{ "uniprot_canonical_ac": "O43294-1", "uniprot_ac": "O43294", "uniprot_id": "TGFI1_HUMAN", "mass": { "chemical_mass": 49814.0, "monoisotopic_mass": 49814.0 }, "refseq": { "ac": "NP_001035919", "name": "transforming growth factor beta-1-induced transcript 1 protein isoform 1", "summary": "This gene encodes a coactivator of the androgen receptor, a transcription factor which is activated by androgen and has a key role in male sexual differentiation. The encoded protein is thought to regulate androgen receptor activity and may have a role to play in the treatment of prostate cancer. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2009].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001035919" }, "gene_names": [ { "name": "TGFB1I1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O43294", "id": "O43294" }, { "name": "ARA55; HIC-5; HIC5; TSC-5", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001035919", "id": "NP_001035919" }, { "name": "ARA55", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O43294", "id": "O43294" }, { "name": "TGFB1I1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001035919", "id": "NP_001035919" } ], "protein_names": [ { "name": "Transforming growth factor beta-1-induced transcript 1 protein", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O43294" }, { "name": "Androgen receptor coactivator 55 kDa protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O43294" }, { "name": "Androgen receptor-associated protein of 55 kDa", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O43294" }, { "name": "Hic-5", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O43294" }, { "name": "Hydrogen peroxide-inducible clone 5 protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O43294" }, { "name": "androgen receptor coactivator ARA55; transforming growth factor beta-1-induced transcript 1 protein; hydrogen peroxide-inducible clone 5 protein; androgen receptor-associated protein of 55 kDa; androgen receptor coactivator 55 kDa protein; hydrogen peroxide-inducible clone-5", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001035919", "id": "NP_001035919" }, { "name": "transforming growth factor beta-1-induced transcript 1 protein isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001035919", "id": "NP_001035919" } ], "function": [ { "annotation": "Exosome-mediated Hic-5 regulates proliferation and apoptosis of osteosarcoma via Wnt/beta-catenin signal pathway.", "evidence": [ { "database": "RefSeq", "id": "NP_001035919", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001035919" }, { "database": "PubMed", "id": "33310972", "url": "https://glygen.org/publication/PubMed/33310972" } ] }, { "annotation": "Functions as a molecular adapter coordinating multiple protein-protein interactions at the focal adhesion complex and in the nucleus. Links various intracellular signaling modules to plasma membrane receptors and regulates the Wnt and TGFB signaling pathways. May also regulate SLC6A3 and SLC6A4 targeting to the plasma membrane hence regulating their activity. In the nucleus, functions as a nuclear receptor coactivator regulating glucocorticoid, androgen, mineralocorticoid and progesterone receptor transcriptional activity. May play a role in the processes of cell growth, proliferation, migration, differentiation and senescence. May have a zinc-dependent DNA-binding activity.", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294#function" }, { "database": "PubMed", "id": "12700349", "url": "https://glygen.org/publication/PubMed/12700349" }, { "database": "PubMed", "id": "10075738", "url": "https://glygen.org/publication/PubMed/10075738" }, { "database": "PubMed", "id": "16141357", "url": "https://glygen.org/publication/PubMed/16141357" }, { "database": "PubMed", "id": "17166536", "url": "https://glygen.org/publication/PubMed/17166536" }, { "database": "PubMed", "id": "15211577", "url": "https://glygen.org/publication/PubMed/15211577" }, { "database": "PubMed", "id": "16803896", "url": "https://glygen.org/publication/PubMed/16803896" }, { "database": "PubMed", "id": "16624805", "url": "https://glygen.org/publication/PubMed/16624805" }, { "database": "PubMed", "id": "11856738", "url": "https://glygen.org/publication/PubMed/11856738" }, { "database": "PubMed", "id": "17233630", "url": "https://glygen.org/publication/PubMed/17233630" }, { "database": "PubMed", "id": "15561701", "url": "https://glygen.org/publication/PubMed/15561701" }, { "database": "PubMed", "id": "12177201", "url": "https://glygen.org/publication/PubMed/12177201" }, { "database": "PubMed", "id": "9032249", "url": "https://glygen.org/publication/PubMed/9032249" }, { "database": "PubMed", "id": "16849583", "url": "https://glygen.org/publication/PubMed/16849583" }, { "database": "PubMed", "id": "12445807", "url": "https://glygen.org/publication/PubMed/12445807" }, { "database": "PubMed", "id": "11463817", "url": "https://glygen.org/publication/PubMed/11463817" } ] }, { "annotation": "Paxillin family of focal adhesion adaptor proteins and regulation of cancer cell invasion.", "evidence": [ { "database": "RefSeq", "id": "NP_001035919", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001035919" }, { "database": "PubMed", "id": "32859368", "url": "https://glygen.org/publication/PubMed/32859368" } ] }, { "annotation": "TGFbeta1I1 suppressed cell migration and invasion in colorectal cancer by inhibiting the TGF-beta pathway and EMT progress.", "evidence": [ { "database": "RefSeq", "id": "NP_001035919", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001035919" }, { "database": "PubMed", "id": "32706067", "url": "https://glygen.org/publication/PubMed/32706067" } ] }, { "annotation": "This gene encodes a coactivator of the androgen receptor, a transcription factor which is activated by androgen and has a key role in male sexual differentiation. The encoded protein is thought to regulate androgen receptor activity and may have a role to play in the treatment of prostate cancer. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2009].", "evidence": [ { "database": "RefSeq", "id": "NP_001035919", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001035919" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs370388162", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs370388162" }, { "id": "rs370388162", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs370388162" }, { "id": "rs370388162", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs370388162#frequency_tab" }, { "id": "rs370388162", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs370388162" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 191, "end_pos": 191, "sequence_org": "G", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NEG->NES).", "chr_id": "16", "chr_pos": "31474614", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "G191", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O43294", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O43294" }, { "id": "rs374512418", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs374512418" }, { "id": "rs374512418", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs374512418" }, { "id": "rs374512418", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs374512418" }, { "id": "rs374512418", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs374512418#frequency_tab" }, { "id": "rs374512418", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs374512418" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 214, "end_pos": 214, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "D", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (DLS->NLS).", "chr_id": "16", "chr_pos": "31474683", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "D214", "disease": [ { "disease_id": "DOID:1319", "recommended_name": { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain cancer", "description": "A central nervous system cancer that is characterized by the growth of abnormal cells in the tissues of the brain." }, "synonyms": [ { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "BT - Brain tumour", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "adult brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "adult malignant brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain neoplasm, adult", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant brain tumour", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant primary brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant primary brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant tumor of Brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant tumor of adult brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "neoplasm of brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary malignant neoplasm of brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "tumor of the Brain", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] }, { "evidence": [ { "id": "rs1596613205", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1596613205" }, { "id": "rs1596613205", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1596613205" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 358, "end_pos": 358, "sequence_org": "I", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NYI->NYT).", "chr_id": "16", "chr_pos": "31476964", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "I358", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1214183636", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1214183636" }, { "id": "rs1214183636", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1214183636" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 397, "end_pos": 397, "sequence_org": "F", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NHF->NHS).", "chr_id": "16", "chr_pos": "31477380", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "F397", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1359926662", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1359926662" }, { "id": "rs1359926662", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1359926662#frequency_tab" }, { "id": "rs1359926662", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1359926662" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 440, "end_pos": 440, "sequence_org": "K", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (KGS->NGS).", "chr_id": "16", "chr_pos": "31477510", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "K440", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O43294", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O43294" }, { "id": "rs1388865618", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1388865618" }, { "id": "rs1388865618", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1388865618" }, { "id": "rs1388865618", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1388865618#frequency_tab" }, { "id": "rs1388865618", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1388865618" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 80, "end_pos": 80, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "F", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (S->F).", "chr_id": "16", "chr_pos": "31473891", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "S80", "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi" ] } ], "mutagenesis": [ { "start_pos": 287, "end_pos": 287, "sequence_org": "C", "sequence_mut": "A", "comment": "Abolishes interaction with CBLC and enhancement of CBLCE3 ubiquitin-protein ligase activity.", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" }, { "database": "PubMed", "id": "23145173", "url": "https://glygen.org/publication/PubMed/23145173" } ] }, { "start_pos": 313, "end_pos": 313, "sequence_org": "C", "sequence_mut": "A", "comment": "No effect on interaction with CBLC.", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" }, { "database": "PubMed", "id": "23145173", "url": "https://glygen.org/publication/PubMed/23145173" } ] }, { "start_pos": 338, "end_pos": 342, "sequence_org": "FLQLF", "sequence_mut": "ALQAA", "comment": "Loss of interaction with AR; when associated with 456-A--A-460.", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" }, { "database": "PubMed", "id": "12714604", "url": "https://glygen.org/publication/PubMed/12714604" } ] }, { "start_pos": 369, "end_pos": 369, "sequence_org": "C", "sequence_mut": "S", "comment": "Loss of AR coactivation; when associated with S-372.", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" }, { "database": "PubMed", "id": "16624805", "url": "https://glygen.org/publication/PubMed/16624805" } ] }, { "start_pos": 372, "end_pos": 372, "sequence_org": "C", "sequence_mut": "S", "comment": "Loss of AR coactivation; when associated with S-369.", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" }, { "database": "PubMed", "id": "16624805", "url": "https://glygen.org/publication/PubMed/16624805" } ] }, { "start_pos": 428, "end_pos": 428, "sequence_org": "H", "sequence_mut": "S", "comment": "Loss of AR coactivation; when associated with S-431.", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" }, { "database": "PubMed", "id": "16624805", "url": "https://glygen.org/publication/PubMed/16624805" } ] }, { "start_pos": 431, "end_pos": 431, "sequence_org": "C", "sequence_mut": "S", "comment": "Loss of AR coactivation; when associated with S-428.", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" }, { "database": "PubMed", "id": "16624805", "url": "https://glygen.org/publication/PubMed/16624805" } ] }, { "start_pos": 456, "end_pos": 460, "sequence_org": "FLKLF", "sequence_mut": "ALKAA", "comment": "Loss of interaction with AR; when associated with 338-A--A-342.", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" }, { "database": "PubMed", "id": "12714604", "url": "https://glygen.org/publication/PubMed/12714604" } ] }, { "start_pos": 60, "end_pos": 60, "sequence_org": "Y", "sequence_mut": "F", "comment": "Prevents phosphorylation by FAK2 and FYN. Prevents interaction with CSK.", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" }, { "database": "PubMed", "id": "10838081", "url": "https://glygen.org/publication/PubMed/10838081" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "85.02", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000140682", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000140682" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "69.88", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000140682", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000140682" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "94.94", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000140682", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000140682" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "97.89", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000140682", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000140682" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "98.99", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000140682", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000140682" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "92.88", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000140682", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000140682" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "96.26", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000140682", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000140682" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "95.92", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000140682", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000140682" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "90.73", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000140682", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000140682" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "89.99", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000140682", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000140682" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "76.54", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000140682", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000140682" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "96.11", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000140682", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000140682" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "93.88", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000140682", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000140682" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O43294", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43294" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O43294", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43294" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O43294", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43294" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O43294", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43294" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O43294", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43294" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O43294", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43294" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O43294", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43294" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O43294", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43294" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O43294", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43294" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O43294", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43294" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O43294", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43294" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O43294", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43294" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" } ], "common_name": "Human" } ], "gene": [ { "name": "TGFB1I1", "url": "https://www.uniprot.org/uniprot/O43294", "locus": { "chromosome": "16", "start_pos": 31477960, "end_pos": 31471585, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000140682", "url": "https://www.ensembl.org/id/ENSG00000140682" } ] } } ], "crossref": [ { "id": "ENSG00000140682", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000140682", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "O43294", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O43294", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd09336", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd09336", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd09337", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd09337", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd09409", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd09409", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd09412", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd09412", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "TGFB1I1", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=TGFB1I1", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "7041", "url": "https://www.ncbi.nlm.nih.gov/gene/7041", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "11767", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=11767", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O43294", "url": "https://www.ebi.ac.uk/intact/interactors/id:O43294*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001781", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001781", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017305", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017305", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR047075", "url": "https://www.ebi.ac.uk/interpro/entry/IPR047075", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:7041", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:7041", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "602353", "url": "http://www.omim.org/entry/602353", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O43294", "url": "https://www.nextprot.org/entry/NX_O43294", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "O43294", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O43294", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "YCPECYF", "url": "https://omabrowser.org/oma/group/YCPECYF/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "370973at2759", "url": "http://www.orthodb.org/?query=370973at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR24216", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24216", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24216:SF8", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24216:SF8", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00412", "url": "http://pfam.xfam.org/family/PF00412", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF03535", "url": "http://pfam.xfam.org/family/PF03535", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O43294", "url": "https://pharos.nih.gov/targets/O43294", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O43294", "url": "http://purl.obolibrary.org/obo/PR_O43294", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_001035919", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001035919", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "H3BN49", "url": "https://www.uniprot.org/uniprot/H3BN49", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H3BN49-1", "url": "https://www.uniprot.org/uniprot/H3BN49-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H3BQC4", "url": "https://www.uniprot.org/uniprot/H3BQC4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H3BQC4-1", "url": "https://www.uniprot.org/uniprot/H3BQC4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H3BRP2", "url": "https://www.uniprot.org/uniprot/H3BRP2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H3BRP2-1", "url": "https://www.uniprot.org/uniprot/H3BRP2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H3BS04", "url": "https://www.uniprot.org/uniprot/H3BS04", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H3BS04-1", "url": "https://www.uniprot.org/uniprot/H3BS04-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H3BSN4", "url": "https://www.uniprot.org/uniprot/H3BSN4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H3BSN4-1", "url": "https://www.uniprot.org/uniprot/H3BSN4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3L209", "url": "https://www.uniprot.org/uniprot/I3L209", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3L209-1", "url": "https://www.uniprot.org/uniprot/I3L209-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O43294-1", "url": "https://www.uniprot.org/uniprot/O43294-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O43294-2", "url": "https://www.uniprot.org/uniprot/O43294-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MEDLDALLSDLETTTSHMPRSGAPKERPAEPLTPPPSYGHQPQTGSGESSGASGDKDHLYSTVCKPRSPKPAAPAAPPFSSSSGVLGTGLCELDRLLQELNATQFNITDEIMSQFPSSKVASGEQKEDQSEDKKRPSLPSSPSPGLPKASATSATLELDRLMASLSDFRVQNHLPASGPTQPPVVSSTNEGSPSPPEPTGKGSLDTMLGLLQSDLSRRGVPTQAKGLCGSCNKPIAGQVVTALGRAWHPEHFVCGGCSTALGGSSFFEKDGAPFCPECYFERFSPRCGFCNQPIRHKMVTALGTHWHPEHFCCVSCGEPFGDEGFHEREGRPYCRRDFLQLFAPRCQGCQGPILDNYISALSALWHPDCFVCRECFAPFSGGSFFEHEGRPLCENHFHARRGSLCATCGLPVTGRCVSALGRRFHPDHFTCTFCLRPLTKGSFQERAGKPYCQPCFLKLFG", "length": 461, "header": "sp|O43294-1|TGFI1_HUMAN Isoform 1 of Transforming growth factor beta-1-induced transcript 1 protein OS=Homo sapiens OX=9606 GN=TGFB1I1 PE=1 SV=2 CANONICAL=O43294-1" }, "isoforms": [ { "isoform_ac": "H3BN49-1", "url": "", "sequence": { "sequence": "MPRSGAPKERPAEPLTPPPSYGHQPQTGSGESSGASGDKDHLYSTVCKPRSPKPAAPAAPPFSSSSGVLGTGLCELDRLLQELNATQFNITALPARLLASQRLLPPQPLWSWID", "length": 114, "header": "tr|H3BN49-1|TGFI1_HUMAN Computationally mapped isoform of Transforming growth factor beta-1-induced transcript 1 protein OS=Homo sapiens OX=9606 GN=TGFB1I1 PE=1 SV=1 CANONICAL=O43294-1" }, "locus": { "chromosome": "16", "start_pos": 31474417, "end_pos": 31473479, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000564804.1", "url": "https://www.ensembl.org/id/ENST00000564804.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000454688.1", "url": "https://www.ensembl.org/id/ENSP00000454688.1" } ] } }, { "isoform_ac": "H3BQC4-1", "url": "", "sequence": { "sequence": "MPCSLTWRLPPRTCQGQGLPKSALRSLSPLPHPMATSHSTVCKPRSPKPAAPAAPPFSSSSGVLGTGLCELDRLLQELNATQFNITDEIMSQFPSSKVASGEQKEDQSEDKKRPSLPSSPSPGLPKASATSATLELDRLMASLSDFRVQNHLPASGPTQPPVVSSTNEGSPSPPEPTGKGSLDTMLGLLQSDLSRRGVPTQAKGLCGSCNKPIAGQ", "length": 216, "header": "tr|H3BQC4-1|TGFI1_HUMAN Computationally mapped isoform of Transforming growth factor beta-1-induced transcript 1 protein OS=Homo sapiens OX=9606 GN=TGFB1I1 PE=1 SV=8 CANONICAL=O43294-1" }, "locus": { "chromosome": "16", "start_pos": 31474757, "end_pos": 31473441, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000565360.5", "url": "https://www.ensembl.org/id/ENST00000565360.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000455709.1", "url": "https://www.ensembl.org/id/ENSP00000455709.1" } ] } }, { "isoform_ac": "H3BRP2-1", "url": "", "sequence": { "sequence": "MEDLDRVWGVFRSLGGQGPPVQHGMQASVPKACSPGGPSILLFQRCLGYRAL", "length": 52, "header": "tr|H3BRP2-1|H3BRP2_HUMAN Computationally mapped isoform of Transforming growth factor beta 1 induced transcript 1 OS=Homo sapiens OX=9606 GN=TGFB1I1 PE=4 SV=2 CANONICAL=O43294-1" }, "locus": { "chromosome": "16", "start_pos": 31473924, "end_pos": 31472189, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000567066.6", "url": "https://www.ensembl.org/id/ENST00000567066.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000456341.2", "url": "https://www.ensembl.org/id/ENSP00000456341.2" } ] } }, { "isoform_ac": "H3BS04-1", "url": "", "sequence": { "sequence": "MPRSGAPKERPAEPLTPPPSYGHQPQTGSGESSGASGDKDHLYSTVCKPRSPKPAAPAAPPFSSSSGVLGTGLCELDRLLQELNATQFN", "length": 89, "header": "tr|H3BS04-1|H3BS04_HUMAN Computationally mapped isoform of Transforming growth factor beta 1 induced transcript 1 OS=Homo sapiens OX=9606 GN=TGFB1I1 PE=1 SV=1 CANONICAL=O43294-1" }, "locus": { "chromosome": "16", "start_pos": 31473970, "end_pos": 31473479, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000562566.5", "url": "https://www.ensembl.org/id/ENST00000562566.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000456482.1", "url": "https://www.ensembl.org/id/ENSP00000456482.1" } ] } }, { "isoform_ac": "H3BSN4-1", "url": "", "sequence": { "sequence": "MPRSGAPKERPAEPLTPPPSYGHQPQTGSGESSGASGDKDHLYSTVCKPRSPKPAAPAAPPFSSSSGVLGTGLCELDRLLQELNATQFNITDEIMSQFPSSKVASGEQKEDQSEDKKRPSLPSSPSPGLPKASATSATLELDRLMASLSDFRVQNHLPASGPTQP", "length": 165, "header": "tr|H3BSN4-1|TGFI1_HUMAN Computationally mapped isoform of Transforming growth factor beta-1-induced transcript 1 protein OS=Homo sapiens OX=9606 GN=TGFB1I1 PE=1 SV=1 CANONICAL=O43294-1" }, "locus": { "chromosome": "16", "start_pos": 31474589, "end_pos": 31473479, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000565454.5", "url": "https://www.ensembl.org/id/ENST00000565454.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000456783.1", "url": "https://www.ensembl.org/id/ENSP00000456783.1" } ] } }, { "isoform_ac": "I3L209-1", "url": "", "sequence": { "sequence": "MEDLDALLSDLETTTSHMPRSGAPKERPAEPLTPPPSYGHQPQTGSGESSGASGDKDHLYR", "length": 61, "header": "tr|I3L209-1|I3L209_HUMAN Computationally mapped isoform of Transforming growth factor beta 1 induced transcript 1 OS=Homo sapiens OX=9606 GN=TGFB1I1 PE=1 SV=1 CANONICAL=O43294-1" }, "locus": { "chromosome": "16", "start_pos": 31474152, "end_pos": 31472189, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000563712.6", "url": "https://www.ensembl.org/id/ENST00000563712.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000459283.1", "url": "https://www.ensembl.org/id/ENSP00000459283.1" } ] } }, { "isoform_ac": "O43294-1", "url": "", "sequence": { "sequence": "MEDLDALLSDLETTTSHMPRSGAPKERPAEPLTPPPSYGHQPQTGSGESSGASGDKDHLYSTVCKPRSPKPAAPAAPPFSSSSGVLGTGLCELDRLLQELNATQFNITDEIMSQFPSSKVASGEQKEDQSEDKKRPSLPSSPSPGLPKASATSATLELDRLMASLSDFRVQNHLPASGPTQPPVVSSTNEGSPSPPEPTGKGSLDTMLGLLQSDLSRRGVPTQAKGLCGSCNKPIAGQVVTALGRAWHPEHFVCGGCSTALGGSSFFEKDGAPFCPECYFERFSPRCGFCNQPIRHKMVTALGTHWHPEHFCCVSCGEPFGDEGFHEREGRPYCRRDFLQLFAPRCQGCQGPILDNYISALSALWHPDCFVCRECFAPFSGGSFFEHEGRPLCENHFHARRGSLCATCGLPVTGRCVSALGRRFHPDHFTCTFCLRPLTKGSFQERAGKPYCQPCFLKLFG", "length": 461, "header": "sp|O43294-1|TGFI1_HUMAN Isoform 1 of Transforming growth factor beta-1-induced transcript 1 protein OS=Homo sapiens OX=9606 GN=TGFB1I1 PE=1 SV=2 CANONICAL=O43294-1" }, "locus": { "chromosome": "16", "start_pos": 31477573, "end_pos": 31472189, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000394863.8", "url": "https://www.ensembl.org/id/ENST00000394863.8" }, { "database": "Ensembl Peptide", "id": "ENSP00000378332.3", "url": "https://www.ensembl.org/id/ENSP00000378332.3" } ] } }, { "isoform_ac": "O43294-2", "url": "", "sequence": { "sequence": "MPRSGAPKERPAEPLTPPPSYGHQPQTGSGESSGASGDKDHLYSTVCKPRSPKPAAPAAPPFSSSSGVLGTGLCELDRLLQELNATQFNITDEIMSQFPSSKVASGEQKEDQSEDKKRPSLPSSPSPGLPKASATSATLELDRLMASLSDFRVQNHLPASGPTQPPVVSSTNEGSPSPPEPTGKGSLDTMLGLLQSDLSRRGVPTQAKGLCGSCNKPIAGQVVTALGRAWHPEHFVCGGCSTALGGSSFFEKDGAPFCPECYFERFSPRCGFCNQPIRHKMVTALGTHWHPEHFCCVSCGEPFGDEGFHEREGRPYCRRDFLQLFAPRCQGCQGPILDNYISALSALWHPDCFVCRECFAPFSGGSFFEHEGRPLCENHFHARRGSLCATCGLPVTGRCVSALGRRFHPDHFTCTFCLRPLTKGSFQERAGKPYCQPCFLKLFG", "length": 444, "header": "sp|O43294-2|TGFI1_HUMAN Isoform 2 of Transforming growth factor beta-1-induced transcript 1 protein OS=Homo sapiens OX=9606 GN=TGFB1I1 PE=1 SV=2 CANONICAL=O43294-1" }, "locus": { "chromosome": "16", "start_pos": 31477573, "end_pos": 31473479, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000567607.5", "url": "https://www.ensembl.org/id/ENST00000567607.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000457586.1", "url": "https://www.ensembl.org/id/ENSP00000457586.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 80, "start_aa": "Ser", "end_pos": 80, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser80", "evidence": [ { "id": "O43294", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O43294" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 81, "start_aa": "Ser", "end_pos": 81, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser81", "evidence": [ { "id": "O43294", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O43294" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "31492838", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/31492838" }, { "id": "35254053", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35254053" } ] } ], "phosphorylation": [ { "start_pos": 122, "end_pos": 122, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O43294", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43294" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" }, { "database": "phospho.ELM", "id": "O43294", "url": "http://phospho.elm.eu.org/byAccession/O43294.html" } ], "site_lbl": "Ser122" }, { "start_pos": 137, "end_pos": 137, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "iPTMnet", "id": "O43294", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43294" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "20166139", "url": "https://glygen.org/publication/PubMed/20166139" }, { "database": "phospho.ELM", "id": "O43294", "url": "http://phospho.elm.eu.org/byAccession/O43294.html" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ], "site_lbl": "Ser137" }, { "start_pos": 140, "end_pos": 140, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "iPTMnet", "id": "O43294", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43294" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "20166139", "url": "https://glygen.org/publication/PubMed/20166139" } ], "site_lbl": "Ser140" }, { "start_pos": 141, "end_pos": 141, "kinase_uniprot_canonical_ac": "P28482-1", "kinase_gene_name": "MAPK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O43294", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43294" }, { "database": "PubMed", "id": "22028470", "url": "https://glygen.org/publication/PubMed/22028470" } ], "site_lbl": "Ser141" }, { "start_pos": 141, "end_pos": 141, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O43294", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43294" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "20166139", "url": "https://glygen.org/publication/PubMed/20166139" } ], "site_lbl": "Ser141" }, { "start_pos": 143, "end_pos": 143, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "iPTMnet", "id": "O43294", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43294" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "20166139", "url": "https://glygen.org/publication/PubMed/20166139" }, { "database": "phospho.ELM", "id": "O43294", "url": "http://phospho.elm.eu.org/byAccession/O43294.html" } ], "site_lbl": "Ser143" }, { "start_pos": 164, "end_pos": 164, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O43294", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43294" } ], "site_lbl": "Ser164" }, { "start_pos": 186, "end_pos": 186, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" }, { "database": "iPTMnet", "id": "O43294", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43294" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ], "site_lbl": "Ser186" }, { "start_pos": 187, "end_pos": 187, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O43294", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43294" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ], "site_lbl": "Ser187" }, { "start_pos": 188, "end_pos": 188, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" }, { "database": "phospho.ELM", "id": "O43294", "url": "http://phospho.elm.eu.org/byAccession/O43294.html" }, { "database": "iPTMnet", "id": "O43294", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43294" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ], "site_lbl": "Thr188" }, { "start_pos": 192, "end_pos": 192, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O43294", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43294" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "PubMed", "id": "20166139", "url": "https://glygen.org/publication/PubMed/20166139" } ], "site_lbl": "Ser192" }, { "start_pos": 194, "end_pos": 194, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O43294", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43294" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" } ], "site_lbl": "Ser194" }, { "start_pos": 33, "end_pos": 33, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "iPTMnet", "id": "O43294", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43294" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "phospho.ELM", "id": "O43294", "url": "http://phospho.elm.eu.org/byAccession/O43294.html" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ], "site_lbl": "Thr33" }, { "start_pos": 38, "end_pos": 38, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" }, { "database": "iPTMnet", "id": "O43294", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43294" }, { "database": "PubMed", "id": "16764713", "url": "https://glygen.org/publication/PubMed/16764713" }, { "database": "PubMed", "id": "22529104", "url": "https://glygen.org/publication/PubMed/22529104" }, { "database": "PubMed", "id": "30893012", "url": "https://glygen.org/publication/PubMed/30893012" } ], "site_lbl": "Tyr38" }, { "start_pos": 403, "end_pos": 403, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "iPTMnet", "id": "O43294", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43294" }, { "database": "PubMed", "id": "20166139", "url": "https://glygen.org/publication/PubMed/20166139" } ], "site_lbl": "Ser403" }, { "start_pos": 407, "end_pos": 407, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "iPTMnet", "id": "O43294", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43294" } ], "site_lbl": "Thr407" }, { "start_pos": 44, "end_pos": 44, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O43294", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43294" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ], "site_lbl": "Thr44" }, { "start_pos": 49, "end_pos": 49, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O43294", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43294" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ], "site_lbl": "Ser49" }, { "start_pos": 53, "end_pos": 53, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O43294", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43294" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ], "site_lbl": "Ser53" }, { "start_pos": 60, "end_pos": 60, "kinase_uniprot_canonical_ac": "P06241-1", "kinase_gene_name": "FYN", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O43294", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43294" }, { "database": "PubMed", "id": "10838081", "url": "https://glygen.org/publication/PubMed/10838081" }, { "database": "phospho.ELM", "id": "O43294", "url": "http://phospho.elm.eu.org/byAccession/O43294.html" } ], "site_lbl": "Tyr60" }, { "start_pos": 60, "end_pos": 60, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by FAK2 and FYN", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" }, { "database": "iPTMnet", "id": "O43294", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43294" }, { "database": "PubMed", "id": "16764713", "url": "https://glygen.org/publication/PubMed/16764713" }, { "database": "PubMed", "id": "22529104", "url": "https://glygen.org/publication/PubMed/22529104" }, { "database": "PubMed", "id": "30893012", "url": "https://glygen.org/publication/PubMed/30893012" }, { "database": "PubMed", "id": "11856738", "url": "https://glygen.org/publication/PubMed/11856738" }, { "database": "PubMed", "id": "10838081", "url": "https://glygen.org/publication/PubMed/10838081" } ], "site_lbl": "Tyr60" }, { "start_pos": 68, "end_pos": 68, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" }, { "database": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "iPTMnet", "id": "O43294", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43294" }, { "database": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" }, { "database": "PubMed", "id": "27869121", "url": "" }, { "database": "PubMed", "id": "31848261", "url": "" }, { "database": "PubMed", "id": "32157095", "url": "" }, { "database": "phospho.ELM", "id": "O43294", "url": "http://phospho.elm.eu.org/byAccession/O43294.html" } ], "site_lbl": "Ser68" }, { "start_pos": 82, "end_pos": 82, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O43294", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43294" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" } ], "site_lbl": "Ser82" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Cloning and characterization of androgen receptor coactivator, ARA55, in human prostate.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Fujimoto N, Yeh S, Kang HY, Inui S, Chang HC, Mizokami A, Chang C", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" } ], "reference": [ { "type": "PubMed", "id": "10075738", "url": "https://glygen.org/publication/PubMed/10075738" } ] }, { "title": "Molecular cloning of human Hic-5, a potential regulator involved in signal transduction and cellular senescence.", "journal": "Mol. Carcinog.", "date": "2000", "authors": "Zhang J, Zhang L X, Meltzer P S, Barrett J C, Trent J M", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" } ], "reference": [ { "type": "PubMed", "id": "10708479", "url": "https://glygen.org/publication/PubMed/10708479" } ] }, { "title": "Phosphorylation of Hic-5 at tyrosine 60 by CAKbeta and Fyn.", "journal": "FEBS letters", "date": "2000", "authors": "Ishino M, Aoto H, Sasaski H, Suzuki R, Sasaki T", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" }, { "database": "iPTMnet", "id": "O43294", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43294" } ], "reference": [ { "type": "PubMed", "id": "10838081", "url": "https://glygen.org/publication/PubMed/10838081" } ] }, { "title": "Involvement of Hic-5 in platelet activation: integrin alphaIIbbeta3-dependent tyrosine phosphorylation and association with proline-rich tyrosine kinase 2.", "journal": "The Biochemical journal", "date": "2001", "authors": "Osada M, Ohmori T, Yatomi Y, Satoh K, Hosogaya S, Ozaki Y", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" } ], "reference": [ { "type": "PubMed", "id": "11311131", "url": "https://glygen.org/publication/PubMed/11311131" } ] }, { "title": "CrkL is an adapter for Wiskott-Aldrich syndrome protein and Syk.", "journal": "Blood", "date": "2001", "authors": "Oda A, Ochs H D, Lasky L A, Spencer S, Ozaki K, Fujihara M, Handa M, Ikebuchi K, Ikeda H", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" } ], "reference": [ { "type": "PubMed", "id": "11313252", "url": "https://glygen.org/publication/PubMed/11313252" } ] }, { "title": "Hic-5-reduced cell spreading on fibronectin: competitive effects between paxillin and Hic-5 through interaction with focal adhesion kinase.", "journal": "Molecular and cellular biology", "date": "2001-08", "authors": "Nishiya N, Tachibana K, Shibanuma M, Mashimo J I, Nose K", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" } ], "reference": [ { "type": "PubMed", "id": "11463817", "url": "https://glygen.org/publication/PubMed/11463817" } ] }, { "title": "Different expression of androgen receptor coactivators in human prostate.", "journal": "Urology", "date": "2001", "authors": "Fujimoto N, Mizokami A, Harada S, Matsumoto T", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" } ], "reference": [ { "type": "PubMed", "id": "11489729", "url": "https://glygen.org/publication/PubMed/11489729" } ] }, { "title": "Potential anti-androgenic activity of roxithromycin in skin.", "journal": "J. Dermatol. Sci.", "date": "2001", "authors": "Inui S, Nakajima T, Fukuzato Y, Fujimoto N, Chang C, Yoshikawa K, Itami S", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" } ], "reference": [ { "type": "PubMed", "id": "11532379", "url": "https://glygen.org/publication/PubMed/11532379" } ] }, { "title": "Suppression of androgen receptor transactivation by Pyk2 via interaction and phosphorylation of the ARA55 coregulator.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Wang X, Yang Y, Guo X, Sampson ER, Hsu CL, Tsai MY, Yeh S, Wu G, Guo Y, Chang C", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" }, { "database": "iPTMnet", "id": "O43294", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43294" } ], "reference": [ { "type": "PubMed", "id": "11856738", "url": "https://glygen.org/publication/PubMed/11856738" } ] }, { "title": "Hic-5 interacts with GIT1 with a different binding mode from paxillin.", "journal": "J. Biochem.", "date": "2002", "authors": "Nishiya N, Shirai T, Suzuki W, Nose K", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" } ], "reference": [ { "type": "PubMed", "id": "12153727", "url": "https://glygen.org/publication/PubMed/12153727" } ] }, { "title": "The multiple LIM domain-containing adaptor protein Hic-5 synaptically colocalizes and interacts with the dopamine transporter.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2002-08-15", "authors": "Carneiro Ana M, Ingram Susan L, Beaulieu Jean-Martin, Sweeney Ava, Amara Susan G, Thomas Sheila M, Caron Marc G, Torres Gonzalo E", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" } ], "reference": [ { "type": "PubMed", "id": "12177201", "url": "https://glygen.org/publication/PubMed/12177201" } ] }, { "title": "Transcriptional activation of the c-fos gene by a LIM protein, Hic-5.", "journal": "Biochemical and biophysical research communications", "date": "2002-12-06", "authors": "Kim-Kaneyama Joo ri, Shibanuma Motoko, Nose Kiyoshi", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" } ], "reference": [ { "type": "PubMed", "id": "12445807", "url": "https://glygen.org/publication/PubMed/12445807" } ] }, { "title": "Hic-5 communicates between focal adhesions and the nucleus through oxidant-sensitive nuclear export signal.", "journal": "Mol. Biol. Cell", "date": "2003", "authors": "Shibanuma M, Kim-Kaneyama JR, Ishino K, Sakamoto N, Hishiki T, Yamaguchi K, Mori K, Mashimo J, Nose K", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" } ], "reference": [ { "type": "PubMed", "id": "12631731", "url": "https://glygen.org/publication/PubMed/12631731" } ] }, { "title": "Expression of the LIM proteins paxillin and Hic-5 in human tissues.", "journal": "J. Histochem. Cytochem.", "date": "2003", "authors": "Yuminamochi Tsutomu, Yatomi Yutaka, Osada Makoto, Ohmori Tsukasa, Ishii Yoshio, Nakazawa Kumiko, Hosogaya Shigemi, Ozaki Yukio", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" } ], "reference": [ { "type": "PubMed", "id": "12642630", "url": "https://glygen.org/publication/PubMed/12642630" } ] }, { "title": "Inactivation of androgen receptor coregulator ARA55 inhibits androgen receptor activity and agonist effect of antiandrogens in prostate cancer cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2003-04-29", "authors": "Rahman Mujib M, Miyamoto Hiroshi, Lardy Henry, Chang Chawnshang", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" } ], "reference": [ { "type": "PubMed", "id": "12700349", "url": "https://glygen.org/publication/PubMed/12700349" } ] }, { "title": "The use of phage display technique for the isolation of androgen receptor interacting peptides with (F/W)XXL(F/W) and FXXLY new signature motifs.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Hsu CL, Chen YL, Yeh S, Ting HJ, Hu YC, Lin H, Wang X, Chang C", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" } ], "reference": [ { "type": "PubMed", "id": "12714604", "url": "https://glygen.org/publication/PubMed/12714604" } ] }, { "title": "Expression of androgen receptor coactivators in normal and cancer prostate tissues and cultured cell lines.", "journal": "Prostate", "date": "2003", "authors": "Mestayer C, Blanch\u00e8re M, Jaubert F, Dufour B, Mowszowicz I", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" } ], "reference": [ { "type": "PubMed", "id": "12772188", "url": "https://glygen.org/publication/PubMed/12772188" } ] }, { "title": "Distinct LIM domains of Hic-5/ARA55 are required for nuclear matrix targeting and glucocorticoid receptor binding and coactivation.", "journal": "Journal of cellular biochemistry", "date": "2004-07-01", "authors": "Guerrero-Santoro Jennifer, Yang Lan, Stallcup Michael R, DeFranco Donald B", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" } ], "reference": [ { "type": "PubMed", "id": "15211577", "url": "https://glygen.org/publication/PubMed/15211577" } ] }, { "title": "Novel function of androgen receptor-associated protein 55/Hic-5 as a negative regulator of Smad3 signaling.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Wang H, Song K, Sponseller TL, Danielpour D", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" } ], "reference": [ { "type": "PubMed", "id": "15561701", "url": "https://glygen.org/publication/PubMed/15561701" } ] }, { "title": "Hic-5 regulates an epithelial program mediated by PPARgamma.", "journal": "Genes Dev.", "date": "2005", "authors": "Drori S, Girnun GD, Tou L, Szwaya JD, Mueller E, Xia K, Shivdasani RA, Spiegelman BM", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" } ], "reference": [ { "type": "PubMed", "id": "15687259", "url": "https://glygen.org/publication/PubMed/15687259" } ] }, { "title": "Mechanism of action of Hic-5/androgen receptor activator 55, a LIM domain-containing nuclear receptor coactivator.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2006-01", "authors": "Heitzer M D, DeFranco D B", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" } ], "reference": [ { "type": "PubMed", "id": "16141357", "url": "https://glygen.org/publication/PubMed/16141357" } ] }, { "title": "Subcellular targeting of oxidants during endothelial cell migration.", "journal": "J. Cell Biol.", "date": "2005", "authors": "Wu Ru Feng, Xu You Cheng, Ma Zhenyi, Nwariaku Fiemu E, Sarosi George A, Terada Lance S", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" } ], "reference": [ { "type": "PubMed", "id": "16330715", "url": "https://glygen.org/publication/PubMed/16330715" } ] }, { "title": "ERK8 down-regulates transactivation of the glucocorticoid receptor through Hic-5.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Saelzler MP, Spackman CC, Liu Y, Martinez LC, Harris JP, Abe MK", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" } ], "reference": [ { "type": "PubMed", "id": "16624805", "url": "https://glygen.org/publication/PubMed/16624805" } ] }, { "title": "Molecular profiling of signalling proteins for effects induced by the anti-cancer compound GSAO with 400 antibodies.", "journal": "BMC cancer", "date": "2006", "authors": "Cadd VA, Hogg PJ, Harris AL, Feller SM", "evidence": [ { "database": "iPTMnet", "id": "O43294", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43294" } ], "reference": [ { "type": "PubMed", "id": "16764713", "url": "https://glygen.org/publication/PubMed/16764713" } ] }, { "title": "Serotonin-, protein kinase C-, and Hic-5-associated redistribution of the platelet serotonin transporter.", "journal": "The Journal of biological chemistry", "date": "2006-08-25", "authors": "Carneiro Ana Marin D, Blakely Randy D", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" } ], "reference": [ { "type": "PubMed", "id": "16803896", "url": "https://glygen.org/publication/PubMed/16803896" } ] }, { "title": "Hic-5/ARA55, a LIM domain-containing nuclear receptor coactivator expressed in prostate stromal cells.", "journal": "Cancer research", "date": "2006-07-15", "authors": "Heitzer Marjet D, DeFranco Donald B", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" } ], "reference": [ { "type": "PubMed", "id": "16849583", "url": "https://glygen.org/publication/PubMed/16849583" } ] }, { "title": "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks.", "journal": "Cell", "date": "2006", "authors": "Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" }, { "database": "iPTMnet", "id": "O43294-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43294-1" } ], "reference": [ { "type": "PubMed", "id": "17081983", "url": "https://glygen.org/publication/PubMed/17081983" } ] }, { "title": "Hic-5/ARA55: a prostate stroma-specific AR coactivator.", "journal": "Steroids", "date": "2007-02", "authors": "Heitzer Marjet D, DeFranco Donald B", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" } ], "reference": [ { "type": "PubMed", "id": "17166536", "url": "https://glygen.org/publication/PubMed/17166536" } ] }, { "title": "Gonadotropin-releasing hormone functionally antagonizes testosterone activation of the human androgen receptor in prostate cells through focal adhesion complexes involving Hic-5.", "journal": "Neuroendocrinology", "date": "2006", "authors": "Maudsley S, Davidson L, Pawson AJ, Freestone SH, Lopez de Maturana R, Thomson AA, Millar RP", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" } ], "reference": [ { "type": "PubMed", "id": "17202804", "url": "https://glygen.org/publication/PubMed/17202804" } ] }, { "title": "Paxillin family members function as Csk-binding proteins that regulate Lyn activity in human and murine platelets.", "journal": "The Biochemical journal", "date": "2007", "authors": "Rathore VB, Okada M, Newman PJ, Newman DK", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" } ], "reference": [ { "type": "PubMed", "id": "17233630", "url": "https://glygen.org/publication/PubMed/17233630" } ] }, { "title": "Global proteomic profiling of phosphopeptides using electron transfer dissociation tandem mass spectrometry.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Molina H, Horn DM, Tang N, Mathivanan S, Pandey A", "evidence": [ { "database": "iPTMnet", "id": "O43294-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43294-1" } ], "reference": [ { "type": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" } ] }, { "title": "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.", "journal": "Molecular cell", "date": "2008", "authors": "Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" }, { "database": "iPTMnet", "id": "O43294-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43294-1" } ], "reference": [ { "type": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" } ] }, { "title": "Global effects of kinase inhibitors on signaling networks revealed by quantitative phosphoproteomics.", "journal": "Molecular & cellular proteomics : MCP", "date": "2009", "authors": "Pan C, Olsen JV, Daub H, Mann M", "evidence": [ { "database": "iPTMnet", "id": "O43294-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43294-1" } ], "reference": [ { "type": "PubMed", "id": "19651622", "url": "https://glygen.org/publication/PubMed/19651622" } ] }, { "title": "Phosphoproteome analysis of human liver tissue by long-gradient nanoflow LC coupled with multiple stage MS analysis.", "journal": "Electrophoresis", "date": "2010", "authors": "Han G, Ye M, Liu H, Song C, Sun D, Wu Y, Jiang X, Chen R, Wang C, Wang L, Zou H", "evidence": [ { "database": "iPTMnet", "id": "O43294-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43294-1" } ], "reference": [ { "type": "PubMed", "id": "20166139", "url": "https://glygen.org/publication/PubMed/20166139" } ] }, { "title": "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.", "journal": "Science signaling", "date": "2011", "authors": "Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" }, { "database": "iPTMnet", "id": "O43294", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43294" } ], "reference": [ { "type": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" } ] }, { "title": "Large-scale discovery of ERK2 substrates identifies ERK-mediated transcriptional regulation by ETV3.", "journal": "Science signaling", "date": "2011", "authors": "Carlson SM, Chouinard CR, Labadorf A, Lam CJ, Schmelzle K, Fraenkel E, White FM", "evidence": [ { "database": "iPTMnet", "id": "O43294", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43294" } ], "reference": [ { "type": "PubMed", "id": "22028470", "url": "https://glygen.org/publication/PubMed/22028470" } ] }, { "title": "Hic-5 promotes invadopodia formation and invasion during TGF-beta-induced epithelial-mesenchymal transition.", "journal": "The Journal of cell biology", "date": "2012", "authors": "Pignatelli J, Tumbarello DA, Schmidt RP, Turner CE", "evidence": [ { "database": "iPTMnet", "id": "O43294", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43294" } ], "reference": [ { "type": "PubMed", "id": "22529104", "url": "https://glygen.org/publication/PubMed/22529104" } ] }, { "title": "Cbl-c ubiquitin ligase activity is increased via the interaction of its RING finger domain with a LIM domain of the paxillin homolog, Hic 5.", "journal": "PloS one", "date": "2012", "authors": "Ryan PE, Kales SC, Yadavalli R, Nau MM, Zhang H, Lipkowitz S", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" } ], "reference": [ { "type": "PubMed", "id": "23145173", "url": "https://glygen.org/publication/PubMed/23145173" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" }, { "database": "iPTMnet", "id": "O43294", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43294" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.", "journal": "Journal of proteomics", "date": "2014", "authors": "Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" }, { "database": "iPTMnet", "id": "O43294", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43294" } ], "reference": [ { "type": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" } ] }, { "title": "Hic-5 regulates Src-induced invadopodia rosette formation and organization.", "journal": "Molecular biology of the cell", "date": "2019", "authors": "Gulvady AC, Forsythe IJ, Turner CE", "evidence": [ { "database": "iPTMnet", "id": "O43294", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O43294" } ], "reference": [ { "type": "PubMed", "id": "30893012", "url": "https://glygen.org/publication/PubMed/30893012" } ] }, { "title": "Next-generation unnatural monosaccharides reveal that ESRRB O-GlcNAcylation regulates pluripotency of mouse embryonic stem cells.", "journal": "Nature communications", "date": "2019", "authors": "Hao Y, Fan X, Shi Y, Zhang C, Sun DE, Qin K, Qin W, Zhou W, Chen X", "evidence": [ { "database": "O-GlcNAc Database", "id": "O43294", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O43294" } ], "reference": [ { "type": "PubMed", "id": "31492838", "url": "https://glygen.org/publication/PubMed/31492838" } ] }, { "title": "TGFbeta1I1 suppressed cell migration and invasion in colorectal cancer by inhibiting the TGF-beta pathway and EMT progress.", "journal": "European review for medical and pharmacological sciences", "date": "2020", "authors": "Ruan XJ, Ye BL, Zheng ZH, Li ST, Zheng XF, Zhang SZ", "evidence": [ { "database": "RefSeq", "id": "NP_001035919", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001035919" } ], "reference": [ { "type": "PubMed", "id": "32706067", "url": "https://glygen.org/publication/PubMed/32706067" } ] }, { "title": "Paxillin family of focal adhesion adaptor proteins and regulation of cancer cell invasion.", "journal": "International review of cell and molecular biology", "date": "2020", "authors": "Alpha KM, Xu W, Turner CE", "evidence": [ { "database": "RefSeq", "id": "NP_001035919", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001035919" } ], "reference": [ { "type": "PubMed", "id": "32859368", "url": "https://glygen.org/publication/PubMed/32859368" } ] }, { "title": "Exosome-mediated Hic-5 regulates proliferation and apoptosis of osteosarcoma via Wnt/beta-catenin signal pathway.", "journal": "Aging", "date": "2020", "authors": "Sha L, Ma D, Chen C", "evidence": [ { "database": "RefSeq", "id": "NP_001035919", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001035919" } ], "reference": [ { "type": "PubMed", "id": "33310972", "url": "https://glygen.org/publication/PubMed/33310972" } ] }, { "title": "O-GlcNAc modification regulates MTA1 transcriptional activity during breast cancer cell genotoxic adaptation.", "journal": "Biochimica et biophysica acta. General subjects", "date": "2021", "authors": "Xie X, Wu Q, Zhang K, Liu Y, Zhang N, Chen Q, Wang L, Li W, Zhang J, Liu Y", "evidence": [ { "database": "O-GlcNAc Database", "id": "O43294", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O43294" } ], "reference": [ { "type": "PubMed", "id": "34019948", "url": "https://glygen.org/publication/PubMed/34019948" } ] }, { "title": "An Optimized Isotopic Photocleavable Tagging Strategy for Site-Specific and Quantitative Profiling of Protein O-GlcNAcylation in Colorectal Cancer Metastasis.", "journal": "ACS chemical biology", "date": "2022", "authors": "Liu J, Hao Y, Wang C, Jin Y, Yang Y, Gu J, Chen X", "evidence": [ { "database": "O-GlcNAc Database", "id": "O43294", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O43294" } ], "reference": [ { "type": "PubMed", "id": "35254053", "url": "https://glygen.org/publication/PubMed/35254053" } ] }, { "title": "Induction of senescence-like phenotypes by forced expression of hic-5, which encodes a novel LIM motif protein, in immortalized human fibroblasts.", "journal": "Molecular and cellular biology", "date": "1997", "authors": "Shibanuma M, Mochizuki E, Maniwa R, Mashimo J, Nishiya N, Imai S, Takano T, Oshimura M, Nose K", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" } ], "reference": [ { "type": "PubMed", "id": "9032249", "url": "https://glygen.org/publication/PubMed/9032249" } ] }, { "title": "Cell adhesion kinase beta forms a complex with a new member, Hic-5, of proteins localized at focal adhesions.", "journal": "J. Biol. Chem.", "date": "1998", "authors": "Matsuya M, Sasaki H, Aoto H, Mitaka T, Nagura K, Ohba T, Ishino M, Takahashi S, Suzuki R, Sasaki T", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" } ], "reference": [ { "type": "PubMed", "id": "9422762", "url": "https://glygen.org/publication/PubMed/9422762" } ] }, { "title": "Recruitment of the LIM protein hic-5 to focal contacts of human platelets.", "journal": "J. Cell Sci.", "date": "1998", "authors": "Hagmann J, Grob M, Welman A, van Willigen G, Burger M M", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" } ], "reference": [ { "type": "PubMed", "id": "9664039", "url": "https://glygen.org/publication/PubMed/9664039" } ] }, { "title": "Interaction of Hic-5, A senescence-related protein, with focal adhesion kinase.", "journal": "J. Biol. Chem.", "date": "1998", "authors": "Fujita H, Kamiguchi K, Cho D, Shibanuma M, Morimoto C, Tachibana K", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" } ], "reference": [ { "type": "PubMed", "id": "9756887", "url": "https://glygen.org/publication/PubMed/9756887" } ] } ], "pathway": [ { "id": "hsa:7041", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:7041", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "Q62219-1", "protein_name": "Transforming growth factor beta-1-induced transcript 1 protein", "gene_name": "Tgfb1i1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MEDLDALLSDLETTTSHMSRLGAPKERPPETLTPPPPYGHQPQTGSGESSGTTGDKDHLYSTVCKPRSPKPVAPVAPPFSSSSGVLGNGLCELDRLLQELNATQFNITDEIMSQFPSSKMAEGEEKEDQSEDKSSPTVPPSPFPAPSKPSATSATQELDRLMASLSDFRVQNHLPASGPPQPPAASPTREGCPSPPGQTSKGSLDTMLGLLQSDLSRRGVPTQAKGLCGSCNKPIAGQVVTALGRAWHPEHFLCSGCSTTLGGSSFFEKDGAPFCPECYFERFSPRCGFCNQPIRHKMVTALGTHWHPEHFCCVSCGEPFGEEGFHEREGRPYCRRDFLQLFAPRCQGCQGPILDNYISALSALWHPDCFVCRECLAPFSGGSFFEHEGRPLCENHFHAQRGSLCATCGLPVTGRCVSALGRRFHPDHFTCTFCLRPLTKGSFQERASKPYCQPCFLKLFG", "length": 461 }, "evidence": [ { "id": "45936532", "url": "http://www.informatics.jax.org/homology/45936532", "database": "MGI" }, { "id": "O43294", "url": "https://omabrowser.org/oma/group/O43294/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q99PD6-1", "protein_name": "Transforming growth factor beta-1-induced transcript 1 protein", "gene_name": "Tgfb1i1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MEDLDALLSDLETTTSHMSRLGAPKERPPETLTPPPPYGHQPQTGSGESSGASGDKDHLYSTVCKPRSPKSVAPVAPPFSSSSGVLGNGLCELDRLLQELNATQFNITDEIMSQFPSSKMAEGEGKEDQSEDKSITTVPSSTFPAPSKPSATSATQELDRLMASLSDFRVQNHLPASGPPQPPAVSPTREGCPSPPGQTNKGSLDTMLGLLQSDLSRRGVPTQAKGLCGSCNKPIAGQVVTALGRAWHPEHFLCRGCSTTLGGSSFFEKDGAPFCPECYFERFSPRCGFCNQPIRHKMVTALGTHWHPEHFCCVSCGEPFGEEGFHEREGRPYCRRDFLQLFAPRCQGCQGPILDNYISALSALWHPDCFVCRECLAPFSGGSFFEHEGRPLCENHFHAQRGSLCATCGLPVTGRCVSALGRRFHPDHFTCTFCLRPLTKGSFQERASKPYCQPCFLKLFG", "length": 461 }, "evidence": [ { "id": "45936532", "url": "http://www.informatics.jax.org/homology/45936532", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 5, "go_terms": [ { "name": "transcription coactivator activity", "id": "GO:0003713", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003713", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" } ], "pmid": "" }, { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" } ], "pmid": "" }, { "name": "nuclear androgen receptor binding", "id": "GO:0050681", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050681", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" } ], "pmid": "" }, { "name": "Roundabout binding", "id": "GO:0048495", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048495", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" } ], "pmid": "" }, { "name": "I-SMAD binding", "id": "GO:0070411", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070411", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 5, "go_terms": [ { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" } ], "pmid": "" }, { "name": "cytoskeleton", "id": "GO:0005856", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005856", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" } ], "pmid": "" }, { "name": "focal adhesion", "id": "GO:0005925", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005925", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" } ], "pmid": "" }, { "name": "intracellular membrane-bounded organelle", "id": "GO:0043231", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043231", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" } ], "pmid": "" }, { "name": "nuclear matrix", "id": "GO:0016363", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016363", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 12, "go_terms": [ { "name": "cell adhesion", "id": "GO:0007155", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007155", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" } ], "pmid": "" }, { "name": "negative regulation of cell population proliferation", "id": "GO:0008285", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008285", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" } ], "pmid": "" }, { "name": "epithelial cell differentiation", "id": "GO:0030855", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030855", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" } ], "pmid": "" }, { "name": "positive regulation of DNA-templated transcription", "id": "GO:0045893", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045893", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" } ], "pmid": "" }, { "name": "morphogenesis of embryonic epithelium", "id": "GO:0016331", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016331", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" } ], "pmid": "" }, { "name": "Wnt signaling pathway", "id": "GO:0016055", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016055", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" } ], "pmid": "" }, { "name": "positive regulation of transforming growth factor beta receptor signaling pathway", "id": "GO:0030511", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030511", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" } ], "pmid": "" }, { "name": "fat cell differentiation", "id": "GO:0045444", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045444", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" } ], "pmid": "" }, { "name": "negative regulation of fat cell differentiation", "id": "GO:0045599", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045599", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" } ], "pmid": "" }, { "name": "positive regulation of epithelial to mesenchymal transition", "id": "GO:0010718", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010718", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" } ], "pmid": "" }, { "name": "cell fate commitment", "id": "GO:0045165", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045165", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" } ], "pmid": "" }, { "name": "positive regulation of ubiquitin-dependent protein catabolic process", "id": "GO:2000060", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000060", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 101, "end_pos": 103, "annotation": "n_glycosylation_sequon" }, { "start_pos": 106, "end_pos": 108, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Phosphorylated by gonadotropin-releasing hormone-activated SRC.", "evidence": [ { "database": "UniProtKB", "id": "O43294", "url": "https://www.uniprot.org/uniprot/O43294" }, { "database": "PubMed", "id": "17202804", "url": "https://glygen.org/publication/PubMed/17202804" }, { "database": "PubMed", "id": "11311131", "url": "https://glygen.org/publication/PubMed/11311131" }, { "database": "PubMed", "id": "11856738", "url": "https://glygen.org/publication/PubMed/11856738" }, { "database": "PubMed", "id": "17233630", "url": "https://glygen.org/publication/PubMed/17233630" }, { "database": "PubMed", "id": "10838081", "url": "https://glygen.org/publication/PubMed/10838081" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 80, 81 ], "snv_sites": [ 80, 191, 214, 358, 397, 440 ], "glycation_sites": [], "phosphorylation_sites": [ 33, 38, 44, 49, 53, 60, 68, 82, 122, 137, 140, 141, 143, 164, 186, 187, 188, 192, 194, 403, 407 ], "sequon_annotation_sites": [ { "start_pos": 101, "end_pos": 103 }, { "start_pos": 106, "end_pos": 108 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 23 }, { "field": "total_sites", "count": 21 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 6 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 51 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }