{ "uniprot_canonical_ac": "O43521-1", "uniprot_ac": "O43521", "uniprot_id": "B2L11_HUMAN", "mass": { "chemical_mass": 22171.0, "monoisotopic_mass": 22171.0 }, "refseq": { "ac": "NP_001191035", "name": "bcl-2-like protein 11 isoform 11", "summary": "The protein encoded by this gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. The protein encoded by this gene contains a Bcl-2 homology domain 3 (BH3). It has been shown to interact with other members of the BCL-2 protein family and to act as an apoptotic activator. The expression of this gene can be induced by nerve growth factor (NGF), as well as by the forkhead transcription factor FKHR-L1, which suggests a role of this gene in neuronal and lymphocyte apoptosis. Transgenic studies of the mouse counterpart suggested that this gene functions as an essential initiator of apoptosis in thymocyte-negative selection. Several alternatively spliced transcript variants of this gene have been identified. [provided by RefSeq, Jun 2013].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001191035" }, "gene_names": [ { "name": "BCL2L11", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O43521", "id": "O43521" }, { "name": "BAM; BIM; BOD", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001191035", "id": "NP_001191035" }, { "name": "BCL2L11", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001191035", "id": "NP_001191035" }, { "name": "BIM", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O43521", "id": "O43521" } ], "protein_names": [ { "name": "Bcl-2-like protein 11", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O43521" }, { "name": "Bcl2-L-11", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O43521" }, { "name": "Bcl2-interacting mediator of cell death", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O43521" }, { "name": "bcl-2 interacting protein Bim; bcl-2 interacting mediator of cell death; bcl-2-related ovarian death agonist; BCL2-like 11 (apoptosis facilitator)", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001191035", "id": "NP_001191035" }, { "name": "bcl-2-like protein 11 isoform 11", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001191035", "id": "NP_001191035" } ], "function": [ { "annotation": "Dach1 deficiency drives alveolar epithelium apoptosis in pulmonary fibrosis via modulating C-Jun/Bim activity.", "evidence": [ { "database": "RefSeq", "id": "NP_001191035", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001191035" }, { "database": "PubMed", "id": "36754276", "url": "https://glygen.org/publication/PubMed/36754276" } ] }, { "annotation": "Expression Levels of MicroRNA-300/BCL2L11 in Papillary Thyroid Cancer and Their Clinical Diagnostic Values.", "evidence": [ { "database": "RefSeq", "id": "NP_001191035", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001191035" }, { "database": "PubMed", "id": "37231813", "url": "https://glygen.org/publication/PubMed/37231813" } ] }, { "annotation": "Induces apoptosis and anoikis. Isoform BimL is more potent than isoform BimEL. Isoform Bim-alpha1, isoform Bim-alpha2 and isoform Bim-alpha3 induce apoptosis, although less potent than isoform BimEL, isoform BimL and isoform BimS. Isoform Bim-gamma induces apoptosis. Isoform Bim-alpha3 induces apoptosis possibly through a caspase-mediated pathway. Isoform BimAC and isoform BimABC lack the ability to induce apoptosis.", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521#function" }, { "database": "PubMed", "id": "9430630", "url": "https://glygen.org/publication/PubMed/9430630" }, { "database": "PubMed", "id": "15661735", "url": "https://glygen.org/publication/PubMed/15661735" }, { "database": "PubMed", "id": "11997495", "url": "https://glygen.org/publication/PubMed/11997495" }, { "database": "PubMed", "id": "15486195", "url": "https://glygen.org/publication/PubMed/15486195" } ] }, { "annotation": "MiR-24-3p down-regulates the expression of the apoptotic factors FasL and BIM in human natural killer cells.", "evidence": [ { "database": "RefSeq", "id": "NP_001191035", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001191035" }, { "database": "PubMed", "id": "35870695", "url": "https://glygen.org/publication/PubMed/35870695" } ] }, { "annotation": "MicroRNA-17-5p Protects against Propofol Anesthesia-Induced Neurotoxicity and Autophagy Impairment via Targeting BCL2L11. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001191035", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001191035" }, { "database": "PubMed", "id": "35799645", "url": "https://glygen.org/publication/PubMed/35799645" } ] }, { "annotation": "Non-canonical BIM-regulated energy metabolism determines drug-induced liver necrosis.", "evidence": [ { "database": "RefSeq", "id": "NP_001191035", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001191035" }, { "database": "PubMed", "id": "38001256", "url": "https://glygen.org/publication/PubMed/38001256" } ] }, { "annotation": "The heterogeneity of tyrosine kinase inhibitors responses across individuals and suggest the possibility of personalizing therapy with BH3 mimetics to overcome BIM-polymorphism-associated tyrosine kinase inhibitors resistance. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001191035", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001191035" }, { "database": "PubMed", "id": "22426421", "url": "https://glygen.org/publication/PubMed/22426421" } ] }, { "annotation": "The protein encoded by this gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. The protein encoded by this gene contains a Bcl-2 homology domain 3 (BH3). It has been shown to interact with other members of the BCL-2 protein family and to act as an apoptotic activator. The expression of this gene can be induced by nerve growth factor (NGF), as well as by the forkhead transcription factor FKHR-L1, which suggests a role of this gene in neuronal and lymphocyte apoptosis. Transgenic studies of the mouse counterpart suggested that this gene functions as an essential initiator of apoptosis in thymocyte-negative selection. Several alternatively spliced transcript variants of this gene have been identified. [provided by RefSeq, Jun 2013].", "evidence": [ { "database": "RefSeq", "id": "NP_001191035", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001191035" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "O43521", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O43521" } ], "glycoeffect": [], "start_pos": 153, "end_pos": 153, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "R", "sequence_mut": "W", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (4).", "chr_id": "2", "chr_pos": "111150106", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "R153", "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] }, { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] }, { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] }, { "disease_id": "DOID:1319", "recommended_name": { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain cancer", "description": "A central nervous system cancer that is characterized by the growth of abnormal cells in the tissues of the brain." }, "synonyms": [ { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "BT - Brain tumour", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "adult brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "adult malignant brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain neoplasm, adult", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant brain tumour", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant primary brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant primary brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant tumor of Brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant tumor of adult brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "neoplasm of brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary malignant neoplasm of brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "tumor of the Brain", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "O43521", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O43521" } ], "glycoeffect": [], "start_pos": 156, "end_pos": 156, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "G", "sequence_mut": "R", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "2", "chr_pos": "111150115", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "G156", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] }, { "disease_id": "DOID:2394", "recommended_name": { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "ovarian cancer", "description": "A female reproductive organ cancer that is located_in the ovary." }, "synonyms": [ { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "malignant Ovarian tumor", "description": "" }, { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "malignant tumour of ovary", "description": "" }, { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "ovarian neoplasm", "description": "" }, { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "ovary neoplasm", "description": "" }, { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "primary ovarian cancer", "description": "" }, { "id": "DOID:2394", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2394", "name": "tumor of the Ovary", "description": "" }, { "id": "MONDO:0011931", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011931", "name": "ovarian cancer, susceptibility to, 1", "description": "" }, { "id": "MONDO:0011931", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011931", "name": "OVCAS1", "description": "" }, { "id": "MONDO:0011931", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011931", "name": "ovarian cancer, susceptibility to", "description": "" }, { "id": "MONDO:0011931", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011931", "name": "ovarian cancer, susceptibility to, 1", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian cancer", "description": "A primary or metastatic malignant neoplasm involving the ovary. Most primary malignant ovarian neoplasms are either carcinomas (serous, mucinous, or endometrioid adenocarcinomas) or malignant germ cell tumors. Metastatic malignant neoplasms to the ovary include carcinomas, lymphomas, and melanomas." }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian neoplasm", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovary neoplasm", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "tumor of the ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "tumour of the ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "cancer of ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "cancer of the ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant neoplasm of ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant neoplasm of the ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant ovarian neoplasm", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant ovarian tumor", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant ovarian tumour", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant ovary neoplasm", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant tumor of ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant tumor of the ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant tumour of ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "malignant tumour of the ovary", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian cancer", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian cancer, somatic", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian malignant tumor", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian malignant tumour", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovary cancer", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "ovarian cancer, epithelial", "description": "" }, { "id": "MONDO:0008170", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008170", "name": "primary ovarian cancer", "description": "" }, { "id": "MIM:167000", "resource": "MIM", "url": "https://www.omim.org/entry/167000", "name": "Ovarian cancer", "description": "Ovarian cancer" } ] }, { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "O43521", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O43521" } ], "glycoeffect": [], "start_pos": 185, "end_pos": 185, "subjects_tested": "92", "subjects_positive": "1", "frequency": "1.1", "sequence_org": "R", "sequence_mut": "*", "comment": "Somatic mutation passed 1 out of 6 filters: patient freq. (1.1%).", "chr_id": "2", "chr_pos": "111164187", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "R185", "keywords": [ "biomuta", "somatic", "cancer" ] } ], "mutagenesis": [ { "start_pos": 156, "end_pos": 156, "sequence_org": "G", "sequence_mut": "A", "comment": "Retains the ability to induce apoptosis. Abolishes interaction with BAX; in isoform Bim-alpha3 and isoform BimS. No effect on interaction with BCL2.", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" }, { "database": "PubMed", "id": "17289999", "url": "https://glygen.org/publication/PubMed/17289999" }, { "database": "PubMed", "id": "11997495", "url": "https://glygen.org/publication/PubMed/11997495" } ] }, { "start_pos": 156, "end_pos": 156, "sequence_org": "G", "sequence_mut": "E", "comment": "Abolishes induction of apoptosis. Abolishes interaction with BAX and BCL2; in isoform Bim-alpha3 and isoform BimS. Loses the ability to induce the conformationally active form of BAX.", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" }, { "database": "PubMed", "id": "17289999", "url": "https://glygen.org/publication/PubMed/17289999" }, { "database": "PubMed", "id": "11997495", "url": "https://glygen.org/publication/PubMed/11997495" } ] }, { "start_pos": 160, "end_pos": 160, "sequence_org": "N", "sequence_mut": "A", "comment": "Retains the ability to induce apoptosis. Abolishes interaction with BCL2; in isoform Bim-alpha3 and isoform BimS. No effect on interaction with BAX.", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" }, { "database": "PubMed", "id": "11997495", "url": "https://glygen.org/publication/PubMed/11997495" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "72.27", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000153094", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000153094" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "79.59", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000153094", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000153094" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "69.69", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000153094", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000153094" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "49.96", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000153094", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000153094" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "83.87", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000153094", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000153094" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "86.67", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000153094", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000153094" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "47.76", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000153094", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000153094" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "80.86", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000153094", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000153094" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "88.47", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000153094", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000153094" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "47.6", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000153094", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000153094" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "82.06", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000153094", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000153094" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "82.48", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000153094", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000153094" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "86.81", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000153094", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000153094" } ] } ], "expression_disease": [ { "significant": "No", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O43521", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43521" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O43521", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43521" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O43521", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43521" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O43521", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43521" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O43521", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43521" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O43521", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43521" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O43521", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43521" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O43521", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43521" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O43521", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43521" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O43521", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43521" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O43521", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43521" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O43521", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43521" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "common_name": "Human" } ], "gene": [ { "name": "BCL2L11", "url": "https://www.uniprot.org/uniprot/O43521", "locus": { "chromosome": "2", "start_pos": 52532, "end_pos": 5001, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "LRG_620", "url": "https://www.ensembl.org/id/LRG_620" } ] } } ], "crossref": [ { "id": "ENSG00000153094", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000153094", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "O43521", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O43521", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "CHEMBL5777", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL5777", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "BCL2L11", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=BCL2L11", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "10018", "url": "https://www.ncbi.nlm.nih.gov/gene/10018", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "994", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=994", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O43521", "url": "https://www.ebi.ac.uk/intact/interactors/id:O43521*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR014771", "url": "https://www.ebi.ac.uk/interpro/entry/IPR014771", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR015040", "url": "https://www.ebi.ac.uk/interpro/entry/IPR015040", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017288", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017288", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:10018", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:10018", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "603827", "url": "http://www.omim.org/entry/603827", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O43521", "url": "https://www.nextprot.org/entry/NX_O43521", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "EIWIARE", "url": "https://omabrowser.org/oma/group/EIWIARE/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4327858at2759", "url": "http://www.orthodb.org/?query=4327858at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR12044", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12044", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12044:SF9", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12044:SF9", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1F95", "url": "https://www.rcsb.org/structure/1F95", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2K7W", "url": "https://www.rcsb.org/structure/2K7W", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2NL9", "url": "https://www.rcsb.org/structure/2NL9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2V6Q", "url": "https://www.rcsb.org/structure/2V6Q", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2VM6", "url": "https://www.rcsb.org/structure/2VM6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2WH6", "url": "https://www.rcsb.org/structure/2WH6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2YQ6", "url": "https://www.rcsb.org/structure/2YQ6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2YQ7", "url": "https://www.rcsb.org/structure/2YQ7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3D7V", "url": "https://www.rcsb.org/structure/3D7V", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3FDL", "url": "https://www.rcsb.org/structure/3FDL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3IO8", "url": "https://www.rcsb.org/structure/3IO8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3IO9", "url": "https://www.rcsb.org/structure/3IO9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3KJ0", "url": "https://www.rcsb.org/structure/3KJ0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3KJ1", "url": "https://www.rcsb.org/structure/3KJ1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3KJ2", "url": "https://www.rcsb.org/structure/3KJ2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4A1U", "url": "https://www.rcsb.org/structure/4A1U", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4A1W", "url": "https://www.rcsb.org/structure/4A1W", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4B4S", "url": "https://www.rcsb.org/structure/4B4S", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4D2M", "url": "https://www.rcsb.org/structure/4D2M", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4QVF", "url": "https://www.rcsb.org/structure/4QVF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4UF3", "url": "https://www.rcsb.org/structure/4UF3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4YJ4", "url": "https://www.rcsb.org/structure/4YJ4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4ZIE", "url": "https://www.rcsb.org/structure/4ZIE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4ZIF", "url": "https://www.rcsb.org/structure/4ZIF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4ZIH", "url": "https://www.rcsb.org/structure/4ZIH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5AGW", "url": "https://www.rcsb.org/structure/5AGW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5AGX", "url": "https://www.rcsb.org/structure/5AGX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5C3G", "url": "https://www.rcsb.org/structure/5C3G", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5VWV", "url": "https://www.rcsb.org/structure/5VWV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5VWW", "url": "https://www.rcsb.org/structure/5VWW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5VWX", "url": "https://www.rcsb.org/structure/5VWX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5VWY", "url": "https://www.rcsb.org/structure/5VWY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5VWZ", "url": "https://www.rcsb.org/structure/5VWZ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5VX0", "url": "https://www.rcsb.org/structure/5VX0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5VX2", "url": "https://www.rcsb.org/structure/5VX2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5VX3", "url": "https://www.rcsb.org/structure/5VX3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5WOS", "url": "https://www.rcsb.org/structure/5WOS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6QFI", "url": "https://www.rcsb.org/structure/6QFI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6RJP", "url": "https://www.rcsb.org/structure/6RJP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6TQQ", "url": "https://www.rcsb.org/structure/6TQQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6UA3", "url": "https://www.rcsb.org/structure/6UA3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6UAB", "url": "https://www.rcsb.org/structure/6UAB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6VBX", "url": "https://www.rcsb.org/structure/6VBX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6X8O", "url": "https://www.rcsb.org/structure/6X8O", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF06773", "url": "http://pfam.xfam.org/family/PF06773", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF08945", "url": "http://pfam.xfam.org/family/PF08945", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O43521", "url": "https://pharos.nih.gov/targets/O43521", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O43521", "url": "http://purl.obolibrary.org/obo/PR_O43521", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-111446", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-111446", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-111453", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-111453", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-193648", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-193648", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6802952", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6802952", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8862803", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8862803", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8952158", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8952158", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9607240", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9614657", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9614657", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001191035", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001191035", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A0C4DH20", "url": "https://www.uniprot.org/uniprot/A0A0C4DH20", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A0C4DH20-1", "url": "https://www.uniprot.org/uniprot/A0A0C4DH20-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9J417", "url": "https://www.uniprot.org/uniprot/C9J417", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9J417-1", "url": "https://www.uniprot.org/uniprot/C9J417-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PAM9", "url": "https://www.uniprot.org/uniprot/E9PAM9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PAM9-1", "url": "https://www.uniprot.org/uniprot/E9PAM9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H7BZE5", "url": "https://www.uniprot.org/uniprot/H7BZE5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H7BZE5-1", "url": "https://www.uniprot.org/uniprot/H7BZE5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O43521-1", "url": "https://www.uniprot.org/uniprot/O43521-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O43521-10", "url": "https://www.uniprot.org/uniprot/O43521-10", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O43521-11", "url": "https://www.uniprot.org/uniprot/O43521-11", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O43521-12", "url": "https://www.uniprot.org/uniprot/O43521-12", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O43521-13", "url": "https://www.uniprot.org/uniprot/O43521-13", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O43521-14", "url": "https://www.uniprot.org/uniprot/O43521-14", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O43521-15", "url": "https://www.uniprot.org/uniprot/O43521-15", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O43521-16", "url": "https://www.uniprot.org/uniprot/O43521-16", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O43521-17", "url": "https://www.uniprot.org/uniprot/O43521-17", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O43521-18", "url": "https://www.uniprot.org/uniprot/O43521-18", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O43521-19", "url": "https://www.uniprot.org/uniprot/O43521-19", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O43521-2", "url": "https://www.uniprot.org/uniprot/O43521-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O43521-20", "url": "https://www.uniprot.org/uniprot/O43521-20", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O43521-3", "url": "https://www.uniprot.org/uniprot/O43521-3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O43521-4", "url": "https://www.uniprot.org/uniprot/O43521-4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O43521-5", "url": "https://www.uniprot.org/uniprot/O43521-5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O43521-6", "url": "https://www.uniprot.org/uniprot/O43521-6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O43521-7", "url": "https://www.uniprot.org/uniprot/O43521-7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O43521-8", "url": "https://www.uniprot.org/uniprot/O43521-8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O43521-9", "url": "https://www.uniprot.org/uniprot/O43521-9", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH", "length": 198, "header": "sp|O43521-1|B2L11_HUMAN Isoform 1 of Bcl-2-like protein 11 OS=Homo sapiens OX=9606 GN=BCL2L11 PE=1 SV=1 CANONICAL=O43521-1" }, "isoforms": [ { "isoform_ac": "A0A0C4DH20-1", "url": "", "sequence": { "sequence": "MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQVSLCHPGWSALVRSWLTATSNSQVQAVLLPQPPK", "length": 75, "header": "tr|A0A0C4DH20-1|A0A0C4DH20_HUMAN Computationally mapped isoform of BCL2 like 11 OS=Homo sapiens OX=9606 GN=BCL2L11 PE=1 SV=1 CANONICAL=O43521-1" }, "locus": { "chromosome": "2", "start_pos": 111130232, "end_pos": 111123746, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000361493.10", "url": "https://www.ensembl.org/id/ENST00000361493.10" }, { "database": "Ensembl Peptide", "id": "ENSP00000354879.6", "url": "https://www.ensembl.org/id/ENSP00000354879.6" } ] } }, { "isoform_ac": "C9J417-1", "url": "", "sequence": { "sequence": "MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQ", "length": 122, "header": "tr|C9J417-1|C9J417_HUMAN Computationally mapped isoform of BCL2 like 11 OS=Homo sapiens OX=9606 GN=BCL2L11 PE=1 SV=1 CANONICAL=O43521-1" }, "locus": { "chromosome": "2", "start_pos": 111124111, "end_pos": 111123746, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000432179.1", "url": "https://www.ensembl.org/id/ENST00000432179.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000411870.1", "url": "https://www.ensembl.org/id/ENSP00000411870.1" } ] } }, { "isoform_ac": "E9PAM9-1", "url": "", "sequence": { "sequence": "MFPAAAAGAARARGAACGALGCPAERGGGLAGRRGLCAAPGTLNPSPGLCLLRCFRGDGQGAPGRRRARAGRRGAWSLARTLRSEGKARTKKDQMAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH", "length": 292, "header": "tr|E9PAM9-1|B2L11_HUMAN Computationally mapped isoform of Bcl-2-like protein 11 OS=Homo sapiens OX=9606 GN=BCL2L11 PE=1 SV=9 CANONICAL=O43521-1" }, "locus": {} }, { "isoform_ac": "H7BZE5-1", "url": "", "sequence": { "sequence": "MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMDDSAGSSLRIALHREVQWPLKWLAKSS", "length": 98, "header": "tr|H7BZE5-1|H7BZE5_HUMAN Computationally mapped isoform of BCL2 like 11 OS=Homo sapiens OX=9606 GN=BCL2L11 PE=1 SV=2 CANONICAL=O43521-1" }, "locus": {} }, { "isoform_ac": "O43521-1", "url": "", "sequence": { "sequence": "MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH", "length": 198, "header": "sp|O43521-1|B2L11_HUMAN Isoform 1 of Bcl-2-like protein 11 OS=Homo sapiens OX=9606 GN=BCL2L11 PE=1 SV=1 CANONICAL=O43521-1" }, "locus": { "chromosome": "2", "start_pos": 111164228, "end_pos": 111123746, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000393256.8", "url": "https://www.ensembl.org/id/ENST00000393256.8" }, { "database": "Ensembl Peptide", "id": "ENSP00000376943.2", "url": "https://www.ensembl.org/id/ENSP00000376943.2" } ] } }, { "isoform_ac": "O43521-10", "url": "", "sequence": { "sequence": "MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMANWD", "length": 135, "header": "sp|O43521-10|B2L11_HUMAN Isoform 10 of Bcl-2-like protein 11 OS=Homo sapiens OX=9606 GN=BCL2L11 PE=1 SV=1 CANONICAL=O43521-1" }, "locus": { "chromosome": "2", "start_pos": 111144498, "end_pos": 111123746, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000431217.1", "url": "https://www.ensembl.org/id/ENST00000431217.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000394640.1", "url": "https://www.ensembl.org/id/ENSP00000394640.1" } ] } }, { "isoform_ac": "O43521-11", "url": "", "sequence": { "sequence": "MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGIFE", "length": 135, "header": "sp|O43521-11|B2L11_HUMAN Isoform 11 of Bcl-2-like protein 11 OS=Homo sapiens OX=9606 GN=BCL2L11 PE=1 SV=1 CANONICAL=O43521-1" }, "locus": {} }, { "isoform_ac": "O43521-12", "url": "", "sequence": { "sequence": "MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQVSLCHPGWSALVRSWLTATSNSQVQAVLLPQPPKRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH", "length": 198, "header": "sp|O43521-12|B2L11_HUMAN Isoform 12 of Bcl-2-like protein 11 OS=Homo sapiens OX=9606 GN=BCL2L11 PE=1 SV=1 CANONICAL=O43521-1" }, "locus": {} }, { "isoform_ac": "O43521-13", "url": "", "sequence": { "sequence": "MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGIF", "length": 44, "header": "sp|O43521-13|B2L11_HUMAN Isoform 13 of Bcl-2-like protein 11 OS=Homo sapiens OX=9606 GN=BCL2L11 PE=1 SV=1 CANONICAL=O43521-1" }, "locus": {} }, { "isoform_ac": "O43521-14", "url": "", "sequence": { "sequence": "MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV", "length": 140, "header": "sp|O43521-14|B2L11_HUMAN Isoform 14 of Bcl-2-like protein 11 OS=Homo sapiens OX=9606 GN=BCL2L11 PE=1 SV=1 CANONICAL=O43521-1" }, "locus": { "chromosome": "2", "start_pos": 111153805, "end_pos": 111123746, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000436733.5", "url": "https://www.ensembl.org/id/ENST00000436733.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000403727.1", "url": "https://www.ensembl.org/id/ENSP00000403727.1" } ] } }, { "isoform_ac": "O43521-15", "url": "", "sequence": { "sequence": "MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMGIFE", "length": 75, "header": "sp|O43521-15|B2L11_HUMAN Isoform 15 of Bcl-2-like protein 11 OS=Homo sapiens OX=9606 GN=BCL2L11 PE=1 SV=1 CANONICAL=O43521-1" }, "locus": {} }, { "isoform_ac": "O43521-16", "url": "", "sequence": { "sequence": "MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVREIEEVVV", "length": 80, "header": "sp|O43521-16|B2L11_HUMAN Isoform 16 of Bcl-2-like protein 11 OS=Homo sapiens OX=9606 GN=BCL2L11 PE=1 SV=1 CANONICAL=O43521-1" }, "locus": { "chromosome": "2", "start_pos": 111153805, "end_pos": 111123746, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000415458.5", "url": "https://www.ensembl.org/id/ENST00000415458.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000393781.1", "url": "https://www.ensembl.org/id/ENSP00000393781.1" } ] } }, { "isoform_ac": "O43521-17", "url": "", "sequence": { "sequence": "MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVVILEDIGDLSLCFGFIFTGLDLYGHHHSQDTEQLNHKDFS", "length": 112, "header": "sp|O43521-17|B2L11_HUMAN Isoform 17 of Bcl-2-like protein 11 OS=Homo sapiens OX=9606 GN=BCL2L11 PE=1 SV=1 CANONICAL=O43521-1" }, "locus": { "chromosome": "2", "start_pos": 111128748, "end_pos": 111123746, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000405953.6", "url": "https://www.ensembl.org/id/ENST00000405953.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000384641.1", "url": "https://www.ensembl.org/id/ENSP00000384641.1" } ] } }, { "isoform_ac": "O43521-18", "url": "", "sequence": { "sequence": "MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH", "length": 103, "header": "sp|O43521-18|B2L11_HUMAN Isoform 18 of Bcl-2-like protein 11 OS=Homo sapiens OX=9606 GN=BCL2L11 PE=1 SV=1 CANONICAL=O43521-1" }, "locus": {} }, { "isoform_ac": "O43521-19", "url": "", "sequence": { "sequence": "MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH", "length": 163, "header": "sp|O43521-19|B2L11_HUMAN Isoform 19 of Bcl-2-like protein 11 OS=Homo sapiens OX=9606 GN=BCL2L11 PE=1 SV=1 CANONICAL=O43521-1" }, "locus": {} }, { "isoform_ac": "O43521-2", "url": "", "sequence": { "sequence": "MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH", "length": 138, "header": "sp|O43521-2|B2L11_HUMAN Isoform 2 of Bcl-2-like protein 11 OS=Homo sapiens OX=9606 GN=BCL2L11 PE=1 SV=1 CANONICAL=O43521-1" }, "locus": { "chromosome": "2", "start_pos": 111164228, "end_pos": 111123746, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000308659.12", "url": "https://www.ensembl.org/id/ENST00000308659.12" }, { "database": "Ensembl Peptide", "id": "ENSP00000309226.8", "url": "https://www.ensembl.org/id/ENSP00000309226.8" } ] } }, { "isoform_ac": "O43521-20", "url": "", "sequence": { "sequence": "MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH", "length": 73, "header": "sp|O43521-20|B2L11_HUMAN Isoform 20 of Bcl-2-like protein 11 OS=Homo sapiens OX=9606 GN=BCL2L11 PE=1 SV=1 CANONICAL=O43521-1" }, "locus": {} }, { "isoform_ac": "O43521-3", "url": "", "sequence": { "sequence": "MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH", "length": 108, "header": "sp|O43521-3|B2L11_HUMAN Isoform 3 of Bcl-2-like protein 11 OS=Homo sapiens OX=9606 GN=BCL2L11 PE=1 SV=1 CANONICAL=O43521-1" }, "locus": {} }, { "isoform_ac": "O43521-4", "url": "", "sequence": { "sequence": "MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRLEK", "length": 169, "header": "sp|O43521-4|B2L11_HUMAN Isoform 4 of Bcl-2-like protein 11 OS=Homo sapiens OX=9606 GN=BCL2L11 PE=1 SV=1 CANONICAL=O43521-1" }, "locus": {} }, { "isoform_ac": "O43521-5", "url": "", "sequence": { "sequence": "MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRLEK", "length": 109, "header": "sp|O43521-5|B2L11_HUMAN Isoform 5 of Bcl-2-like protein 11 OS=Homo sapiens OX=9606 GN=BCL2L11 PE=1 SV=1 CANONICAL=O43521-1" }, "locus": {} }, { "isoform_ac": "O43521-6", "url": "", "sequence": { "sequence": "MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRLEK", "length": 79, "header": "sp|O43521-6|B2L11_HUMAN Isoform 6 of Bcl-2-like protein 11 OS=Homo sapiens OX=9606 GN=BCL2L11 PE=1 SV=1 CANONICAL=O43521-1" }, "locus": {} }, { "isoform_ac": "O43521-7", "url": "", "sequence": { "sequence": "MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRLAKLLASST", "length": 85, "header": "sp|O43521-7|B2L11_HUMAN Isoform 7 of Bcl-2-like protein 11 OS=Homo sapiens OX=9606 GN=BCL2L11 PE=1 SV=1 CANONICAL=O43521-1" }, "locus": { "chromosome": "2", "start_pos": 111151848, "end_pos": 111123746, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000439718.1", "url": "https://www.ensembl.org/id/ENST00000439718.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000411137.1", "url": "https://www.ensembl.org/id/ENSP00000411137.1" } ] } }, { "isoform_ac": "O43521-8", "url": "", "sequence": { "sequence": "MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQGNPEGNHGGEGDSCPHGSPQGPLAPPASPGPFATRSPLFIFMRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRMPLPPD", "length": 172, "header": "sp|O43521-8|B2L11_HUMAN Isoform 8 of Bcl-2-like protein 11 OS=Homo sapiens OX=9606 GN=BCL2L11 PE=1 SV=1 CANONICAL=O43521-1" }, "locus": { "chromosome": "2", "start_pos": 111161436, "end_pos": 111123746, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000437029.5", "url": "https://www.ensembl.org/id/ENST00000437029.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000412892.1", "url": "https://www.ensembl.org/id/ENSP00000412892.1" } ] } }, { "isoform_ac": "O43521-9", "url": "", "sequence": { "sequence": "MAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRMPLPPD", "length": 82, "header": "sp|O43521-9|B2L11_HUMAN Isoform 9 of Bcl-2-like protein 11 OS=Homo sapiens OX=9606 GN=BCL2L11 PE=1 SV=1 CANONICAL=O43521-1" }, "locus": { "chromosome": "2", "start_pos": 111161436, "end_pos": 111123746, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000452231.5", "url": "https://www.ensembl.org/id/ENST00000452231.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000391292.1", "url": "https://www.ensembl.org/id/ENSP00000391292.1" } ] } } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 104, "end_pos": 104, "kinase_uniprot_canonical_ac": "P06493-1", "kinase_gene_name": "CDK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O43521", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43521" }, { "database": "PubMed", "id": "22071694", "url": "https://glygen.org/publication/PubMed/22071694" } ], "site_lbl": "Ser104" }, { "start_pos": 104, "end_pos": 104, "kinase_uniprot_canonical_ac": "P45983-1", "kinase_gene_name": "MAPK8", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O43521", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43521" }, { "database": "PubMed", "id": "12591950", "url": "https://glygen.org/publication/PubMed/12591950" }, { "database": "PubMed", "id": "12818176", "url": "https://glygen.org/publication/PubMed/12818176" } ], "site_lbl": "Ser104" }, { "start_pos": 104, "end_pos": 104, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "O43521", "url": "http://phospho.elm.eu.org/byAccession/O43521.html" }, { "database": "iPTMnet", "id": "O43521", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43521" }, { "database": "PubMed", "id": "12591950", "url": "https://glygen.org/publication/PubMed/12591950" } ], "site_lbl": "Ser104" }, { "start_pos": 116, "end_pos": 116, "kinase_uniprot_canonical_ac": "P45983-1", "kinase_gene_name": "MAPK8", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O43521", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43521" }, { "database": "PubMed", "id": "12591950", "url": "https://glygen.org/publication/PubMed/12591950" }, { "database": "PubMed", "id": "12818176", "url": "https://glygen.org/publication/PubMed/12818176" } ], "site_lbl": "Thr116" }, { "start_pos": 116, "end_pos": 116, "kinase_uniprot_canonical_ac": "P53779-1", "kinase_gene_name": "MAPK10", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O43521", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43521" }, { "database": "PubMed", "id": "18498746", "url": "https://glygen.org/publication/PubMed/18498746" } ], "site_lbl": "Thr116" }, { "start_pos": 116, "end_pos": 116, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "O43521", "url": "http://phospho.elm.eu.org/byAccession/O43521.html" }, { "database": "iPTMnet", "id": "O43521", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43521" }, { "database": "PubMed", "id": "12591950", "url": "https://glygen.org/publication/PubMed/12591950" }, { "database": "PubMed", "id": "22742832", "url": "https://glygen.org/publication/PubMed/22742832" } ], "site_lbl": "Thr116" }, { "start_pos": 118, "end_pos": 118, "kinase_uniprot_canonical_ac": "P45983-1", "kinase_gene_name": "MAPK8", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O43521", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43521" }, { "database": "PubMed", "id": "12591950", "url": "https://glygen.org/publication/PubMed/12591950" }, { "database": "PubMed", "id": "12818176", "url": "https://glygen.org/publication/PubMed/12818176" } ], "site_lbl": "Ser118" }, { "start_pos": 118, "end_pos": 118, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "O43521", "url": "http://phospho.elm.eu.org/byAccession/O43521.html" }, { "database": "iPTMnet", "id": "O43521", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43521" }, { "database": "PubMed", "id": "12591950", "url": "https://glygen.org/publication/PubMed/12591950" } ], "site_lbl": "Ser118" }, { "start_pos": 59, "end_pos": 59, "kinase_uniprot_canonical_ac": "P45983-1", "kinase_gene_name": "MAPK8", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O43521", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43521" }, { "database": "PubMed", "id": "12818176", "url": "https://glygen.org/publication/PubMed/12818176" } ], "site_lbl": "Ser59" }, { "start_pos": 59, "end_pos": 59, "kinase_uniprot_canonical_ac": "P45984-1", "kinase_gene_name": "MAPK9", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O43521", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43521" }, { "database": "PubMed", "id": "12818176", "url": "https://glygen.org/publication/PubMed/12818176" } ], "site_lbl": "Ser59" }, { "start_pos": 59, "end_pos": 59, "kinase_uniprot_canonical_ac": "P53779-1", "kinase_gene_name": "MAPK10", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O43521", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43521" }, { "database": "PubMed", "id": "12818176", "url": "https://glygen.org/publication/PubMed/12818176" } ], "site_lbl": "Ser59" }, { "start_pos": 59, "end_pos": 59, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O43521", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43521" }, { "database": "PubMed", "id": "21247487", "url": "https://glygen.org/publication/PubMed/21247487" }, { "database": "PubMed", "id": "25526094", "url": "" } ], "site_lbl": "Ser59" }, { "start_pos": 69, "end_pos": 69, "kinase_uniprot_canonical_ac": "P27361-1", "kinase_gene_name": "MAPK3", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O43521", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43521" }, { "database": "PubMed", "id": "14681225", "url": "https://glygen.org/publication/PubMed/14681225" }, { "database": "phospho.ELM", "id": "O43521", "url": "http://phospho.elm.eu.org/byAccession/O43521.html" }, { "database": "PubMed", "id": "14555991", "url": "https://glygen.org/publication/PubMed/14555991" }, { "database": "PubMed", "id": "15486195", "url": "https://glygen.org/publication/PubMed/15486195" } ], "site_lbl": "Ser69" }, { "start_pos": 69, "end_pos": 69, "kinase_uniprot_canonical_ac": "P28482-1", "kinase_gene_name": "MAPK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O43521", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43521" }, { "database": "PubMed", "id": "14555991", "url": "https://glygen.org/publication/PubMed/14555991" }, { "database": "phospho.ELM", "id": "O43521", "url": "http://phospho.elm.eu.org/byAccession/O43521.html" }, { "database": "PubMed", "id": "15486195", "url": "https://glygen.org/publication/PubMed/15486195" } ], "site_lbl": "Ser69" }, { "start_pos": 69, "end_pos": 69, "kinase_uniprot_canonical_ac": "P45983-1", "kinase_gene_name": "MAPK8", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O43521", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43521" }, { "database": "PubMed", "id": "12818176", "url": "https://glygen.org/publication/PubMed/12818176" }, { "database": "PubMed", "id": "12591950", "url": "https://glygen.org/publication/PubMed/12591950" }, { "database": "PubMed", "id": "18174237", "url": "https://glygen.org/publication/PubMed/18174237" } ], "site_lbl": "Ser69" }, { "start_pos": 69, "end_pos": 69, "kinase_uniprot_canonical_ac": "P45984-1", "kinase_gene_name": "MAPK9", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O43521", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43521" }, { "database": "PubMed", "id": "12818176", "url": "https://glygen.org/publication/PubMed/12818176" } ], "site_lbl": "Ser69" }, { "start_pos": 69, "end_pos": 69, "kinase_uniprot_canonical_ac": "P53779-1", "kinase_gene_name": "MAPK10", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O43521", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43521" }, { "database": "PubMed", "id": "12818176", "url": "https://glygen.org/publication/PubMed/12818176" } ], "site_lbl": "Ser69" }, { "start_pos": 69, "end_pos": 69, "kinase_uniprot_canonical_ac": "Q16539-1", "kinase_gene_name": "MAPK14", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O43521", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43521" }, { "database": "PubMed", "id": "16818494", "url": "https://glygen.org/publication/PubMed/16818494" } ], "site_lbl": "Ser69" }, { "start_pos": 69, "end_pos": 69, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by MAPK", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" }, { "database": "PRO", "id": "O43521", "url": "http://purl.obolibrary.org/obo/O43521" }, { "database": "iPTMnet", "id": "O43521", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43521" }, { "database": "PubMed", "id": "18063582", "url": "https://glygen.org/publication/PubMed/18063582" }, { "database": "PubMed", "id": "18715233", "url": "https://glygen.org/publication/PubMed/18715233" }, { "database": "PubMed", "id": "21247487", "url": "https://glygen.org/publication/PubMed/21247487" }, { "database": "PubMed", "id": "25187648", "url": "https://glygen.org/publication/PubMed/25187648" }, { "database": "PubMed", "id": "26245900", "url": "" }, { "database": "PubMed", "id": "26447615", "url": "https://glygen.org/publication/PubMed/26447615" }, { "database": "PubMed", "id": "26716515", "url": "https://glygen.org/publication/PubMed/26716515" }, { "database": "PubMed", "id": "27661108", "url": "https://glygen.org/publication/PubMed/27661108" }, { "database": "PubMed", "id": "28863346", "url": "https://glygen.org/publication/PubMed/28863346" }, { "database": "PubMed", "id": "15486195", "url": "https://glygen.org/publication/PubMed/15486195" } ], "site_lbl": "Ser69" }, { "start_pos": 77, "end_pos": 77, "kinase_uniprot_canonical_ac": "P45983-1", "kinase_gene_name": "MAPK8", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O43521", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43521" }, { "database": "PubMed", "id": "12818176", "url": "https://glygen.org/publication/PubMed/12818176" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" } ], "site_lbl": "Ser77" }, { "start_pos": 77, "end_pos": 77, "kinase_uniprot_canonical_ac": "P45984-1", "kinase_gene_name": "MAPK9", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O43521", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43521" }, { "database": "PubMed", "id": "12818176", "url": "https://glygen.org/publication/PubMed/12818176" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" } ], "site_lbl": "Ser77" }, { "start_pos": 77, "end_pos": 77, "kinase_uniprot_canonical_ac": "P53779-1", "kinase_gene_name": "MAPK10", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O43521", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43521" }, { "database": "PubMed", "id": "12818176", "url": "https://glygen.org/publication/PubMed/12818176" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" } ], "site_lbl": "Ser77" }, { "start_pos": 77, "end_pos": 77, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" }, { "database": "phospho.ELM", "id": "O43521", "url": "http://phospho.elm.eu.org/byAccession/O43521.html" }, { "database": "iPTMnet", "id": "O43521", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43521" }, { "database": "PubMed", "id": "18220336", "url": "https://glygen.org/publication/PubMed/18220336" }, { "database": "PubMed", "id": "26716515", "url": "https://glygen.org/publication/PubMed/26716515" } ], "site_lbl": "Ser77" }, { "start_pos": 87, "end_pos": 87, "kinase_uniprot_canonical_ac": "P31749-1", "kinase_gene_name": "AKT1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O43521", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43521" }, { "database": "PubMed", "id": "16282323", "url": "https://glygen.org/publication/PubMed/16282323" } ], "site_lbl": "Ser87" }, { "start_pos": 87, "end_pos": 87, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" }, { "database": "PRO", "id": "O43521", "url": "http://purl.obolibrary.org/obo/O43521" }, { "database": "iPTMnet", "id": "O43521", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43521" }, { "database": "PubMed", "id": "16282323", "url": "https://glygen.org/publication/PubMed/16282323" } ], "site_lbl": "Ser87" }, { "start_pos": 94, "end_pos": 94, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O43521", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43521" } ], "site_lbl": "Ser94" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Akt promotes cell survival by phosphorylating and inhibiting a Forkhead transcription factor.", "journal": "Cell", "date": "1999", "authors": "Brunet A, Bonni A, Zigmond MJ, Lin MZ, Juo P, Hu LS, Anderson MJ, Arden KC, Blenis J, Greenberg ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-9614657", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9614657" } ], "reference": [ { "type": "PubMed", "id": "10102273", "url": "https://glygen.org/publication/PubMed/10102273" } ] }, { "title": "Ca2+-induced apoptosis through calcineurin dephosphorylation of BAD.", "journal": "Science (New York, N.Y.)", "date": "1999", "authors": "Wang HG, Pathan N, Ethell IM, Krajewski S, Yamaguchi Y, Shibasaki F, McKeon F, Bobo T, Franke TF, Reed JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-111453", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-111453" } ], "reference": [ { "type": "PubMed", "id": "10195903", "url": "https://glygen.org/publication/PubMed/10195903" } ] }, { "title": "The proapoptotic activity of the Bcl-2 family member Bim is regulated by interaction with the dynein motor complex.", "journal": "Molecular cell", "date": "1999", "authors": "Puthalakath H, Huang DC, O'Reilly LA, King SM, Strasser A", "evidence": [ { "database": "Reactome", "id": "R-HSA-111453", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-111453" } ], "reference": [ { "type": "PubMed", "id": "10198631", "url": "https://glygen.org/publication/PubMed/10198631" } ] }, { "title": "Ubiquitination of p27 is regulated by Cdk-dependent phosphorylation and trimeric complex formation.", "journal": "Genes & development", "date": "1999", "authors": "Montagnoli A, Fiore F, Eytan E, Carrano AC, Draetta GF, Hershko A, Pagano M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9607240", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240" } ], "reference": [ { "type": "PubMed", "id": "10323868", "url": "https://glygen.org/publication/PubMed/10323868" } ] }, { "title": "Conversion of p35 to p25 deregulates Cdk5 activity and promotes neurodegeneration.", "journal": "Nature", "date": "1999", "authors": "Patrick GN, Zukerberg L, Nikolic M, de la Monte S, Dikkes P, Tsai LH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8862803", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8862803" } ], "reference": [ { "type": "PubMed", "id": "10604467", "url": "https://glygen.org/publication/PubMed/10604467" } ] }, { "title": "The crystal structure of calcium-free human m-calpain suggests an electrostatic switch mechanism for activation by calcium.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2000", "authors": "Strobl S, Fernandez-Catalan C, Braun M, Huber R, Masumoto H, Nakagawa K, Irie A, Sorimachi H, Bourenkow G, Bartunik H, Suzuki K, Bode W", "evidence": [ { "database": "Reactome", "id": "R-HSA-8862803", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8862803" } ], "reference": [ { "type": "PubMed", "id": "10639123", "url": "https://glygen.org/publication/PubMed/10639123" } ] }, { "title": "AFX-like Forkhead transcription factors mediate cell-cycle regulation by Ras and PKB through p27kip1.", "journal": "Nature", "date": "2000", "authors": "Medema RH, Kops GJ, Bos JL, Burgering BM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9607240", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240" } ], "reference": [ { "type": "PubMed", "id": "10783894", "url": "https://glygen.org/publication/PubMed/10783894" } ] }, { "title": "Noxa, a BH3-only member of the Bcl-2 family and candidate mediator of p53-induced apoptosis.", "journal": "Science (New York, N.Y.)", "date": "2000", "authors": "Oda E, Ohki R, Murasawa H, Nemoto J, Shibue T, Yamashita T, Tokino T, Taniguchi T, Tanaka N", "evidence": [ { "database": "Reactome", "id": "R-HSA-111453", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-111453" } ], "reference": [ { "type": "PubMed", "id": "10807576", "url": "https://glygen.org/publication/PubMed/10807576" } ] }, { "title": "Neurotoxicity induces cleavage of p35 to p25 by calpain.", "journal": "Nature", "date": "2000", "authors": "Lee MS, Kwon YT, Li M, Peng J, Friedlander RM, Tsai LH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8862803", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8862803" } ], "reference": [ { "type": "PubMed", "id": "10830966", "url": "https://glygen.org/publication/PubMed/10830966" } ] }, { "title": "Flt3 ligand induces tyrosine phosphorylation of gab1 and gab2 and their association with shp-2, grb2, and PI3 kinase.", "journal": "Biochemical and biophysical research communications", "date": "2000", "authors": "Zhang S, Broxmeyer HE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9607240", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240" } ], "reference": [ { "type": "PubMed", "id": "11027663", "url": "https://glygen.org/publication/PubMed/11027663" } ] }, { "title": "Forkhead transcription factor FKHR-L1 modulates cytokine-dependent transcriptional regulation of p27(KIP1).", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Dijkers PF, Medema RH, Pals C, Banerji L, Thomas NS, Lam EW, Burgering BM, Raaijmakers JA, Lammers JW, Koenderman L, Coffer PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9607240", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240" } ], "reference": [ { "type": "PubMed", "id": "11094066", "url": "https://glygen.org/publication/PubMed/11094066" } ] }, { "title": "PUMA, a novel proapoptotic gene, is induced by p53.", "journal": "Molecular cell", "date": "2001", "authors": "Nakano K, Vousden KH", "evidence": [ { "database": "Reactome", "id": "R-HSA-111453", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-111453" } ], "reference": [ { "type": "PubMed", "id": "11463392", "url": "https://glygen.org/publication/PubMed/11463392" } ] }, { "title": "Bmf: a proapoptotic BH3-only protein regulated by interaction with the myosin V actin motor complex, activated by anoikis.", "journal": "Science (New York, N.Y.)", "date": "2001", "authors": "Puthalakath H, Villunger A, O'Reilly LA, Beaumont JG, Coultas L, Cheney RE, Huang DC, Strasser A", "evidence": [ { "database": "Reactome", "id": "R-HSA-111453", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-111453" } ], "reference": [ { "type": "PubMed", "id": "11546872", "url": "https://glygen.org/publication/PubMed/11546872" } ] }, { "title": "Molecular cloning and characterization of six novel isoforms of human Bim, a member of the proapoptotic Bcl-2 family.", "journal": "FEBS Lett.", "date": "2001", "authors": "U M, Miyashita T, Shikama Y, Tadokoro K, Yamada M", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "reference": [ { "type": "PubMed", "id": "11734221", "url": "https://glygen.org/publication/PubMed/11734221" } ] }, { "title": "Activation of Rac GTPase by p75 is necessary for c-jun N-terminal kinase-mediated apoptosis.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2002", "authors": "Harrington AW, Kim JY, Yoon SO", "evidence": [ { "database": "Reactome", "id": "R-HSA-193648", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-193648" } ], "reference": [ { "type": "PubMed", "id": "11756498", "url": "https://glygen.org/publication/PubMed/11756498" } ] }, { "title": "The forkhead transcription factor AFX activates apoptosis by induction of the BCL-6 transcriptional repressor.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Tang TT, Dowbenko D, Jackson A, Toney L, Lewin DA, Dent AL, Lasky LA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9614657", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9614657" } ], "reference": [ { "type": "PubMed", "id": "11777915", "url": "https://glygen.org/publication/PubMed/11777915" } ] }, { "title": "A novel human small subunit of calpains.", "journal": "The Biochemical journal", "date": "2002", "authors": "Schad E, Farkas A, Jekely G, Tompa P, Friedrich P", "evidence": [ { "database": "Reactome", "id": "R-HSA-8862803", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8862803" } ], "reference": [ { "type": "PubMed", "id": "11853546", "url": "https://glygen.org/publication/PubMed/11853546" } ] }, { "title": "Identification of novel isoforms of the BH3 domain protein Bim which directly activate Bax to trigger apoptosis.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Marani M, Tenev T, Hancock D, Downward J, Lemoine NR", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "reference": [ { "type": "PubMed", "id": "11997495", "url": "https://glygen.org/publication/PubMed/11997495" } ] }, { "title": "Identification and characterization of Bimgamma, a novel proapoptotic BH3-only splice variant of Bim.", "journal": "Cancer Res.", "date": "2002", "authors": "Liu Jun-Wei, Chandra Dhyan, Tang Shao-Hua, Chopra Dharam, Tang Dean G", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "reference": [ { "type": "PubMed", "id": "12019181", "url": "https://glygen.org/publication/PubMed/12019181" } ] }, { "title": "Mechanisms of p75-mediated death of hippocampal neurons. Role of caspases.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Troy CM, Friedman JE, Friedman WJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-193648", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-193648" } ], "reference": [ { "type": "PubMed", "id": "12097334", "url": "https://glygen.org/publication/PubMed/12097334" } ] }, { "title": "JNK phosphorylation of Bim-related members of the Bcl2 family induces Bax-dependent apoptosis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2003", "authors": "Lei K, Davis RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-111446", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-111446" }, { "database": "iPTMnet", "id": "O43521-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43521-1" } ], "reference": [ { "type": "PubMed", "id": "12591950", "url": "https://glygen.org/publication/PubMed/12591950" } ] }, { "title": "Inhibition of Bid-induced apoptosis by Bcl-2. tBid insertion, Bax translocation, and Bax/Bak oligomerization suppressed.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Yi X, Yin XM, Dong Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-111453", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-111453" } ], "reference": [ { "type": "PubMed", "id": "12624108", "url": "https://glygen.org/publication/PubMed/12624108" } ] }, { "title": "Smad3 potentiates transforming growth factor beta (TGFbeta )-induced apoptosis and expression of the BH3-only protein Bim in WEHI 231 B lymphocytes.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Wildey GM, Patil S, Howe PH", "evidence": [ { "database": "Reactome", "id": "R-HSA-8952158", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8952158" } ], "reference": [ { "type": "PubMed", "id": "12637528", "url": "https://glygen.org/publication/PubMed/12637528" } ] }, { "title": "JNK-mediated BIM phosphorylation potentiates BAX-dependent apoptosis.", "journal": "Neuron", "date": "2003", "authors": "Putcha GV, Le S, Frank S, Besirli CG, Clark K, Chu B, Alix S, Youle RJ, LaMarche A, Maroney AC, Johnson EM Jr", "evidence": [ { "database": "iPTMnet", "id": "O43521-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43521-1" } ], "reference": [ { "type": "PubMed", "id": "12818176", "url": "https://glygen.org/publication/PubMed/12818176" } ] }, { "title": "Phosphorylation of Bim-EL by Erk1/2 on serine 69 promotes its degradation via the proteasome pathway and regulates its proapoptotic function.", "journal": "Oncogene", "date": "2003", "authors": "Luciano F, Jacquel A, Colosetti P, Herrant M, Cagnol S, Pages G, Auberger P", "evidence": [ { "database": "iPTMnet", "id": "O43521", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43521" } ], "reference": [ { "type": "PubMed", "id": "14555991", "url": "https://glygen.org/publication/PubMed/14555991" } ] }, { "title": "Inhibition of Akt kinase signalling and activation of Forkhead are indispensable for upregulation of FasL expression in apoptosis of glioma cells.", "journal": "Oncogene", "date": "2003", "authors": "Ciechomska I, Pyrzynska B, Kazmierczak P, Kaminska B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9614657", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9614657" } ], "reference": [ { "type": "PubMed", "id": "14576824", "url": "https://glygen.org/publication/PubMed/14576824" } ] }, { "title": "Apoptosis induced by p75NTR overexpression requires Jun kinase-dependent phosphorylation of Bad.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2003", "authors": "Bhakar AL, Howell JL, Paul CE, Salehi AH, Becker EB, Said F, Bonni A, Barker PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-193648", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-193648" } ], "reference": [ { "type": "PubMed", "id": "14673001", "url": "https://glygen.org/publication/PubMed/14673001" } ] }, { "title": "Extracellular signal-regulated kinases 1/2 are serum-stimulated `Bim(EL) kinases` that bind to the BH3-only protein Bim(EL) causing its phosphorylation and turnover.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Ley R, Ewings KE, Hadfield K, Howes E, Balmanno K, Cook SJ", "evidence": [ { "database": "iPTMnet", "id": "O43521", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43521" } ], "reference": [ { "type": "PubMed", "id": "14681225", "url": "https://glygen.org/publication/PubMed/14681225" } ] }, { "title": "Inhibition of phosphorylation of a forkhead transcription factor sensitizes human ovarian cancer cells to cisplatin.", "journal": "Endocrinology", "date": "2004", "authors": "Arimoto-Ishida E, Ohmichi M, Mabuchi S, Takahashi T, Ohshima C, Hayakawa J, Kimura A, Takahashi K, Nishio Y, Sakata M, Kurachi H, Tasaka K, Murata Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9614657", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9614657" } ], "reference": [ { "type": "PubMed", "id": "14701673", "url": "https://glygen.org/publication/PubMed/14701673" } ] }, { "title": "FLT3 receptors with internal tandem duplications promote cell viability and proliferation by signaling through Foxo proteins.", "journal": "Oncogene", "date": "2004", "authors": "Scheijen B, Ngo HT, Kang H, Griffin JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9607240", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240" } ], "reference": [ { "type": "PubMed", "id": "14981546", "url": "https://glygen.org/publication/PubMed/14981546" } ] }, { "title": "Over-expression of Bim alpha3, a novel isoform of human Bim, result in cell apoptosis.", "journal": "Int. J. Biochem. Cell Biol.", "date": "2004", "authors": "Chen Jin-Zhong, Ji Chao-Neng, Gu Shao-Hua, Li Ji-Xi, Zhao En-Peng, Huang Yan, Huang Lu, Ying Kang, Xie Yi, Mao Yu-Min", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "reference": [ { "type": "PubMed", "id": "15147734", "url": "https://glygen.org/publication/PubMed/15147734" } ] }, { "title": "Characterization of the c-Jun N-terminal kinase-BimEL signaling pathway in neuronal apoptosis.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2004", "authors": "Becker EB, Howell J, Kodama Y, Barker PA, Bonni A", "evidence": [ { "database": "Reactome", "id": "R-HSA-193648", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-193648" } ], "reference": [ { "type": "PubMed", "id": "15470142", "url": "https://glygen.org/publication/PubMed/15470142" } ] }, { "title": "BimEL is an important determinant for induction of anoikis sensitivity by mitogen-activated protein/extracellular signal-regulated kinase kinase inhibitors.", "journal": "Molecular cancer therapeutics", "date": "2004", "authors": "Fukazawa H, Noguchi K, Masumi A, Murakami Y, Uehara Y", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" }, { "database": "iPTMnet", "id": "O43521", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43521" } ], "reference": [ { "type": "PubMed", "id": "15486195", "url": "https://glygen.org/publication/PubMed/15486195" } ] }, { "title": "FoxO3a and BCR-ABL regulate cyclin D2 transcription through a STAT5/BCL6-dependent mechanism.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Fernandez de Mattos S, Essafi A, Soeiro I, Pietersen AM, Birkenkamp KU, Edwards CS, Martino A, Nelson BH, Francis JM, Jones MC, Brosens JJ, Coffer PJ, Lam EW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9614657", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9614657" } ], "reference": [ { "type": "PubMed", "id": "15509806", "url": "https://glygen.org/publication/PubMed/15509806" } ] }, { "title": "Calcium signals induced by amyloid beta peptide and their consequences in neurons and astrocytes in culture.", "journal": "Biochimica et biophysica acta", "date": "2004", "authors": "Abramov AY, Canevari L, Duchen MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-8862803", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8862803" } ], "reference": [ { "type": "PubMed", "id": "15590058", "url": "https://glygen.org/publication/PubMed/15590058" } ] }, { "title": "Oncogenic AKAP9-BRAF fusion is a novel mechanism of MAPK pathway activation in thyroid cancer.", "journal": "The Journal of clinical investigation", "date": "2005", "authors": "Ciampi R, Knauf JA, Kerler R, Gandhi M, Zhu Z, Nikiforova MN, Rabes HM, Fagin JA, Nikiforov YE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6802952", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6802952" } ], "reference": [ { "type": "PubMed", "id": "15630448", "url": "https://glygen.org/publication/PubMed/15630448" } ] }, { "title": "Cytoprotective peptide humanin binds and inhibits proapoptotic Bcl-2/Bax family protein BimEL.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Luciano F, Zhai D, Zhu X, Bailly-Maitre B, Ricci JE, Satterthwait AC, Reed JC", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "reference": [ { "type": "PubMed", "id": "15661735", "url": "https://glygen.org/publication/PubMed/15661735" } ] }, { "title": "Constitutive activation of Akt by Flt3 internal tandem duplications is necessary for increased survival, proliferation, and myeloid transformation.", "journal": "Cancer research", "date": "2005", "authors": "Brandts CH, Sargin B, Rode M, Biermann C, Lindtner B, Schwable J, Buerger H, Muller-Tidow C, Choudhary C, McMahon M, Berdel WE, Serve H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9607240", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240" } ], "reference": [ { "type": "PubMed", "id": "16266983", "url": "https://glygen.org/publication/PubMed/16266983" } ] }, { "title": "Evidence that Ser87 of BimEL is phosphorylated by Akt and regulates BimEL apoptotic function.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Qi XJ, Wildey GM, Howe PH", "evidence": [ { "database": "iPTMnet", "id": "O43521", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43521" } ], "reference": [ { "type": "PubMed", "id": "16282323", "url": "https://glygen.org/publication/PubMed/16282323" } ] }, { "title": "RUNX3 cooperates with FoxO3a to induce apoptosis in gastric cancer cells.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Yamamura Y, Lee WL, Inoue K, Ida H, Ito Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-8952158", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8952158" } ], "reference": [ { "type": "PubMed", "id": "16373335", "url": "https://glygen.org/publication/PubMed/16373335" } ] }, { "title": "IAN family critically regulates survival and development of T lymphocytes.", "journal": "PLoS Biol.", "date": "2006", "authors": "Nitta T, Nasreen M, Seike T, Goji A, Ohigashi I, Miyazaki T, Ohta T, Kanno M, Takahama Y", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "reference": [ { "type": "PubMed", "id": "16509771", "url": "https://glygen.org/publication/PubMed/16509771" } ] }, { "title": "Identification of Y589 and Y599 in the juxtamembrane domain of Flt3 as ligand-induced autophosphorylation sites involved in binding of Src family kinases and the protein tyrosine phosphatase SHP2.", "journal": "Blood", "date": "2006", "authors": "Heiss E, Masson K, Sundberg C, Pedersen M, Sun J, Bengtsson S, Ronnstrand L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9607240", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240" } ], "reference": [ { "type": "PubMed", "id": "16684964", "url": "https://glygen.org/publication/PubMed/16684964" } ] }, { "title": "The RUNX3 tumor suppressor upregulates Bim in gastric epithelial cells undergoing transforming growth factor beta-induced apoptosis.", "journal": "Molecular and cellular biology", "date": "2006", "authors": "Yano T, Ito K, Fukamachi H, Chi XZ, Wee HJ, Inoue K, Ida H, Bouillet P, Strasser A, Bae SC, Ito Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-8952158", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8952158" } ], "reference": [ { "type": "PubMed", "id": "16738314", "url": "https://glygen.org/publication/PubMed/16738314" } ] }, { "title": "p38 MAP kinase mediates apoptosis through phosphorylation of BimEL at Ser-65.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Cai B, Chang SH, Becker EB, Bonni A, Xia Z", "evidence": [ { "database": "iPTMnet", "id": "O43521", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43521" } ], "reference": [ { "type": "PubMed", "id": "16818494", "url": "https://glygen.org/publication/PubMed/16818494" } ] }, { "title": "Epstein-Barr virus represses the FoxO1 transcription factor through latent membrane protein 1 and latent membrane protein 2A.", "journal": "Journal of virology", "date": "2006", "authors": "Shore AM, White PC, Hui RC, Essafi A, Lam EW, Rowe M, Brennan P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9614657", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9614657" } ], "reference": [ { "type": "PubMed", "id": "16943287", "url": "https://glygen.org/publication/PubMed/16943287" } ] }, { "title": "Cdk-inhibitory activity and stability of p27Kip1 are directly regulated by oncogenic tyrosine kinases.", "journal": "Cell", "date": "2007", "authors": "Grimmler M, Wang Y, Mund T, Cilensek Z, Keidel EM, Waddell MB, Jakel H, Kullmann M, Kriwacki RW, Hengst L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9607240", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240" } ], "reference": [ { "type": "PubMed", "id": "17254966", "url": "https://glygen.org/publication/PubMed/17254966" } ] }, { "title": "Studies leading to potent, dual inhibitors of Bcl-2 and Bcl-xL.", "journal": "Journal of medicinal chemistry", "date": "2007", "authors": "Bruncko M, Oost TK, Belli BA, Ding H, Joseph MK, Kunzer A, Martineau D, McClellan WJ, Mitten M, Ng SC, Nimmer PM, Oltersdorf T, Park CM, Petros AM, Shoemaker AR, Song X, Wang X, Wendt MD, Zhang H, Fesik SW, Rosenberg SH, Elmore SW", "evidence": [ { "database": "Reactome", "id": "R-HSA-111453", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-111453" } ], "reference": [ { "type": "PubMed", "id": "17256834", "url": "https://glygen.org/publication/PubMed/17256834" } ] }, { "title": "Apoptosis initiated when BH3 ligands engage multiple Bcl-2 homologs, not Bax or Bak.", "journal": "Science (New York, N.Y.)", "date": "2007", "authors": "Willis SN, Fletcher JI, Kaufmann T, van Delft MF, Chen L, Czabotar PE, Ierino H, Lee EF, Fairlie WD, Bouillet P, Strasser A, Kluck RM, Adams JM, Huang DC", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "reference": [ { "type": "PubMed", "id": "17289999", "url": "https://glygen.org/publication/PubMed/17289999" } ] }, { "title": "Structural insights into the degradation of Mcl-1 induced by BH3 domains.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2007", "authors": "Czabotar PE, Lee EF, van Delft MF, Day CL, Smith BJ, Huang DC, Fairlie WD, Hinds MG, Colman PM", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "reference": [ { "type": "PubMed", "id": "17389404", "url": "https://glygen.org/publication/PubMed/17389404" } ] }, { "title": "Identification and characterization of BH3 domain protein Bim and its isoforms in human hepatocellular carcinomas.", "journal": "Apoptosis", "date": "2007", "authors": "Miao Ji, Chen George G, Yun Jing-Ping, Chun Suk-Ying, Zheng Zi-Zheng, Ho Rocky L K, Chak Ernest C W, Xia Ning-Shao, Lai Paul B S", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "reference": [ { "type": "PubMed", "id": "17503221", "url": "https://glygen.org/publication/PubMed/17503221" } ] }, { "title": "PINCH-1 regulates the ERK-Bim pathway and contributes to apoptosis resistance in cancer cells.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Chen K, Tu Y, Zhang Y, Blair HC, Zhang L, Wu C", "evidence": [ { "database": "iPTMnet", "id": "O43521", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43521" } ], "reference": [ { "type": "PubMed", "id": "18063582", "url": "https://glygen.org/publication/PubMed/18063582" } ] }, { "title": "FOXO3a is activated in response to hypoxic stress and inhibits HIF1-induced apoptosis via regulation of CITED2.", "journal": "Molecular cell", "date": "2007", "authors": "Bakker WJ, Harris IS, Mak TW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9614657", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9614657" } ], "reference": [ { "type": "PubMed", "id": "18158893", "url": "https://glygen.org/publication/PubMed/18158893" } ] }, { "title": "Activation of the JNK pathway promotes phosphorylation and degradation of BimEL--a novel mechanism of chemoresistance in T-cell acute lymphoblastic leukemia.", "journal": "Carcinogenesis", "date": "2008", "authors": "Leung KT, Li KK, Sun SS, Chan PK, Ooi VE, Chiu LC", "evidence": [ { "database": "iPTMnet", "id": "O43521", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43521" } ], "reference": [ { "type": "PubMed", "id": "18174237", "url": "https://glygen.org/publication/PubMed/18174237" } ] }, { "title": "Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.", "journal": "Journal of proteome research", "date": "2008", "authors": "Cantin GT, Yi W, Lu B, Park SK, Xu T, Lee JD, Yates JR 3rd", "evidence": [ { "database": "iPTMnet", "id": "O43521", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43521" } ], "reference": [ { "type": "PubMed", "id": "18220336", "url": "https://glygen.org/publication/PubMed/18220336" } ] }, { "title": "A novel paradigm for rapid ABT-737-induced apoptosis involving outer mitochondrial membrane rupture in primary leukemia and lymphoma cells.", "journal": "Cell death and differentiation", "date": "2008", "authors": "Vogler M, Dinsdale D, Sun XM, Young KW, Butterworth M, Nicotera P, Dyer MJ, Cohen GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-111453", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-111453" } ], "reference": [ { "type": "PubMed", "id": "18309326", "url": "https://glygen.org/publication/PubMed/18309326" } ] }, { "title": "A brief introduction to FOXOlogy.", "journal": "Oncogene", "date": "2008", "authors": "Burgering BM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9607240", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240" } ], "reference": [ { "type": "PubMed", "id": "18391968", "url": "https://glygen.org/publication/PubMed/18391968" } ] }, { "title": "ABT-263: a potent and orally bioavailable Bcl-2 family inhibitor.", "journal": "Cancer research", "date": "2008", "authors": "Tse C, Shoemaker AR, Adickes J, Anderson MG, Chen J, Jin S, Johnson EF, Marsh KC, Mitten MJ, Nimmer P, Roberts L, Tahir SK, Xiao Y, Yang X, Zhang H, Fesik S, Rosenberg SH, Elmore SW", "evidence": [ { "database": "Reactome", "id": "R-HSA-111453", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-111453" } ], "reference": [ { "type": "PubMed", "id": "18451170", "url": "https://glygen.org/publication/PubMed/18451170" } ] }, { "title": "Multisite phosphorylation regulates Bim stability and apoptotic activity.", "journal": "Molecular cell", "date": "2008", "authors": "Hubner A, Barrett T, Flavell RA, Davis RJ", "evidence": [ { "database": "iPTMnet", "id": "O43521", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43521" } ], "reference": [ { "type": "PubMed", "id": "18498746", "url": "https://glygen.org/publication/PubMed/18498746" } ] }, { "title": "The BH3-only mimetic ABT-737 synergizes the antineoplastic activity of proteasome inhibitors in lymphoid malignancies.", "journal": "Blood", "date": "2008", "authors": "Paoluzzi L, Gonen M, Bhagat G, Furman RR, Gardner JR, Scotto L, Gueorguiev VD, Heaney ML, Manova K, O'Connor OA", "evidence": [ { "database": "Reactome", "id": "R-HSA-111453", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-111453" } ], "reference": [ { "type": "PubMed", "id": "18591385", "url": "https://glygen.org/publication/PubMed/18591385" } ] }, { "title": "Deregulated Cdk5 promotes oxidative stress and mitochondrial dysfunction.", "journal": "Journal of neurochemistry", "date": "2008", "authors": "Sun KH, de Pablo Y, Vincent F, Shah K", "evidence": [ { "database": "Reactome", "id": "R-HSA-8862803", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8862803" } ], "reference": [ { "type": "PubMed", "id": "18691386", "url": "https://glygen.org/publication/PubMed/18691386" } ] }, { "title": "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.", "journal": "Molecular cell", "date": "2008", "authors": "Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M", "evidence": [ { "database": "iPTMnet", "id": "O43521-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43521-1" } ], "reference": [ { "type": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" } ] }, { "title": "Oncogenic BRAF(V600E) inhibits BIM expression to promote melanoma cell survival.", "journal": "Pigment cell & melanoma research", "date": "2008", "authors": "Cartlidge RA, Thomas GR, Cagnol S, Jong KA, Molton SA, Finch AJ, McMahon M", "evidence": [ { "database": "iPTMnet", "id": "O43521", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43521" } ], "reference": [ { "type": "PubMed", "id": "18715233", "url": "https://glygen.org/publication/PubMed/18715233" } ] }, { "title": "Age-dependent FOXO regulation of p27Kip1 expression via a conserved binding motif in rat muscle precursor cells.", "journal": "American journal of physiology. Cell physiology", "date": "2008", "authors": "Lees SJ, Childs TE, Booth FW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9607240", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240" } ], "reference": [ { "type": "PubMed", "id": "18787071", "url": "https://glygen.org/publication/PubMed/18787071" } ] }, { "title": "Completing the family portrait of the anti-apoptotic Bcl-2 proteins: crystal structure of human Bfl-1 in complex with Bim.", "journal": "FEBS Lett.", "date": "2008", "authors": "Herman Maria Dolores, Nyman Tomas, Welin Martin, Lehti\u00f6 Lari, Flodin Susanne, Tr\u00e9saugues Lionel, Kotenyova Tetyana, Flores Alex, Nordlund P\u00e4r", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "reference": [ { "type": "PubMed", "id": "18812174", "url": "https://glygen.org/publication/PubMed/18812174" } ] }, { "title": "Tandem duplication producing a novel oncogenic BRAF fusion gene defines the majority of pilocytic astrocytomas.", "journal": "Cancer research", "date": "2008", "authors": "Jones DT, Kocialkowski S, Liu L, Pearson DM, Backlund LM, Ichimura K, Collins VP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6802952", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6802952" } ], "reference": [ { "type": "PubMed", "id": "18974108", "url": "https://glygen.org/publication/PubMed/18974108" } ] }, { "title": "BH3-only protein Bim more critical than Puma in tyrosine kinase inhibitor-induced apoptosis of human leukemic cells and transduced hematopoietic progenitors carrying oncogenic FLT3.", "journal": "Blood", "date": "2009", "authors": "Nordigarden A, Kraft M, Eliasson P, Labi V, Lam EW, Villunger A, Jonsson JI", "evidence": [ { "database": "Reactome", "id": "R-HSA-9607240", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240" } ], "reference": [ { "type": "PubMed", "id": "19064725", "url": "https://glygen.org/publication/PubMed/19064725" } ] }, { "title": "p27Kip1 inhibits cyclin D-cyclin-dependent kinase 4 by two independent modes.", "journal": "Molecular and cellular biology", "date": "2009", "authors": "Ray A, James MK, Larochelle S, Fisher RP, Blain SW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9607240", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240" } ], "reference": [ { "type": "PubMed", "id": "19075005", "url": "https://glygen.org/publication/PubMed/19075005" } ] }, { "title": "A role of Gab2 association in Flt3 ITD mediated Stat5 phosphorylation and cell survival.", "journal": "British journal of haematology", "date": "2009", "authors": "Masson K, Liu T, Khan R, Sun J, Ronnstrand L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9607240", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240" } ], "reference": [ { "type": "PubMed", "id": "19438505", "url": "https://glygen.org/publication/PubMed/19438505" } ] }, { "title": "Oncogenic Flt3 receptors display different specificity and kinetics of autophosphorylation.", "journal": "Experimental hematology", "date": "2009", "authors": "Razumovskaya E, Masson K, Khan R, Bengtsson S, Ronnstrand L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9607240", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240" } ], "reference": [ { "type": "PubMed", "id": "19477218", "url": "https://glygen.org/publication/PubMed/19477218" } ] }, { "title": "A frequent kinase domain mutation that changes the interaction between PI3Kalpha and the membrane.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Mandelker D, Gabelli SB, Schmidt-Kittler O, Zhu J, Cheong I, Huang CH, Kinzler KW, Vogelstein B, Amzel LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9607240", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240" } ], "reference": [ { "type": "PubMed", "id": "19805105", "url": "https://glygen.org/publication/PubMed/19805105" } ] }, { "title": "Rearrangements of the RAF kinase pathway in prostate cancer, gastric cancer and melanoma.", "journal": "Nature medicine", "date": "2010", "authors": "Palanisamy N, Ateeq B, Kalyana-Sundaram S, Pflueger D, Ramnarayanan K, Shankar S, Han B, Cao Q, Cao X, Suleman K, Kumar-Sinha C, Dhanasekaran SM, Chen YB, Esgueva R, Banerjee S, LaFargue CJ, Siddiqui J, Demichelis F, Moeller P, Bismar TA, Kuefer R, Fullen DR, Johnson TM, Greenson JK, Giordano TJ, Tan P, Tomlins SA, Varambally S, Rubin MA, Maher CA, Chinnaiyan AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6802952", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6802952" } ], "reference": [ { "type": "PubMed", "id": "20526349", "url": "https://glygen.org/publication/PubMed/20526349" } ] }, { "title": "PUMA induction by FoxO3a mediates the anticancer activities of the broad-range kinase inhibitor UCN-01.", "journal": "Molecular cancer therapeutics", "date": "2010", "authors": "Dudgeon C, Wang P, Sun X, Peng R, Sun Q, Yu J, Zhang L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9614657", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9614657" } ], "reference": [ { "type": "PubMed", "id": "20978166", "url": "https://glygen.org/publication/PubMed/20978166" } ] }, { "title": "Bim and Mcl-1 exert key roles in regulating JAK2V617F cell survival.", "journal": "BMC cancer", "date": "2011", "authors": "Rubert J, Qian Z, Andraos R, Guthy DA, Radimerski T", "evidence": [ { "database": "iPTMnet", "id": "O43521", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43521" } ], "reference": [ { "type": "PubMed", "id": "21247487", "url": "https://glygen.org/publication/PubMed/21247487" } ] }, { "title": "Structural insights into the extracellular assembly of the hematopoietic Flt3 signaling complex.", "journal": "Blood", "date": "2011", "authors": "Verstraete K, Vandriessche G, Januar M, Elegheert J, Shkumatov AV, Desfosses A, Van Craenenbroeck K, Svergun DI, Gutsche I, Vergauwen B, Savvides SN", "evidence": [ { "database": "Reactome", "id": "R-HSA-9607240", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240" } ], "reference": [ { "type": "PubMed", "id": "21389326", "url": "https://glygen.org/publication/PubMed/21389326" } ] }, { "title": "Oncogenic FAM131B-BRAF fusion resulting from 7q34 deletion comprises an alternative mechanism of MAPK pathway activation in pilocytic astrocytoma.", "journal": "Acta neuropathologica", "date": "2011", "authors": "Cin H, Meyer C, Herr R, Janzarik WG, Lambert S, Jones DT, Jacob K, Benner A, Witt H, Remke M, Bender S, Falkenstein F, Van Anh TN, Olbrich H, von Deimling A, Pekrun A, Kulozik AE, Gnekow A, Scheurlen W, Witt O, Omran H, Jabado N, Collins VP, Brummer T, Marschalek R, Lichter P, Korshunov A, Pfister SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6802952", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6802952" } ], "reference": [ { "type": "PubMed", "id": "21424530", "url": "https://glygen.org/publication/PubMed/21424530" } ] }, { "title": "Identification of a novel Bcl-2-interacting mediator of cell death (Bim) E3 ligase, tripartite motif-containing protein 2 (TRIM2), and its role in rapid ischemic tolerance-induced neuroprotection.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Thompson S, Pearson AN, Ashley MD, Jessick V, Murphy BM, Gafken P, Henshall DC, Morris KT, Simon RP, Meller R", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "reference": [ { "type": "PubMed", "id": "21478148", "url": "https://glygen.org/publication/PubMed/21478148" } ] }, { "title": "Dynamics of the phosphoinositide 3-kinase p110delta interaction with p85alpha and membranes reveals aspects of regulation distinct from p110alpha.", "journal": "Structure (London, England : 1993)", "date": "2011", "authors": "Burke JE, Vadas O, Berndt A, Finegan T, Perisic O, Williams RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9607240", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240" } ], "reference": [ { "type": "PubMed", "id": "21827948", "url": "https://glygen.org/publication/PubMed/21827948" } ] }, { "title": "Cyclin B1 interacts with the BH3-only protein Bim and mediates its phosphorylation by Cdk1 during mitosis.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2011", "authors": "Mac Fhearraigh S, Mc Gee MM", "evidence": [ { "database": "iPTMnet", "id": "O43521", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43521" } ], "reference": [ { "type": "PubMed", "id": "22071694", "url": "https://glygen.org/publication/PubMed/22071694" } ] }, { "title": "Gene expression of the tumour suppressor LKB1 is mediated by Sp1, NF-Y and FOXO transcription factors.", "journal": "PloS one", "date": "2012", "authors": "Lutzner N, De-Castro Arce J, Rosl F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9614657", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9614657" } ], "reference": [ { "type": "PubMed", "id": "22412893", "url": "https://glygen.org/publication/PubMed/22412893" } ] }, { "title": "A common BIM deletion polymorphism mediates intrinsic resistance and inferior responses to tyrosine kinase inhibitors in cancer.", "journal": "Nature medicine", "date": "2012", "authors": "Ng KP, Hillmer AM, Chuah CT, Juan WC, Ko TK, Teo AS, Ariyaratne PN, Takahashi N, Sawada K, Fei Y, Soh S, Lee WH, Huang JW, Allen JC Jr, Woo XY, Nagarajan N, Kumar V, Thalamuthu A, Poh WT, Ang AL, Mya HT, How GF, Yang LY, Koh LP, Chowbay B, Chang CT, Nadarajan VS, Chng WJ, Than H, Lim LC, Goh YT, Zhang S, Poh D, Tan P, Seet JE, Ang MK, Chau NM, Ng QS, Tan DS, Soda M, Isobe K, Nothen MM, Wong TY, Shahab A, Ruan X, Cacheux-Rataboul V, Sung WK, Tan EH, Yatabe Y, Mano H, Soo RA, Chin TM, Lim WT, Ruan Y, Ong ST", "evidence": [ { "database": "RefSeq", "id": "NP_001191035", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001191035" } ], "reference": [ { "type": "PubMed", "id": "22426421", "url": "https://glygen.org/publication/PubMed/22426421" } ] }, { "title": "The anti-apoptotic Bcl-B protein inhibits BECN1-dependent autophagic cell death.", "journal": "Autophagy", "date": "2012", "authors": "Robert G, Gastaldi C, Puissant A, Hamouda A, Jacquel A, Dufies M, Belhacene N, Colosetti P, Reed JC, Auberger P, Luciano F", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "reference": [ { "type": "PubMed", "id": "22498477", "url": "https://glygen.org/publication/PubMed/22498477" } ] }, { "title": "Bim inhibits autophagy by recruiting Beclin 1 to microtubules.", "journal": "Molecular cell", "date": "2012-08-10", "authors": "Luo Shouqing, Garcia-Arencibia Moises, Zhao Rui, Puri Claudia, Toh Pearl P C, Sadiq Oana, Rubinsztein David C", "evidence": [ { "database": "iPTMnet", "id": "O43521", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43521" } ], "reference": [ { "type": "PubMed", "id": "22742832", "url": "https://glygen.org/publication/PubMed/22742832" } ] }, { "title": "A novel SND1-BRAF fusion confers resistance to c-Met inhibitor PF-04217903 in GTL16 cells through [corrected] MAPK activation.", "journal": "PloS one", "date": "2012", "authors": "Lee NV, Lira ME, Pavlicek A, Ye J, Buckman D, Bagrodia S, Srinivasa SP, Zhao Y, Aparicio S, Rejto PA, Christensen JG, Ching KA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6802952", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6802952" } ], "reference": [ { "type": "PubMed", "id": "22745804", "url": "https://glygen.org/publication/PubMed/22745804" } ] }, { "title": "CHOP potentially co-operates with FOXO3a in neuronal cells to regulate PUMA and BIM expression in response to ER stress.", "journal": "PLoS ONE", "date": "2012", "authors": "Ghosh Arindam P, Klocke Barbara J, Ballestas Mary E, Roth Kevin A", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "reference": [ { "type": "PubMed", "id": "22761832", "url": "https://glygen.org/publication/PubMed/22761832" } ] }, { "title": "Deregulated Cdk5 triggers aberrant activation of cell cycle kinases and phosphatases inducing neuronal death.", "journal": "Journal of cell science", "date": "2012", "authors": "Chang KH, Vincent F, Shah K", "evidence": [ { "database": "Reactome", "id": "R-HSA-8862803", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8862803" } ], "reference": [ { "type": "PubMed", "id": "22899714", "url": "https://glygen.org/publication/PubMed/22899714" } ] }, { "title": "Direct binding of Grb2 has an important role in the development of myeloproliferative disease induced by ETV6/FLT3.", "journal": "Leukemia", "date": "2013", "authors": "Chonabayashi K, Hishizawa M, Kawamata S, Nagai Y, Ohno T, Ishikawa T, Uchiyama T, Takaori-Kondo A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9607240", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240" } ], "reference": [ { "type": "PubMed", "id": "23168613", "url": "https://glygen.org/publication/PubMed/23168613" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" }, { "database": "iPTMnet", "id": "O43521", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43521" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "The restricted binding repertoire of Bcl-B leaves Bim as the universal BH3-only prosurvival Bcl-2 protein antagonist.", "journal": "Cell Death Dis.", "date": "2012", "authors": "Rautureau G J P, Yabal M, Yang H, Huang D C S, Kvansakul M, Hinds M G", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "reference": [ { "type": "PubMed", "id": "23235460", "url": "https://glygen.org/publication/PubMed/23235460" } ] }, { "title": "FLT3 signals via the adapter protein Grb10 and overexpression of Grb10 leads to aberrant cell proliferation in acute myeloid leukemia.", "journal": "Molecular oncology", "date": "2013", "authors": "Kazi JU, Ronnstrand L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9607240", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240" } ], "reference": [ { "type": "PubMed", "id": "23246379", "url": "https://glygen.org/publication/PubMed/23246379" } ] }, { "title": "ABT-199, a potent and selective BCL-2 inhibitor, achieves antitumor activity while sparing platelets.", "journal": "Nature medicine", "date": "2013", "authors": "Souers AJ, Leverson JD, Boghaert ER, Ackler SL, Catron ND, Chen J, Dayton BD, Ding H, Enschede SH, Fairbrother WJ, Huang DC, Hymowitz SG, Jin S, Khaw SL, Kovar PJ, Lam LT, Lee J, Maecker HL, Marsh KC, Mason KD, Mitten MJ, Nimmer PM, Oleksijew A, Park CH, Park CM, Phillips DC, Roberts AW, Sampath D, Seymour JF, Smith ML, Sullivan GM, Tahir SK, Tse C, Wendt MD, Xiao Y, Xue JC, Zhang H, Humerickhouse RA, Rosenberg SH, Elmore SW", "evidence": [ { "database": "Reactome", "id": "R-HSA-111453", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-111453" } ], "reference": [ { "type": "PubMed", "id": "23291630", "url": "https://glygen.org/publication/PubMed/23291630" } ] }, { "title": "Polyubiquitination and proteasomal turnover controls the anti-apoptotic activity of Bcl-B.", "journal": "Oncogene", "date": "2013", "authors": "van de Kooij B, Rooswinkel RW, Kok F, Herrebout M, de Vries E, Paauwe M, Janssen GM, van Veelen PA, Borst J", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "reference": [ { "type": "PubMed", "id": "23563182", "url": "https://glygen.org/publication/PubMed/23563182" } ] }, { "title": "Whole-genome sequencing identifies genetic alterations in pediatric low-grade gliomas.", "journal": "Nature genetics", "date": "2013", "authors": "Zhang J, Wu G, Miller CP, Tatevossian RG, Dalton JD, Tang B, Orisme W, Punchihewa C, Parker M, Qaddoumi I, Boop FA, Lu C, Kandoth C, Ding L, Lee R, Huether R, Chen X, Hedlund E, Nagahawatte P, Rusch M, Boggs K, Cheng J, Becksfort J, Ma J, Song G, Li Y, Wei L, Wang J, Shurtleff S, Easton J, Zhao D, Fulton RS, Fulton LL, Dooling DJ, Vadodaria B, Mulder HL, Tang C, Ochoa K, Mullighan CG, Gajjar A, Kriwacki R, Sheer D, Gilbertson RJ, Mardis ER, Wilson RK, Downing JR, Baker SJ, Ellison DW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6802952", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6802952" } ], "reference": [ { "type": "PubMed", "id": "23583981", "url": "https://glygen.org/publication/PubMed/23583981" } ] }, { "title": "miR-421 induces cell proliferation and apoptosis resistance in human nasopharyngeal carcinoma via downregulation of FOXO4.", "journal": "Biochemical and biophysical research communications", "date": "2013", "authors": "Chen L, Tang Y, Wang J, Yan Z, Xu R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9614657", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9614657" } ], "reference": [ { "type": "PubMed", "id": "23707940", "url": "https://glygen.org/publication/PubMed/23707940" } ] }, { "title": "Identification of kinase fusion oncogenes in post-Chernobyl radiation-induced thyroid cancers.", "journal": "The Journal of clinical investigation", "date": "2013", "authors": "Ricarte-Filho JC, Li S, Garcia-Rendueles ME, Montero-Conde C, Voza F, Knauf JA, Heguy A, Viale A, Bogdanova T, Thomas GA, Mason CE, Fagin JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6802952", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6802952" } ], "reference": [ { "type": "PubMed", "id": "24135138", "url": "https://glygen.org/publication/PubMed/24135138" } ] }, { "title": "BRAF fusions define a distinct molecular subset of melanomas with potential sensitivity to MEK inhibition.", "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research", "date": "2013", "authors": "Hutchinson KE, Lipson D, Stephens PJ, Otto G, Lehmann BD, Lyle PL, Vnencak-Jones CL, Ross JS, Pietenpol JA, Sosman JA, Puzanov I, Miller VA, Pao W", "evidence": [ { "database": "Reactome", "id": "R-HSA-6802952", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6802952" } ], "reference": [ { "type": "PubMed", "id": "24345920", "url": "https://glygen.org/publication/PubMed/24345920" } ] }, { "title": "Selective BCL-2 inhibition by ABT-199 causes on-target cell death in acute myeloid leukemia.", "journal": "Cancer discovery", "date": "2014", "authors": "Pan R, Hogdal LJ, Benito JM, Bucci D, Han L, Borthakur G, Cortes J, DeAngelo DJ, Debose L, Mu H, Dohner H, Gaidzik VI, Galinsky I, Golfman LS, Haferlach T, Harutyunyan KG, Hu J, Leverson JD, Marcucci G, Muschen M, Newman R, Park E, Ruvolo PP, Ruvolo V, Ryan J, Schindela S, Zweidler-McKay P, Stone RM, Kantarjian H, Andreeff M, Konopleva M, Letai AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-111453", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-111453" } ], "reference": [ { "type": "PubMed", "id": "24346116", "url": "https://glygen.org/publication/PubMed/24346116" } ] }, { "title": "Hsp27 binding to the 3'UTR of bim mRNA prevents neuronal death during oxidative stress-induced injury: a novel cytoprotective mechanism.", "journal": "Molecular biology of the cell", "date": "2014", "authors": "Davila D, Jimenez-Mateos EM, Mooney CM, Velasco G, Henshall DC, Prehn JH", "evidence": [ { "database": "iPTMnet", "id": "O43521", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43521" } ], "reference": [ { "type": "PubMed", "id": "25187648", "url": "https://glygen.org/publication/PubMed/25187648" } ] }, { "title": "The landscape of kinase fusions in cancer.", "journal": "Nature communications", "date": "2014", "authors": "Stransky N, Cerami E, Schalm S, Kim JL, Lengauer C", "evidence": [ { "database": "Reactome", "id": "R-HSA-6802952", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6802952" } ], "reference": [ { "type": "PubMed", "id": "25204415", "url": "https://glygen.org/publication/PubMed/25204415" } ] }, { "title": "Regulation of RAF protein kinases in ERK signalling.", "journal": "Nature reviews. Molecular cell biology", "date": "2015", "authors": "Lavoie H, Therrien M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6802952", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6802952" } ], "reference": [ { "type": "PubMed", "id": "25907612", "url": "https://glygen.org/publication/PubMed/25907612" } ] }, { "title": "Targeting ERK1/2-bim signaling cascades by BH3-mimetic ABT-737 as an alternative therapeutic strategy for oral cancer.", "journal": "Oncotarget", "date": "2015", "authors": "Shin JA, Kim LH, Lee SJ, Jeong JH, Jung JY, Lee HN, Hong IS, Cho SD", "evidence": [ { "database": "iPTMnet", "id": "O43521", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43521" } ], "reference": [ { "type": "PubMed", "id": "26447615", "url": "https://glygen.org/publication/PubMed/26447615" } ] }, { "title": "microRNA-150 promotes cervical cancer cell growth and survival by targeting FOXO4.", "journal": "BMC molecular biology", "date": "2015", "authors": "Li J, Hu L, Tian C, Lu F, Wu J, Liu L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9614657", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9614657" } ], "reference": [ { "type": "PubMed", "id": "26715362", "url": "https://glygen.org/publication/PubMed/26715362" } ] }, { "title": "Mitotic cell death caused by follistatin-like 1 inhibition is associated with up-regulated Bim by inactivated Erk1/2 in human lung cancer cells.", "journal": "Oncotarget", "date": "2016", "authors": "Bae K, Park KE, Han J, Kim J, Kim K, Yoon KA", "evidence": [ { "database": "iPTMnet", "id": "O43521", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43521" } ], "reference": [ { "type": "PubMed", "id": "26716515", "url": "https://glygen.org/publication/PubMed/26716515" } ] }, { "title": "Expression of GADS enhances FLT3-induced mitogenic signaling.", "journal": "Oncotarget", "date": "2016", "authors": "Chougule RA, Cordero E, Moharram SA, Pietras K, Ronnstrand L, Kazi JU", "evidence": [ { "database": "Reactome", "id": "R-HSA-9607240", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240" } ], "reference": [ { "type": "PubMed", "id": "26895103", "url": "https://glygen.org/publication/PubMed/26895103" } ] }, { "title": "missing tag=TI", "journal": "missing tag=JT", "date": "missing", "authors": "author information missing", "evidence": [ { "database": "Reactome", "id": "R-HSA-8862803", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8862803" } ], "reference": [ { "type": "PubMed", "id": "26962010", "url": "https://glygen.org/publication/PubMed/26962010" } ] }, { "title": "The deubiquitinase Usp27x stabilizes the BH3-only protein Bim and enhances apoptosis.", "journal": "EMBO Rep.", "date": "2016", "authors": "Weber A, Heinlein M, Dengjel J, Alber C, Singh PK, Hacker G", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "reference": [ { "type": "PubMed", "id": "27013495", "url": "https://glygen.org/publication/PubMed/27013495" } ] }, { "title": "Insulin Downregulates the Transcriptional Coregulator CITED2, an Inhibitor of Proangiogenic Function in Endothelial Cells.", "journal": "Diabetes", "date": "2016", "authors": "Wang X, Lockhart SM, Rathjen T, Albadawi H, Sorensen D, O'Neill BT, Dwivedi N, Preil SR, Beck HC, Dunwoodie SL, Watkins MT, Rasmussen LM, Rask-Madsen C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9614657", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9614657" } ], "reference": [ { "type": "PubMed", "id": "27561725", "url": "https://glygen.org/publication/PubMed/27561725" } ] }, { "title": "Acquired resistance to venetoclax (ABT-199) in t(14;18) positive lymphoma cells.", "journal": "Oncotarget", "date": "2016", "authors": "Bodo J, Zhao X, Durkin L, Souers AJ, Phillips DC, Smith MR, Hsi ED", "evidence": [ { "database": "iPTMnet", "id": "O43521", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43521" } ], "reference": [ { "type": "PubMed", "id": "27661108", "url": "https://glygen.org/publication/PubMed/27661108" } ] }, { "title": "FLT3 and FLT3-ITD phosphorylate and inactivate the cyclin-dependent kinase inhibitor p27(Kip1) in acute myeloid leukemia.", "journal": "Haematologica", "date": "2017", "authors": "Peschel I, Podmirseg SR, Taschler M, Duyster J, Gotze KS, Sill H, Nachbaur D, Jakel H, Hengst L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9607240", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240" } ], "reference": [ { "type": "PubMed", "id": "28522571", "url": "https://glygen.org/publication/PubMed/28522571" } ] }, { "title": "FLT3 Inhibitors in Acute Myeloid Leukemia: Current Status and Future Directions.", "journal": "Molecular cancer therapeutics", "date": "2017", "authors": "Larrosa-Garcia M, Baer MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9607240", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240" } ], "reference": [ { "type": "PubMed", "id": "28576946", "url": "https://glygen.org/publication/PubMed/28576946" } ] }, { "title": "Molecular targeting in acute myeloid leukemia.", "journal": "Journal of translational medicine", "date": "2017", "authors": "Lim SH, Dubielecka PM, Raghunathan VM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9607240", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240" } ], "reference": [ { "type": "PubMed", "id": "28851395", "url": "https://glygen.org/publication/PubMed/28851395" } ] }, { "title": "The Imipridone ONC201 Induces Apoptosis and Overcomes Chemotherapy Resistance by Up-Regulation of Bim in Multiple Myeloma.", "journal": "Neoplasia (New York, N.Y.)", "date": "2017", "authors": "Tu YS, He J, Liu H, Lee HC, Wang H, Ishizawa J, Allen JE, Andreeff M, Orlowski RZ, Davis RE, Yang J", "evidence": [ { "database": "iPTMnet", "id": "O43521", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43521" } ], "reference": [ { "type": "PubMed", "id": "28863346", "url": "https://glygen.org/publication/PubMed/28863346" } ] }, { "title": "FoxO transcription factors in cancer metabolism.", "journal": "Seminars in cancer biology", "date": "2018", "authors": "Yadav RK, Chauhan AS, Zhuang L, Gan B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9607240", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240" } ], "reference": [ { "type": "PubMed", "id": "29309929", "url": "https://glygen.org/publication/PubMed/29309929" } ] }, { "title": "Autophagy Inhibition Mediates Apoptosis Sensitization in Cancer Therapy by Relieving FOXO3a Turnover.", "journal": "Developmental cell", "date": "2018", "authors": "Fitzwalter BE, Towers CG, Sullivan KD, Andrysik Z, Hoh M, Ludwig M, O'Prey J, Ryan KM, Espinosa JM, Morgan MJ, Thorburn A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9614657", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9614657" } ], "reference": [ { "type": "PubMed", "id": "29533771", "url": "https://glygen.org/publication/PubMed/29533771" } ] }, { "title": "Structural and clinical consequences of activation loop mutations in class III receptor tyrosine kinases.", "journal": "Pharmacology & therapeutics", "date": "2018", "authors": "Klug LR, Kent JD, Heinrich MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9607240", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240" } ], "reference": [ { "type": "PubMed", "id": "29964125", "url": "https://glygen.org/publication/PubMed/29964125" } ] }, { "title": "FMS-like Tyrosine Kinase 3/FLT3: From Basic Science to Clinical Implications.", "journal": "Physiological reviews", "date": "2019", "authors": "Kazi JU, Ronnstrand L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9607240", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240" } ], "reference": [ { "type": "PubMed", "id": "31066629", "url": "https://glygen.org/publication/PubMed/31066629" } ] }, { "title": "MicroRNA-17-5p Protects against Propofol Anesthesia-Induced Neurotoxicity and Autophagy Impairment via Targeting BCL2L11.", "journal": "Computational and mathematical methods in medicine", "date": "2022", "authors": "Xiu M, Luan H, Gu X, Liu C, Xu D", "evidence": [ { "database": "RefSeq", "id": "NP_001191035", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001191035" } ], "reference": [ { "type": "PubMed", "id": "35799645", "url": "https://glygen.org/publication/PubMed/35799645" } ] }, { "title": "miR-24-3p down-regulates the expression of the apoptotic factors FasL and BIM in human natural killer cells.", "journal": "Cellular signalling", "date": "2022", "authors": "Regis S, Dondero A, Spaggiari GM, Serra M, Caliendo F, Bottino C, Castriconi R", "evidence": [ { "database": "RefSeq", "id": "NP_001191035", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001191035" } ], "reference": [ { "type": "PubMed", "id": "35870695", "url": "https://glygen.org/publication/PubMed/35870695" } ] }, { "title": "Dach1 deficiency drives alveolar epithelium apoptosis in pulmonary fibrosis via modulating C-Jun/Bim activity.", "journal": "Translational research : the journal of laboratory and clinical medicine", "date": "2023-02-06", "authors": "Lu Yanjiao, Tang Kum, Wang Shanshan, Tian Zhen, Fan Yan, Li Boyu, Wang Meijia, Zhao Jianping, Xie Jungang", "evidence": [ { "database": "RefSeq", "id": "NP_001191035", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001191035" } ], "reference": [ { "type": "PubMed", "id": "36754276", "url": "https://glygen.org/publication/PubMed/36754276" } ] }, { "title": "Expression Levels of MicroRNA-300/BCL2L11 in Papillary Thyroid Cancer and Their Clinical Diagnostic Values.", "journal": "European surgical research. Europaische chirurgische Forschung. Recherches chirurgicales europeennes", "date": "2023", "authors": "Shen Yi, Li Xiaoen, Xie Rongli, Chen Yupan, Hu Xun, Liu Yaping, Ma He", "evidence": [ { "database": "RefSeq", "id": "NP_001191035", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001191035" } ], "reference": [ { "type": "PubMed", "id": "37231813", "url": "https://glygen.org/publication/PubMed/37231813" } ] }, { "title": "Non-canonical BIM-regulated energy metabolism determines drug-induced liver necrosis.", "journal": "Cell death and differentiation", "date": "2024-01", "authors": "Lambrecht Rebekka, Rudolf Franziska, \u00dcckert Anna-Katharina, Sladky Valentina C, Phan Truong San, Jansen Jasmin, Naim Samara, Kaufmann Thomas, Keogh Adrian, Kirschnek Susanne, Mangerich Aswin, Stengel Florian, Leist Marcel, Villunger Andreas, Brunner Thomas", "evidence": [ { "database": "RefSeq", "id": "NP_001191035", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001191035" } ], "reference": [ { "type": "PubMed", "id": "38001256", "url": "https://glygen.org/publication/PubMed/38001256" } ] }, { "title": "Preference of calcium-dependent interactions between calmodulin-like domains of calpain and calpastatin subdomains.", "journal": "FEBS letters", "date": "1995", "authors": "Takano E, Ma H, Yang HQ, Maki M, Hatanaka M", "evidence": [ { "database": "Reactome", "id": "R-HSA-8862803", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8862803" } ], "reference": [ { "type": "PubMed", "id": "7698360", "url": "https://glygen.org/publication/PubMed/7698360" } ] }, { "title": "Bad, a heterodimeric partner for Bcl-XL and Bcl-2, displaces Bax and promotes cell death.", "journal": "Cell", "date": "1995", "authors": "Yang E, Zha J, Jockel J, Boise LH, Thompson CB, Korsmeyer SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-111453", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-111453" } ], "reference": [ { "type": "PubMed", "id": "7834748", "url": "https://glygen.org/publication/PubMed/7834748" } ] }, { "title": "Ligand for FLT3/FLK2 receptor tyrosine kinase regulates growth of haematopoietic stem cells and is encoded by variant RNAs.", "journal": "Nature", "date": "1994", "authors": "Hannum C, Culpepper J, Campbell D, McClanahan T, Zurawski S, Bazan JF, Kastelein R, Hudak S, Wagner J, Mattson J, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-9607240", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240" } ], "reference": [ { "type": "PubMed", "id": "8145851", "url": "https://glygen.org/publication/PubMed/8145851" } ] }, { "title": "Guanine-nucleotide-releasing factor hSos1 binds to Grb2 and links receptor tyrosine kinases to Ras signalling.", "journal": "Nature", "date": "1993", "authors": "Li N, Batzer A, Daly R, Yajnik V, Skolnik E, Chardin P, Bar-Sagi D, Margolis B, Schlessinger J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9607240", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240" } ], "reference": [ { "type": "PubMed", "id": "8479541", "url": "https://glygen.org/publication/PubMed/8479541" } ] }, { "title": "Crystal structure of calcium bound domain VI of calpain at 1.9 A resolution and its role in enzyme assembly, regulation, and inhibitor binding.", "journal": "Nature structural biology", "date": "1997", "authors": "Lin GD, Chattopadhyay D, Maki M, Wang KK, Carson M, Jin L, Yuen PW, Takano E, Hatanaka M, DeLucas LJ, Narayana SV", "evidence": [ { "database": "Reactome", "id": "R-HSA-8862803", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8862803" } ], "reference": [ { "type": "PubMed", "id": "9228946", "url": "https://glygen.org/publication/PubMed/9228946" } ] }, { "title": "Bim: a novel member of the Bcl-2 family that promotes apoptosis.", "journal": "The EMBO journal", "date": "1998", "authors": "O'Connor L, Strasser A, O'Reilly LA, Hausmann G, Adams JM, Cory S, Huang DC", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "reference": [ { "type": "PubMed", "id": "9430630", "url": "https://glygen.org/publication/PubMed/9430630" } ] }, { "title": "The small GTP-binding protein Cdc42 is required for nerve growth factor withdrawal-induced neuronal death.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Bazenet CE, Mota MA, Rubin LL", "evidence": [ { "database": "Reactome", "id": "R-HSA-193648", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-193648" } ], "reference": [ { "type": "PubMed", "id": "9520479", "url": "https://glygen.org/publication/PubMed/9520479" } ] }, { "title": "p85 subunit of PI3 kinase does not bind to human Flt3 receptor, but associates with SHP2, SHIP, and a tyrosine-phosphorylated 100-kDa protein in Flt3 ligand-stimulated hematopoietic cells.", "journal": "Biochemical and biophysical research communications", "date": "1999", "authors": "Zhang S, Broxmeyer HE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9607240", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240" } ], "reference": [ { "type": "PubMed", "id": "9918857", "url": "https://glygen.org/publication/PubMed/9918857" } ] } ], "pathway": [ { "id": "hsa:10018", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:10018", "resource": "KEGG Pathway" }, { "id": "R-HSA-111446", "name": "Activation of BIM and translocation to mitochondria", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-111446", "resource": "Reactome", "description": "Activation of BIM and translocation to mitochondria" }, { "id": "R-HSA-111453", "name": "BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-111453", "resource": "Reactome", "description": "BH3-only proteins associate with and inactivate anti-apoptotic BCL-2 members" }, { "id": "R-HSA-193648", "name": "NRAGE signals death through JNK", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-193648", "resource": "Reactome", "description": "NRAGE signals death through JNK" }, { "id": "R-HSA-6802952", "name": "Signaling by BRAF and RAF1 fusions", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6802952", "resource": "Reactome", "description": "Signaling by BRAF and RAF1 fusions" }, { "id": "R-HSA-8862803", "name": "Deregulated CDK5 triggers multiple neurodegenerative pathways in Alzheimer's disease models", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8862803", "resource": "Reactome", "description": "Deregulated CDK5 triggers multiple neurodegenerative pathways in Alzheimer's disease models" }, { "id": "R-HSA-8952158", "name": "RUNX3 regulates BCL2L11 (BIM) transcription", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8952158", "resource": "Reactome", "description": "RUNX3 regulates BCL2L11 (BIM) transcription" }, { "id": "R-HSA-9607240", "name": "FLT3 Signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9607240", "resource": "Reactome", "description": "FLT3 Signaling" }, { "id": "R-HSA-9614657", "name": "FOXO-mediated transcription of cell death genes", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9614657", "resource": "Reactome", "description": "FOXO-mediated transcription of cell death genes" } ], "orthologs": [ { "uniprot_canonical_ac": "O54918-1", "protein_name": "Bcl-2-like protein 11", "gene_name": "Bcl2l11", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTEPQGNPDGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPEDLRPEIRIAQELRRIGDEFNETYTRRVFANDYREAEDHPQMVILQLLRFIFRLVWRRH", "length": 196 }, "evidence": [ { "id": "45922270", "url": "http://www.informatics.jax.org/homology/45922270", "database": "MGI" }, { "id": "O43521", "url": "https://omabrowser.org/oma/group/O43521/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "O88498-1", "protein_name": "Bcl-2-like protein 11", "gene_name": "Bcl2l11", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MAKQPSDVNSECDREGGQLQPAERPPQLRPGAPTSLQTESQGNPDGEGDRCPHGSPQGPLAPPASPGPFATRSPLFIFVRRSSLLSRSSSGYFSFDTDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASIRQSQEEPEDLRPEIRIAQELRRIGDEFNETYTRRAFANDYREAEDHPQMVILQLLRFIFRLVWRRH", "length": 196 }, "evidence": [ { "id": "45922270", "url": "http://www.informatics.jax.org/homology/45922270", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "molecular adaptor activity", "id": "GO:0060090", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060090", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "pmid": "" }, { "name": "microtubule binding", "id": "GO:0008017", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008017", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "pmid": "" }, { "name": "protein kinase binding", "id": "GO:0019901", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019901", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 39, "go_terms": [ { "name": "in utero embryonic development", "id": "GO:0001701", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001701", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "pmid": "" }, { "name": "spermatogenesis", "id": "GO:0007283", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007283", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "pmid": "" }, { "name": "positive regulation of apoptotic process", "id": "GO:0043065", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043065", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "pmid": "" }, { "name": "kidney development", "id": "GO:0001822", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001822", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "pmid": "" }, { "name": "apoptotic process", "id": "GO:0006915", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006915", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "pmid": "" }, { "name": "cell-matrix adhesion", "id": "GO:0007160", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007160", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "pmid": "" }, { "name": "activation of cysteine-type endopeptidase activity involved in apoptotic process", "id": "GO:0006919", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006919", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "pmid": "" }, { "name": "male gonad development", "id": "GO:0008584", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008584", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "pmid": "" }, { "name": "positive regulation of protein-containing complex assembly", "id": "GO:0031334", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031334", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "pmid": "" }, { "name": "intrinsic apoptotic signaling pathway in response to DNA damage", "id": "GO:0008630", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008630", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "pmid": "" }, { "name": "post-embryonic development", "id": "GO:0009791", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009791", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "pmid": "" }, { "name": "spleen development", "id": "GO:0048536", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048536", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "pmid": "" }, { "name": "thymus development", "id": "GO:0048538", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048538", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "pmid": "" }, { "name": "positive regulation of IRE1-mediated unfolded protein response", "id": "GO:1903896", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903896", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "pmid": "" }, { "name": "regulation of apoptotic process", "id": "GO:0042981", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042981", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "pmid": "" }, { "name": "odontogenesis of dentin-containing tooth", "id": "GO:0042475", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042475", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "pmid": "" }, { "name": "positive regulation of neuron apoptotic process", "id": "GO:0043525", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043525", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "pmid": "" }, { "name": "positive regulation of cell cycle", "id": "GO:0045787", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045787", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "pmid": "" }, { "name": "T cell homeostasis", "id": "GO:0043029", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043029", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "pmid": "" }, { "name": "positive regulation of release of cytochrome c from mitochondria", "id": "GO:0090200", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090200", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "pmid": "" }, { "name": "positive regulation of endoplasmic reticulum stress-induced intrinsic apoptotic signaling pathway", "id": "GO:1902237", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902237", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "pmid": "" }, { "name": "positive regulation of intrinsic apoptotic signaling pathway", "id": "GO:2001244", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2001244", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "pmid": "" }, { "name": "response to endoplasmic reticulum stress", "id": "GO:0034976", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034976", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "pmid": "" }, { "name": "cellular response to glucocorticoid stimulus", "id": "GO:0071385", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071385", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "pmid": "" }, { "name": "B cell homeostasis", "id": "GO:0001782", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001782", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "pmid": "" }, { "name": "myeloid cell homeostasis", "id": "GO:0002262", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002262", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "pmid": "" }, { "name": "thymocyte apoptotic process", "id": "GO:0070242", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070242", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "pmid": "" }, { "name": "extrinsic apoptotic signaling pathway in absence of ligand", "id": "GO:0097192", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097192", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "pmid": "" }, { "name": "positive regulation of mitochondrial membrane permeability involved in apoptotic process", "id": "GO:1902110", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902110", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "pmid": "" }, { "name": "apoptotic process involved in embryonic digit morphogenesis", "id": "GO:1902263", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902263", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "pmid": "" }, { "name": "mammary gland development", "id": "GO:0030879", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030879", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "pmid": "" }, { "name": "tube formation", "id": "GO:0035148", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035148", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "pmid": "" }, { "name": "ear development", "id": "GO:0043583", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043583", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "pmid": "" }, { "name": "regulation of organ growth", "id": "GO:0046620", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046620", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "pmid": "" }, { "name": "developmental pigmentation", "id": "GO:0048066", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048066", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "pmid": "" }, { "name": "regulation of developmental pigmentation", "id": "GO:0048070", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048070", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "pmid": "" }, { "name": "positive regulation of fibroblast apoptotic process", "id": "GO:2000271", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000271", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "pmid": "" }, { "name": "positive regulation of T cell apoptotic process", "id": "GO:0070234", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070234", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "pmid": "" }, { "name": "meiosis I", "id": "GO:0007127", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007127", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 7, "go_terms": [ { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "pmid": "" }, { "name": "mitochondrial outer membrane", "id": "GO:0005741", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005741", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "pmid": "" }, { "name": "endomembrane system", "id": "GO:0012505", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0012505", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "pmid": "" }, { "name": "Bcl-2 family protein complex", "id": "GO:0097136", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097136", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "pmid": "" }, { "name": "BIM-BCL-xl complex", "id": "GO:0097140", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097140", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "pmid": "" }, { "name": "BIM-BCL-2 complex", "id": "GO:0097141", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097141", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [ { "annotation": "Phosphorylation at Ser-69 by MAPK1/MAPK3 leads to interaction with TRIM2 and polyubiquitination, followed by proteasomal degradation (PubMed:15486195, PubMed:21478148). Deubiquitination catalyzed by USP27X stabilizes the protein (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "O43521", "url": "https://www.uniprot.org/uniprot/O43521" }, { "database": "PubMed", "id": "15486195", "url": "https://glygen.org/publication/PubMed/15486195" }, { "database": "PubMed", "id": "21478148", "url": "https://glygen.org/publication/PubMed/21478148" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [ 153, 156, 185 ], "glycation_sites": [], "phosphorylation_sites": [ 59, 69, 77, 87, 94, 104, 116, 118 ], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 26 }, { "field": "total_sites", "count": 8 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 128 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }