtKB", "id": "O43663", "url": "https://www.uniprot.org/uniprot/O43663" } ], "pmid": "" }, { "name": "mitotic spindle midzone assembly", "id": "GO:0051256", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051256", "evidence": [ { "database": "UniProtKB", "id": "O43663", "url": "https://www.uniprot.org/uniprot/O43663" } ], "pmid": "" }, { "name": "mitotic spindle elongation", "id": "GO:0000022", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000022", "evidence": [ { "database": "UniProtKB", "id": "O43663", "url": "https://www.uniprot.org/uniprot/O43663" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 489, "end_pos": 491, "annotation": "n_glycosylation_sequon" }, { "start_pos": 495, "end_pos": 497, "annotation": "n_glycosylation_sequon" }, { "start_pos": 499, "end_pos": 501, "annotation": "n_glycosylation_sequon" }, { "start_pos": 552, "end_pos": 554, "annotation": "n_glycosylation_sequon" }, { "start_pos": 569, "end_pos": 571, "annotation": "n_glycosylation_sequon" }, { "start_pos": 614, "end_pos": 616, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Phosphorylation by CDK1 in early mitosis holds PRC1 in an inactive monomeric state, during the metaphase to anaphase transition, PRC1 is dephosphorylated, promoting interaction with KIF4A, which then translocates PRC1 along mitotic spindles to the plus ends of antiparallel interdigitating microtubules. Dephosphorylation also promotes MT-bundling activity by allowing dimerization. Phosphorylation by CDK1 prevents PLK1-binding: upon degradation of CDK1 at anaphase and dephosphorylation, it is then phosphorylated by PLK1, leading to cytokinesis.", "evidence": [ { "database": "UniProtKB", "id": "O43663", "url": "https://www.uniprot.org/uniprot/O43663" }, { "database": "PubMed", "id": "17351640", "url": "https://glygen.org/publication/PubMed/17351640" }, { "database": "PubMed", "id": "17438553", "url": "https://glygen.org/publication/PubMed/17438553" }, { "database": "PubMed", "id": "9885575", "url": "https://glygen.org/publication/PubMed/9885575" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [ 191, 194, 195, 265, 267, 464, 470, 481, 501, 513, 536, 541, 560, 571, 578, 587, 589, 592, 615, 616, 620 ], "sequon_annotation_sites": [ { "start_pos": 489, "end_pos": 491 }, { "start_pos": 495, "end_pos": 497 }, { "start_pos": 499, "end_pos": 501 }, { "start_pos": 552, "end_pos": 554 }, { "start_pos": 569, "end_pos": 571 }, { "start_pos": 614, "end_pos": 616 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 24 }, { "field": "total_sites", "count": 21 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 46 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }