{ "uniprot_canonical_ac": "O43157-1", "uniprot_ac": "O43157", "uniprot_id": "PLXB1_HUMAN", "mass": { "chemical_mass": 232298.0, "monoisotopic_mass": 232298.0 }, "refseq": { "ac": "NP_001123554", "name": "plexin-B1 precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001123554" }, "gene_names": [ { "name": "PLXNB1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O43157", "id": "O43157" }, { "name": "KIAA0407", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O43157", "id": "O43157" }, { "name": "PLEXIN-B1; PLXN5; SEP", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001123554", "id": "NP_001123554" }, { "name": "PLXN5", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O43157", "id": "O43157" }, { "name": "PLXNB1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001123554", "id": "NP_001123554" }, { "name": "SEP", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O43157", "id": "O43157" } ], "protein_names": [ { "name": "Plexin-B1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O43157" }, { "name": "Semaphorin receptor SEP", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O43157" }, { "name": "plexin 5; semaphorin receptor SEP", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001123554", "id": "NP_001123554" }, { "name": "plexin-B1 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001123554", "id": "NP_001123554" } ], "function": [ { "annotation": "Neurite outgrowth deficits caused by rare PLXNB1 mutation in pediatric bipolar disorder.", "evidence": [ { "database": "RefSeq", "id": "NP_001123554", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001123554" }, { "database": "PubMed", "id": "37032361", "url": "https://glygen.org/publication/PubMed/37032361" } ] }, { "annotation": "PLXNB1 mutations in the etiology of idiopathic hypogonadotropic hypogonadism.", "evidence": [ { "database": "RefSeq", "id": "NP_001123554", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001123554" }, { "database": "PubMed", "id": "35170806", "url": "https://glygen.org/publication/PubMed/35170806" } ] }, { "annotation": "Plexin-Bs enhance their GAP activity with a novel activation switch loop generating a cooperative enzyme.", "evidence": [ { "database": "RefSeq", "id": "NP_001123554", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001123554" }, { "database": "PubMed", "id": "32601713", "url": "https://glygen.org/publication/PubMed/32601713" } ] }, { "annotation": "Receptor for SEMA4D (PubMed:19843518, PubMed:20877282, PubMed:21912513). Plays a role in GABAergic synapse development (By similarity). Mediates SEMA4A- and SEMA4D-dependent inhibitory synapse development (By similarity). Plays a role in RHOA activation and subsequent changes of the actin cytoskeleton (PubMed:12196628, PubMed:15210733). Plays a role in axon guidance, invasive growth and cell migration (PubMed:12198496).", "evidence": [ { "database": "UniProtKB", "id": "O43157", "url": "https://www.uniprot.org/uniprot/O43157#function" }, { "database": "PubMed", "id": "15210733", "url": "https://glygen.org/publication/PubMed/15210733" }, { "database": "PubMed", "id": "12198496", "url": "https://glygen.org/publication/PubMed/12198496" }, { "database": "PubMed", "id": "20877282", "url": "https://glygen.org/publication/PubMed/20877282" }, { "database": "PubMed", "id": "21912513", "url": "https://glygen.org/publication/PubMed/21912513" }, { "database": "PubMed", "id": "12196628", "url": "https://glygen.org/publication/PubMed/12196628" }, { "database": "PubMed", "id": "19843518", "url": "https://glygen.org/publication/PubMed/19843518" }, { "database": "UniProtKB", "id": "Q8CJH3", "url": "https://www.uniprot.org/uniprot/Q8CJH3#function" } ] }, { "annotation": "Sema4D/Plexin-B1 promotes the progression of osteosarcoma cells by activating Pyk2-PI3K-AKT pathway.", "evidence": [ { "database": "RefSeq", "id": "NP_001123554", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001123554" }, { "database": "PubMed", "id": "34854398", "url": "https://glygen.org/publication/PubMed/34854398" } ] }, { "annotation": "Semaphorin4A promotes lung cancer by activation of NF-kappaB pathway mediated by PlexinB1. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001123554", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001123554" }, { "database": "PubMed", "id": "37901456", "url": "https://glygen.org/publication/PubMed/37901456" } ] }, { "annotation": "The plexin-B1/Rac interaction inhibits PAK activation and enhances Sema4D ligand binding", "evidence": [ { "database": "RefSeq", "id": "NP_001123554", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001123554" }, { "database": "PubMed", "id": "11937491", "url": "https://glygen.org/publication/PubMed/11937491" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs954109295", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs954109295" }, { "id": "rs954109295", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs954109295#frequency_tab" }, { "id": "rs954109295", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs954109295" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 1185, "end_pos": 1185, "sequence_org": "S", "sequence_mut": "C", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->NGC).", "chr_id": "3", "chr_pos": "48416094", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S1185", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs954109295", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs954109295" }, { "id": "rs954109295", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs954109295#frequency_tab" }, { "id": "rs954109295", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs954109295" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 1185, "end_pos": 1185, "sequence_org": "S", "sequence_mut": "F", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->NGF).", "chr_id": "3", "chr_pos": "48416094", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S1185", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs778301118", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778301118" }, { "id": "rs778301118", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778301118" }, { "id": "rs778301118", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs778301118#frequency_tab" }, { "id": "rs778301118", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs778301118" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1224, "end_pos": 1224, "sequence_org": "T", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->K).", "chr_id": "3", "chr_pos": "48415706", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1224", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs778301118", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778301118" }, { "id": "rs778301118", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778301118" }, { "id": "rs778301118", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs778301118#frequency_tab" }, { "id": "rs778301118", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs778301118" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1224, "end_pos": 1224, "sequence_org": "T", "sequence_mut": "M", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->M).", "chr_id": "3", "chr_pos": "48415706", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1224", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1575393531", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1575393531" }, { "id": "rs1575393531", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1575393531" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 1224, "end_pos": 1224, "sequence_org": "T", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->P).", "chr_id": "3", "chr_pos": "48415707", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1224", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O43157", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O43157" }, { "id": "rs1256351609", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1256351609" }, { "id": "rs1256351609", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1256351609#frequency_tab" }, { "id": "rs1256351609", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1256351609" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 1253, "end_pos": 1253, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NIT->SIT).", "chr_id": "3", "chr_pos": "48415619", "ref_nt": "T", "alt_nt": "C", "minor_allelic_frequency": "", "site_lbl": "N1253", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi" ] }, { "evidence": [ { "id": "rs1560057838", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1560057838" }, { "id": "rs1560057838", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1560057838" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 1255, "end_pos": 1255, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->NII).", "chr_id": "3", "chr_pos": "48415613", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1255", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1575393228", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1575393228" }, { "id": "rs1575393228", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1575393228" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 1255, "end_pos": 1255, "sequence_org": "T", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->NIP).", "chr_id": "3", "chr_pos": "48415614", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1255", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs771118029", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771118029" }, { "id": "rs771118029", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771118029" }, { "id": "rs771118029", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs771118029#frequency_tab" }, { "id": "rs771118029", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs771118029" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 1260, "end_pos": 1260, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (TKS->NKS).", "chr_id": "3", "chr_pos": "48415598", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T1260", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs766775375", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs766775375" }, { "id": "rs766775375", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs766775375" }, { "id": "rs766775375", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs766775375#frequency_tab" }, { "id": "rs766775375", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs766775375" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 1330, "end_pos": 1330, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->SSS).", "chr_id": "3", "chr_pos": "48415019", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N1330", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1406284235", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1406284235" }, { "id": "rs1406284235", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1406284235" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1369, "end_pos": 1369, "sequence_org": "P", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NPT->NAT).", "chr_id": "3", "chr_pos": "48414903", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P1369", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1406284235", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1406284235" }, { "id": "rs1406284235", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1406284235" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1369, "end_pos": 1369, "sequence_org": "P", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NPT->NST).", "chr_id": "3", "chr_pos": "48414903", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P1369", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs200875085", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs200875085" }, { "id": "rs200875085", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs200875085" }, { "id": "rs200875085", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs200875085" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 148, "end_pos": 148, "sequence_org": "P", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NDP->NDS).", "chr_id": "3", "chr_pos": "48424170", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "P148", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs757535663", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757535663" }, { "id": "rs757535663", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs757535663" }, { "id": "rs757535663", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs757535663#frequency_tab" }, { "id": "rs757535663", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs757535663" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1553, "end_pos": 1553, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DLT->NLT).", "chr_id": "3", "chr_pos": "48412939", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D1553", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs76762037", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs76762037" }, { "id": "rs76762037", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs76762037#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1737, "end_pos": 1737, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NDN->NDS).", "chr_id": "3", "chr_pos": "48411900", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N1737", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs76762037", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs76762037" }, { "id": "rs76762037", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs76762037#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 1737, "end_pos": 1737, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NDN->NDT).", "chr_id": "3", "chr_pos": "48411900", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N1737", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O43157", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O43157" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 1926, "end_pos": 1926, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "K", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (KGT->NGT).", "chr_id": "3", "chr_pos": "48409905", "ref_nt": "C", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "K1926", "disease": [ { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs559719918", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs559719918" }, { "id": "rs559719918", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs559719918" }, { "id": "rs559719918", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs559719918" }, { "id": "rs559719918", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs559719918" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 31, "end_pos": 31, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->SGT).", "chr_id": "3", "chr_pos": "48424520", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "N31", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs761724294", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761724294" }, { "id": "rs761724294", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs761724294" }, { "id": "rs761724294", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs761724294#frequency_tab" }, { "id": "rs761724294", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs761724294" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 336, "end_pos": 336, "sequence_org": "T", "sequence_mut": "M", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NRT->NRM).", "chr_id": "3", "chr_pos": "48423605", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T336", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs956668949", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs956668949" }, { "id": "rs956668949", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs956668949" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 33, "end_pos": 33, "sequence_org": "T", "sequence_mut": "M", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGT->NGM).", "chr_id": "3", "chr_pos": "48424514", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T33", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1216866439", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1216866439" }, { "id": "rs1216866439", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1216866439#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 543, "end_pos": 543, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->SIS).", "chr_id": "3", "chr_pos": "48421699", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N543", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1479353835", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1479353835" }, { "id": "rs1479353835", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1479353835" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 543, "end_pos": 543, "sequence_org": "N", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->YIS).", "chr_id": "3", "chr_pos": "48421700", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N543", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O43157", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O43157" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 582, "end_pos": 582, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (TGS->NGS).", "chr_id": "3", "chr_pos": "48421293", "ref_nt": "G", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "T582", "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs759321808", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs759321808" }, { "id": "rs759321808", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs759321808" }, { "id": "rs759321808", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs759321808" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 693, "end_pos": 693, "sequence_org": "S", "sequence_mut": "F", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->F).", "chr_id": "3", "chr_pos": "48420208", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S693", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O43157", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O43157" }, { "id": "rs1366345664", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1366345664" }, { "id": "rs1366345664", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1366345664#frequency_tab" }, { "id": "rs1366345664", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1366345664" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 693, "end_pos": 693, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "P", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (S->P).", "chr_id": "3", "chr_pos": "48420209", "ref_nt": "A", "alt_nt": "G", "minor_allelic_frequency": "", "site_lbl": "S693", "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] }, { "evidence": [ { "id": "O43157", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O43157" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 693, "end_pos": 693, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "Y", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (S->Y).", "chr_id": "3", "chr_pos": "48420208", "ref_nt": "G", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "S693", "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "O43157", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O43157" }, { "id": "rs868708658", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs868708658" }, { "id": "rs868708658", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs868708658#frequency_tab" }, { "id": "rs868708658", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs868708658" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 696, "end_pos": 696, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "P", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (T->P).", "chr_id": "3", "chr_pos": "48420200", "ref_nt": "T", "alt_nt": "G", "minor_allelic_frequency": "", "site_lbl": "T696", "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] }, { "evidence": [ { "id": "rs746171195", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746171195" }, { "id": "rs746171195", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746171195" }, { "id": "rs746171195", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs746171195" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 768, "end_pos": 768, "sequence_org": "P", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NGP->NGS).", "chr_id": "3", "chr_pos": "48419984", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P768", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1436614844", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1436614844" }, { "id": "rs1436614844", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1436614844" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 790, "end_pos": 790, "sequence_org": "S", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->P).", "chr_id": "3", "chr_pos": "48419918", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S790", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1446023259", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1446023259" }, { "id": "rs1446023259", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1446023259" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 952, "end_pos": 952, "sequence_org": "C", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NEC->NES).", "chr_id": "3", "chr_pos": "48419018", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "C952", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs780898975", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs780898975" }, { "id": "rs780898975", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs780898975" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 97, "end_pos": 97, "sequence_org": "P", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NNP->NNT).", "chr_id": "3", "chr_pos": "48424323", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P97", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [ { "start_pos": 1302, "end_pos": 1305, "sequence_org": "RRRR", "sequence_mut": "AAAA", "comment": "Abolishes cleavage by proprotein convertases.", "evidence": [ { "database": "UniProtKB", "id": "O43157", "url": "https://www.uniprot.org/uniprot/O43157" }, { "database": "PubMed", "id": "12533544", "url": "https://glygen.org/publication/PubMed/12533544" } ] }, { "start_pos": 139, "end_pos": 139, "sequence_org": "D", "sequence_mut": "K", "comment": "Strongly reduced interaction with SEMA4D.", "evidence": [ { "database": "UniProtKB", "id": "O43157", "url": "https://www.uniprot.org/uniprot/O43157" }, { "database": "PubMed", "id": "20877282", "url": "https://glygen.org/publication/PubMed/20877282" } ] }, { "start_pos": 1815, "end_pos": 1815, "sequence_org": "L", "sequence_mut": "F", "comment": "Abolishes interaction with RAC1 and RND1.", "evidence": [ { "database": "UniProtKB", "id": "O43157", "url": "https://www.uniprot.org/uniprot/O43157" }, { "database": "PubMed", "id": "18275816", "url": "https://glygen.org/publication/PubMed/18275816" } ] }, { "start_pos": 1815, "end_pos": 1815, "sequence_org": "L", "sequence_mut": "P", "comment": "Abolishes interaction with RAC1 and RND1.", "evidence": [ { "database": "UniProtKB", "id": "O43157", "url": "https://www.uniprot.org/uniprot/O43157" }, { "database": "PubMed", "id": "18275816", "url": "https://glygen.org/publication/PubMed/18275816" } ] }, { "start_pos": 1884, "end_pos": 1885, "sequence_org": "WH", "sequence_mut": "SS", "comment": "Loss of cytoskeleton remodeling in response to SEMA4D.", "evidence": [ { "database": "UniProtKB", "id": "O43157", "url": "https://www.uniprot.org/uniprot/O43157" }, { "database": "PubMed", "id": "19843518", "url": "https://glygen.org/publication/PubMed/19843518" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "90.81", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000164050", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164050" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "77.22", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000164050", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164050" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "84.58", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000164050", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164050" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "70.55", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000164050", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164050" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "98.39", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000164050", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164050" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "95.36", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000164050", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164050" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "78.51", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000164050", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164050" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "87.9", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000164050", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164050" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "96.51", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000164050", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164050" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "77.78", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000164050", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164050" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "93.24", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000164050", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164050" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "98.36", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000164050", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164050" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "95.26", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000164050", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164050" } ] } ], "expression_disease": [ { "significant": "No", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O43157", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43157" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O43157", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43157" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O43157", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43157" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O43157", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43157" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O43157", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43157" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O43157", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43157" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O43157", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43157" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O43157", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43157" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O43157", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43157" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O43157", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43157" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O43157", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43157" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O43157", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O43157" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O43157", "url": "https://www.uniprot.org/uniprot/O43157" } ], "common_name": "Human" } ], "gene": [ { "name": "PLXNB1", "url": "https://www.uniprot.org/uniprot/O43157", "locus": { "chromosome": "3", "start_pos": 48403854, "end_pos": 48430086, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000164050", "url": "https://www.ensembl.org/id/ENSG00000164050" } ] } } ], "crossref": [ { "id": "ENSG00000164050", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164050", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "O43157", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O43157", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd01179", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01179", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd01180", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01180", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd01181", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01181", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd11275", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd11275", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd12793", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd12793", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "PLXNB1", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=PLXNB1", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "5364", "url": "https://www.ncbi.nlm.nih.gov/gene/5364", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "1612", "url": "https://glyconnect.expasy.org/browser/proteins/1612", "database": "GlyConnect", "categories": [ "Glycoproteomics", "Glycan" ] }, { "id": "9103", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=9103", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O43157", "url": "https://www.ebi.ac.uk/intact/interactors/id:O43157*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001627", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001627", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002165", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002165", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR002909", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002909", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008936", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008936", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013548", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013548", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013783", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013783", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR014756", "url": "https://www.ebi.ac.uk/interpro/entry/IPR014756", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR015943", "url": "https://www.ebi.ac.uk/interpro/entry/IPR015943", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016201", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016201", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR031148", "url": "https://www.ebi.ac.uk/interpro/entry/IPR031148", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036352", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036352", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR041019", "url": "https://www.ebi.ac.uk/interpro/entry/IPR041019", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR041362", "url": "https://www.ebi.ac.uk/interpro/entry/IPR041362", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR046800", "url": "https://www.ebi.ac.uk/interpro/entry/IPR046800", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:5364", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:5364", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "601053", "url": "http://www.omim.org/entry/601053", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O43157", "url": "https://www.nextprot.org/entry/NX_O43157", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "HFVSAFV", "url": "https://omabrowser.org/oma/group/HFVSAFV/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "1387371at2759", "url": "http://www.orthodb.org/?query=1387371at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR22625", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR22625", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR22625:SF36", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR22625:SF36", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "2JPH", "url": "https://www.rcsb.org/structure/2JPH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2OS6", "url": "https://www.rcsb.org/structure/2OS6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2R2O", "url": "https://www.rcsb.org/structure/2R2O", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2REX", "url": "https://www.rcsb.org/structure/2REX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3HM6", "url": "https://www.rcsb.org/structure/3HM6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3OL2", "url": "https://www.rcsb.org/structure/3OL2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3SU8", "url": "https://www.rcsb.org/structure/3SU8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3SUA", "url": "https://www.rcsb.org/structure/3SUA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5B4W", "url": "https://www.rcsb.org/structure/5B4W", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7VF3", "url": "https://www.rcsb.org/structure/7VF3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7VG7", "url": "https://www.rcsb.org/structure/7VG7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8B3K", "url": "https://www.rcsb.org/structure/8B3K", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF01403", "url": "http://pfam.xfam.org/family/PF01403", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF01437", "url": "http://pfam.xfam.org/family/PF01437", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF01833", "url": "http://pfam.xfam.org/family/PF01833", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF08337", "url": "http://pfam.xfam.org/family/PF08337", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF17960", "url": "http://pfam.xfam.org/family/PF17960", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF18020", "url": "http://pfam.xfam.org/family/PF18020", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF20170", "url": "http://pfam.xfam.org/family/PF20170", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O43157", "url": "https://pharos.nih.gov/targets/O43157", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR:000050727", "url": "https://proconsortium.org/app/entry/PR:000050727", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000050728", "url": "https://proconsortium.org/app/entry/PR:000050728", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000050729", "url": "https://proconsortium.org/app/entry/PR:000050729", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000050730", "url": "https://proconsortium.org/app/entry/PR:000050730", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000050731", "url": "https://proconsortium.org/app/entry/PR:000050731", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000050732", "url": "https://proconsortium.org/app/entry/PR:000050732", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000050733", "url": "https://proconsortium.org/app/entry/PR:000050733", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000050734", "url": "https://proconsortium.org/app/entry/PR:000050734", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000050735", "url": "https://proconsortium.org/app/entry/PR:000050735", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR_O43157", "url": "http://purl.obolibrary.org/obo/PR_O43157", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-416550", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416550", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-416572", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416572", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9013405", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013405", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001123554", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001123554", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "O43157", "url": "DISABLED", "database": "UniCarbKB", "categories": [ "Glycoproteomics" ] }, { "id": "O43157", "url": "https://www.uniprot.org/uniprot/O43157", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O43157-1", "url": "https://www.uniprot.org/uniprot/O43157-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O43157-2", "url": "https://www.uniprot.org/uniprot/O43157-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O43157-3", "url": "https://www.uniprot.org/uniprot/O43157-3", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MPALGPALLQALWAGWVLTLQPLPPTAFTPNGTYLQHLARDPTSGTLYLGATNFLFQLSPGLQLEATVSTGPVLDSRDCLPPVMPDECPQAQPTNNPNQLLLVSPGALVVCGSVHQGVCEQRRLGQLEQLLLRPERPGDTQYVAANDPAVSTVGLVAQGLAGEPLLFVGRGYTSRGVGGGIPPITTRALWPPDPQAAFSYEETAKLAVGRLSEYSHHFVSAFARGASAYFLFLRRDLQAQSRAFRAYVSRVCLRDQHYYSYVELPLACEGGRYGLIQAAAVATSREVAHGEVLFAAFSSAAPPTVGRPPSAAAGASGASALCAFPLDEVDRLANRTRDACYTREGRAEDGTEVAYIEYDVNSDCAQLPVDTLDAYPCGSDHTPSPMASRVPLEATPILEWPGIQLTAVAVTMEDGHTIAFLGDSQGQLHRVYLGPGSDGHPYSTQSIQQGSAVSRDLTFDGTFEHLYVMTQSTLLKVPVASCAQHLDCASCLAHRDPYCGWCVLLGRCSRRSECSRGQGPEQWLWSFQPELGCLQVAAMSPANISREETREVFLSVPDLPPLWPGESYSCHFGEHQSPALLTGSGVMCPSPDPSEAPVLPRGADYVSVSVELRFGAVVIAKTSLSFYDCVAVTELRPSAQCQACVSSRWGCNWCVWQHLCTHKASCDAGPMVASHQSPLVSPDPPARGGPSPSPPTAPKALATPAPDTLPVEPGAPSTATASDISPGASPSLLSPWGPWAGSGSISSPGSTGSPLHEEPSPPSPQNGPGTAVPAPTDFRPSATPEDLLASPLSPSEVAAVPPADPGPEALHPTVPLDLPPATVPATTFPGAMGSVKPALDWLTREGGELPEADEWTGGDAPAFSTSTLLSGDGDSAELEGPPAPLILPSSLDYQYDTPGLWELEEATLGASSCPCVESVQGSTLMPVHVEREIRLLGRNLHLFQDGPGDNECVMELEGLEVVVEARVECEPPPDTQCHVTCQQHQLSYEALQPELRVGLFLRRAGRLRVDSAEGLHVVLYDCSVGHGDCSRCQTAMPQYGCVWCEGERPRCVTREACGEAEAVATQCPAPLIHSVEPLTGPVDGGTRVTIRGSNLGQHVQDVLGMVTVAGVPCAVDAQEYEVSSSLVCITGASGEEVAGATAVEVPGRGRGVSEHDFAYQDPKVHSIFPARGPRAGGTRLTLNGSKLLTGRLEDIRVVVGDQPCHLLPEQQSEQLRCETSPRPTPATLPVAVWFGATERRLQRGQFKYTLDPNITSAGPTKSFLSGGREICVRGQNLDVVQTPRIRVTVVSRMLQPSQGLGRRRRVVPETACSLGPSCSSQQFEEPCHVNSSQLITCRTPALPGLPEDPWVRVEFILDNLVFDFATLNPTPFSYEADPTLQPLNPEDPTMPFRHKPGSVFSVEGENLDLAMSKEEVVAMIGDGPCVVKTLTRHHLYCEPPVEQPLPRHHALREAPDSLPEFTVQMGNLRFSLGHVQYDGESPGAFPVAAQVGLGVGTSLLALGVIIIVLMYRRKSKQALRDYKKVQIQLENLESSVRDRCKKEFTDLMTEMTDLTSDLLGSGIPFLDYKVYAERIFFPGHRESPLHRDLGVPESRRPTVEQGLGQLSNLLNSKLFLTKFIHTLESQRTFSARDRAYVASLLTVALHGKLEYFTDILRTLLSDLVAQYVAKNPKLMLRRTETVVEKLLTNWMSICLYTFVRDSVGEPLYMLFRGIKHQVDKGPVDSVTGKAKYTLNDNRLLREDVEYRPLTLNALLAVGPGAGEAQGVPVKVLDCDTISQAKEKMLDQLYKGVPLTQRPDPRTLDVEWRSGVAGHLILSDEDVTSEVQGLWRRLNTLQHYKVPDGATVALVPCLTKHVLRENQDYVPGERTPMLEDVDEGGIRPWHLVKPSDEPEPPRPRRGSLRGGERERAKAIPEIYLTRLLSMKGTLQKFVDDLFQVILSTSRPVPLAVKYFFDLLDEQAQQHGISDQDTIHIWKTNSLPLRFWINIIKNPQFVFDVQTSDNMDAVLLVIAQTFMDACTLADHKLGRDSPINKLLYARDIPRYKRMVERYYADIRQTVPASDQEMNSVLAELSWNYSGDLGARVALHELYKYINKYYDQIITALEEDGTAQKMQLGYRLQQIAAAVENKVTDL", "length": 2135, "header": "sp|O43157-1|PLXB1_HUMAN Isoform 1 of Plexin-B1 OS=Homo sapiens OX=9606 GN=PLXNB1 PE=1 SV=3 CANONICAL=O43157-1" }, "isoforms": [ { "isoform_ac": "O43157-1", "url": "", "sequence": { "sequence": "MPALGPALLQALWAGWVLTLQPLPPTAFTPNGTYLQHLARDPTSGTLYLGATNFLFQLSPGLQLEATVSTGPVLDSRDCLPPVMPDECPQAQPTNNPNQLLLVSPGALVVCGSVHQGVCEQRRLGQLEQLLLRPERPGDTQYVAANDPAVSTVGLVAQGLAGEPLLFVGRGYTSRGVGGGIPPITTRALWPPDPQAAFSYEETAKLAVGRLSEYSHHFVSAFARGASAYFLFLRRDLQAQSRAFRAYVSRVCLRDQHYYSYVELPLACEGGRYGLIQAAAVATSREVAHGEVLFAAFSSAAPPTVGRPPSAAAGASGASALCAFPLDEVDRLANRTRDACYTREGRAEDGTEVAYIEYDVNSDCAQLPVDTLDAYPCGSDHTPSPMASRVPLEATPILEWPGIQLTAVAVTMEDGHTIAFLGDSQGQLHRVYLGPGSDGHPYSTQSIQQGSAVSRDLTFDGTFEHLYVMTQSTLLKVPVASCAQHLDCASCLAHRDPYCGWCVLLGRCSRRSECSRGQGPEQWLWSFQPELGCLQVAAMSPANISREETREVFLSVPDLPPLWPGESYSCHFGEHQSPALLTGSGVMCPSPDPSEAPVLPRGADYVSVSVELRFGAVVIAKTSLSFYDCVAVTELRPSAQCQACVSSRWGCNWCVWQHLCTHKASCDAGPMVASHQSPLVSPDPPARGGPSPSPPTAPKALATPAPDTLPVEPGAPSTATASDISPGASPSLLSPWGPWAGSGSISSPGSTGSPLHEEPSPPSPQNGPGTAVPAPTDFRPSATPEDLLASPLSPSEVAAVPPADPGPEALHPTVPLDLPPATVPATTFPGAMGSVKPALDWLTREGGELPEADEWTGGDAPAFSTSTLLSGDGDSAELEGPPAPLILPSSLDYQYDTPGLWELEEATLGASSCPCVESVQGSTLMPVHVEREIRLLGRNLHLFQDGPGDNECVMELEGLEVVVEARVECEPPPDTQCHVTCQQHQLSYEALQPELRVGLFLRRAGRLRVDSAEGLHVVLYDCSVGHGDCSRCQTAMPQYGCVWCEGERPRCVTREACGEAEAVATQCPAPLIHSVEPLTGPVDGGTRVTIRGSNLGQHVQDVLGMVTVAGVPCAVDAQEYEVSSSLVCITGASGEEVAGATAVEVPGRGRGVSEHDFAYQDPKVHSIFPARGPRAGGTRLTLNGSKLLTGRLEDIRVVVGDQPCHLLPEQQSEQLRCETSPRPTPATLPVAVWFGATERRLQRGQFKYTLDPNITSAGPTKSFLSGGREICVRGQNLDVVQTPRIRVTVVSRMLQPSQGLGRRRRVVPETACSLGPSCSSQQFEEPCHVNSSQLITCRTPALPGLPEDPWVRVEFILDNLVFDFATLNPTPFSYEADPTLQPLNPEDPTMPFRHKPGSVFSVEGENLDLAMSKEEVVAMIGDGPCVVKTLTRHHLYCEPPVEQPLPRHHALREAPDSLPEFTVQMGNLRFSLGHVQYDGESPGAFPVAAQVGLGVGTSLLALGVIIIVLMYRRKSKQALRDYKKVQIQLENLESSVRDRCKKEFTDLMTEMTDLTSDLLGSGIPFLDYKVYAERIFFPGHRESPLHRDLGVPESRRPTVEQGLGQLSNLLNSKLFLTKFIHTLESQRTFSARDRAYVASLLTVALHGKLEYFTDILRTLLSDLVAQYVAKNPKLMLRRTETVVEKLLTNWMSICLYTFVRDSVGEPLYMLFRGIKHQVDKGPVDSVTGKAKYTLNDNRLLREDVEYRPLTLNALLAVGPGAGEAQGVPVKVLDCDTISQAKEKMLDQLYKGVPLTQRPDPRTLDVEWRSGVAGHLILSDEDVTSEVQGLWRRLNTLQHYKVPDGATVALVPCLTKHVLRENQDYVPGERTPMLEDVDEGGIRPWHLVKPSDEPEPPRPRRGSLRGGERERAKAIPEIYLTRLLSMKGTLQKFVDDLFQVILSTSRPVPLAVKYFFDLLDEQAQQHGISDQDTIHIWKTNSLPLRFWINIIKNPQFVFDVQTSDNMDAVLLVIAQTFMDACTLADHKLGRDSPINKLLYARDIPRYKRMVERYYADIRQTVPASDQEMNSVLAELSWNYSGDLGARVALHELYKYINKYYDQIITALEEDGTAQKMQLGYRLQQIAAAVENKVTDL", "length": 2135, "header": "sp|O43157-1|PLXB1_HUMAN Isoform 1 of Plexin-B1 OS=Homo sapiens OX=9606 GN=PLXNB1 PE=1 SV=3 CANONICAL=O43157-1" }, "locus": { "chromosome": "3", "start_pos": 48424611, "end_pos": 48404489, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000296440.11", "url": "https://www.ensembl.org/id/ENST00000296440.11" }, { "database": "Ensembl Peptide", "id": "ENSP00000296440.6", "url": "https://www.ensembl.org/id/ENSP00000296440.6" } ] } }, { "isoform_ac": "O43157-2", "url": "", "sequence": { "sequence": "MPALGPALLQALWAGWVLTLQPLPPTAFTPNGTYLQHLARDPTSGTLYLGATNFLFQLSPGLQLEATVSTGPVLDSRDCLPPVMPDECPQAQPTNNPNQLLLVSPGALVVCGSVHQGVCEQRRLGQLEQLLLRPERPGDTQYVAANDPAVSTVGLVAQGLAGEPLLFVGRGYTSRGVGGGIPPITTRALWPPDPQAAFSYEETAKLAVGRLSEYSHHFVSAFARGASAYFLFLRRDLQAQSRAFRAYVSRVCLRDQHYYSYVELPLACEGGRYGLIQAAAVATSREVAHGEVLFAAFSSAAPPTVGRPPSAAAGASGASALCAFPLDEVDRLANRTRDACYTREGRAEDGTEVAYIEYDVNSDCAQLPVDTLDAYPCGSDHTPSPMASRVPLEATPILEWPGIQLTAVAVTMEDGHTIAFLGDSQGQLHRVYLGPGSDGHPYSTQSIQQGSAVSRDLTFDGTFEHLYVMTQSTLLKVPVASCAQHLDCASCLAHRDPYCGWCVLLGRCSRRSECSRGQGPEQWLWSFQPELGCLQVAAMSPANISREETREVFLSVPDLPPLWPGESYSCHFGEHQSPALLTGSGVMCPSPDPSEAPVLPRGADYVSVSVELRFGAVVIAKTSLSFYDCVAVTELRPSAQCQACVSSRWGCNWCVWQHLCTHKASCDAGPMVASHQSPLVSPDPPARGDGDSAELEGPPAPLILPSSLDYQYDTPGLWELEEATLGASSCPCVESVQGSTLMPVHVEREIRLLGRNLHLFQDGPGDNECVMELEGLEVVVEARVECEPPPDTQCHVTCQQHQLSYEALQPELRVGLFLRRAGRLRVDSAEGLHVVLYDCSVGHGDCSRCQTAMPQYGCVWCEGERPRCVTREACGEAEAVATQCPAPLIHSVEPLTGPVDGGTRVTIRGSNLGQHVQDVLGMVTVAGVPCAVDAQEYEVSSSLVCITGASGEEVAGATAVEVPGRGRGVSEHDFAYQDPKVHSIFPARGPRAGGTRLTLNGSKLLTGRLEDIRVVVGDQPCHLLPEQQSEQLRCETSPRPTPATLPVAVWFGATERRLQRGQFKYTLDPNITSAGPTKSFLSGGREICVRGQNLDVVQTPRIRVTVVSRMLQPSQGLGRRRRVVPETACSLGPSCSSQQFEEPCHVNSSQLITCRTPALPGLPEDPWVRVEFILDNLVFDFATLNPTPFSYEADPTLQPLNPEDPTMPFRHKPGSVFSVEGENLDLAMSKEEVVAMIGDGPCVVKTLTRHHLYCEPPVEQPLPRHHALREAPDSLPEFTVQMGNLRFSLGHVQYDGESPGAFPVAAQVGLGVGTSLLALGVIIIVLMYRRKSKQALRDYKKVQIQLENLESSVRDRCKKEFTDLMTEMTDLTSDLLGSGIPFLDYKVYAERIFFPGHRESPLHRDLGVPESRRPTVEQGLGQLSNLLNSKLFLTKFIHTLESQRTFSARDRAYVASLLTVALHGKLEYFTDILRTLLSDLVAQYVAKNPKLMLRRTETVVEKLLTNWMSICLYTFVRDSVGEPLYMLFRGIKHQVDKGPVDSVTGKAKYTLNDNRLLREDVEYRPLTLNALLAVGPGAGEAQGVPVKVLDCDTISQAKEKMLDQLYKGVPLTQRPDPRTLDVEWRSGVAGHLILSDEDVTSEVQGLWRRLNTLQHYKVPDGATVALVPCLTKHVLRENQDYVPGERTPMLEDVDEGGIRPWHLVKPSDEPEPPRPRRGSLRGGERERAKAIPEIYLTRLLSMKGTLQKFVDDLFQVILSTSRPVPLAVKYFFDLLDEQAQQHGISDQDTIHIWKTNSLPLRFWINIIKNPQFVFDVQTSDNMDAVLLVIAQTFMDACTLADHKLGRDSPINKLLYARDIPRYKRMVERYYADIRQTVPASDQEMNSVLAELSWNYSGDLGARVALHELYKYINKYYDQIITALEEDGTAQKMQLGYRLQQIAAAVENKVTDL", "length": 1952, "header": "sp|O43157-2|PLXB1_HUMAN Isoform 2 of Plexin-B1 OS=Homo sapiens OX=9606 GN=PLXNB1 PE=1 SV=3 CANONICAL=O43157-1" }, "locus": { "chromosome": "3", "start_pos": 48424611, "end_pos": 48404489, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000456774.5", "url": "https://www.ensembl.org/id/ENST00000456774.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000414199.1", "url": "https://www.ensembl.org/id/ENSP00000414199.1" } ] } }, { "isoform_ac": "O43157-3", "url": "", "sequence": { "sequence": "MPALGPALLQALWAGWVLTLQPLPPTAFTPNGTYLQHLARDPTSGTLYLGATNFLFQLSPGLQLEATVSTGPVLDSRDCLPPVMPDECPQAQPTNNPNQLLLVSPGALVVCGSVHQGVCEQRRLGQLEQLLLRPERPGDTQYVAANDPAVSTVGLVAQGLAGEPLLFVGRGYTSRGVGGGIPPITTRALWPPDPQAAFSYEETAKLAVGRLSEYSHHFVSAFARGASAYFLFLRRDLQAQSRAFRAYVSRVCLRDQHYYSYVELPLACEGGRYGLIQAAAVATSREVAHGEVLFAAFSSAAPPTVGRPPSAAAGASGASALCAFPLDEVDRLANRTRDACYTREGRAEDGTEVAYIEYDVNSDCAQLPVDTLDAYPCGSDHTPSPMASRVPLEATPILEWPGIQLTAVAVTMEDGHTIAFLGDSQGQLHRVYLGPGSDGHPYSTQSIQQGSAVSRDLTFDGTFEHLYVMTQSTLLKVPVASCAQHLDCASCLAHRDPYCGWCVLLGRCSRRSECSRGQGPEQWLWSFQPELGCLQVAAMSPANISREETREVFLSVPDLPPLWPGESYSCHFGEHQSPALLTGSGVMCPSPDPSEAPVLPRGADYVSVSVELRFGAVVIAKTSLSFYDCVAVTELRPSAQCQACVSSRWGCNWCVWQHLCTHKASCDAGPMVASHQVMETQQSLRALPPPSSSRPASTTSMTPPGSGSWKRRPWGQAPAPVWRAFRAPR", "length": 729, "header": "sp|O43157-3|PLXB1_HUMAN Isoform 3 of Plexin-B1 OS=Homo sapiens OX=9606 GN=PLXNB1 PE=1 SV=3 CANONICAL=O43157-1" }, "locus": { "chromosome": "3", "start_pos": 48424611, "end_pos": 48419306, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000449094.5", "url": "https://www.ensembl.org/id/ENST00000449094.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000395987.1", "url": "https://www.ensembl.org/id/ENSP00000395987.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G38663NM", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1183, "start_aa": "Asn", "end_pos": 1183, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1183", "evidence": [ { "id": "1612", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1612" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G57888GL", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1183, "start_aa": "Asn", "end_pos": 1183, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1183", "evidence": [ { "id": "1612", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1612" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 1183, "start_aa": "Asn", "end_pos": 1183, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1183", "evidence": [ { "id": "O43157", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43157#ptm_processing" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 1224, "start_aa": "Thr", "end_pos": 1224, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr1224", "evidence": [ { "id": "O43157", "database": "UniCarbKB", "url": "" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" } ] }, { "glytoucan_ac": "G00912UN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1253, "start_aa": "Asn", "end_pos": 1253, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1253", "evidence": [ { "id": "O43157", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1253, "start_aa": "Asn", "end_pos": 1253, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1253", "evidence": [ { "id": "1612", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1612" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G22310AV", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1253, "start_aa": "Asn", "end_pos": 1253, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1253", "evidence": [ { "id": "1612", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1612" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G27947YN", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1253, "start_aa": "Asn", "end_pos": 1253, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1253", "evidence": [ { "id": "O43157", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1253, "start_aa": "Asn", "end_pos": 1253, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1253", "evidence": [ { "id": "1612", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1612" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G52527GH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1253, "start_aa": "Asn", "end_pos": 1253, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1253", "evidence": [ { "id": "1612", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1612" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1253, "start_aa": "Asn", "end_pos": 1253, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1253", "evidence": [ { "id": "O43157", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "G88374WZ", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 1253, "start_aa": "Asn", "end_pos": 1253, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1253", "evidence": [ { "id": "O43157", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 1253, "start_aa": "Asn", "end_pos": 1253, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1253", "evidence": [ { "id": "O43157", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43157#ptm_processing" }, { "id": "19349973", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19349973" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "16335952", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16335952" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 1330, "start_aa": "Asn", "end_pos": 1330, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn1330", "evidence": [ { "id": "O43157", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43157#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 31, "start_aa": "Asn", "end_pos": 31, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn31", "evidence": [ { "id": "O43157", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43157#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 334, "start_aa": "Asn", "end_pos": 334, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn334", "evidence": [ { "id": "O43157", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43157#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 543, "start_aa": "Asn", "end_pos": 543, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn543", "evidence": [ { "id": "O43157", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43157#ptm_processing" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "GGPSPSPPTAPK", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 688, "start_aa": "Gly", "end_pos": 699, "end_aa": "Lys", "evidence": [ { "id": "O43157", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 691, "start_aa": "Ser", "end_pos": 691, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser691", "evidence": [ { "id": "O43157", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 693, "start_aa": "Ser", "end_pos": 693, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser693", "evidence": [ { "id": "O43157", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 693, "start_aa": "Ser", "end_pos": 693, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser693", "evidence": [ { "id": "O43157", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 696, "start_aa": "Thr", "end_pos": 696, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr696", "evidence": [ { "id": "O43157", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 790, "start_aa": "Ser", "end_pos": 790, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser790", "evidence": [ { "id": "O43157", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 790, "start_aa": "Ser", "end_pos": 790, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser790", "evidence": [ { "id": "O43157", "database": "UniCarbKB", "url": "" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 793, "start_aa": "Ser", "end_pos": 793, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser793", "evidence": [ { "id": "O43157", "database": "UniCarbKB", "url": "" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 795, "start_aa": "Ser", "end_pos": 795, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser795", "evidence": [ { "id": "O43157", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 795, "start_aa": "Ser", "end_pos": 795, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser795", "evidence": [ { "id": "O43157", "database": "UniCarbKB", "url": "" }, { "id": "25813380", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/25813380" }, { "id": "10.1074/mcp.M114.046862", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" } ] }, { "glytoucan_ac": "G29068FM", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 834, "start_aa": "Ser", "end_pos": 834, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser834", "evidence": [ { "id": "O43157", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 834, "start_aa": "Ser", "end_pos": 834, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser834", "evidence": [ { "id": "O43157", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan", "glycoprotein_predicted", "glycoprotein_reported" ], "publication": [ { "title": "Precision mapping of the human O-GalNAc glycoproteome through SimpleCell technology", "journal": "EMBO J", "date": "2013", "authors": "Steentoft C., Vakhrushev S.Y., Joshi H.J., Kong Y., Vester-Christensen M.B., Schjoldager K.T., Lavrsen K., Dabelsteen S., Pedersen N.B., Marcos-Silva L., Gupta R., Bennett E.P., Mandel U., Brunak S., Wandall H.H., Levery S.B., Clausen H.", "evidence": [ { "database": "UniCarbKB", "id": "O43157", "url": "" } ], "reference": [ { "type": "DOI", "id": "10.1038/emboj.2013.79", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "title": "Probing the O-Glycoproteome of Gastric Cancer Cell Lines for Biomarker Discovery", "journal": "Molecular & Cellular Proteomics", "date": "2015", "authors": "Campos D., Freitas D., Gomes J., Magalh\u00e3es A., Steentoft C., Gomes C., Vester-Christensen M. B., Ferreira J. A., Afonso L. P., Santos L. L., Pinto de Sousa J., Mandel U., Clausen H., Vakhrushev S. Y., Reis C. A.", "evidence": [ { "database": "UniCarbKB", "id": "O43157", "url": "" } ], "reference": [ { "type": "DOI", "id": "10.1074/mcp.M114.046862", "url": "https://glygen.org/publication/DOI/10.1074/mcp.M114.046862" } ] }, { "title": "Plexins are a large family of receptors for transmembrane, secreted, and GPI-anchored semaphorins in vertebrates.", "journal": "Cell", "date": "1999", "authors": "Tamagnone L, Artigiani S, Chen H, He Z, Ming GI, Song H, Chedotal A, Winberg ML, Goodman CS, Poo M, Tessier-Lavigne M, Comoglio PM", "evidence": [ { "database": "UniProtKB", "id": "O43157", "url": "https://www.uniprot.org/uniprot/O43157" } ], "reference": [ { "type": "PubMed", "id": "10520995", "url": "https://glygen.org/publication/PubMed/10520995" } ] }, { "title": "Rho-associated kinase ROCK activates LIM-kinase 1 by phosphorylation at threonine 508 within the activation loop.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Ohashi K, Nagata K, Maekawa M, Ishizaki T, Narumiya S, Mizuno K", "evidence": [ { "database": "Reactome", "id": "R-HSA-416572", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416572" } ], "reference": [ { "type": "PubMed", "id": "10652353", "url": "https://glygen.org/publication/PubMed/10652353" } ] }, { "title": "Specific activation of LIM kinase 2 via phosphorylation of threonine 505 by ROCK, a Rho-dependent protein kinase.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Sumi T, Matsumoto K, Nakamura T", "evidence": [ { "database": "Reactome", "id": "R-HSA-416572", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416572" } ], "reference": [ { "type": "PubMed", "id": "11018042", "url": "https://glygen.org/publication/PubMed/11018042" } ] }, { "title": "The semaphorin receptor plexin-B1 specifically interacts with active Rac in a ligand-dependent manner.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2000", "authors": "Vikis HG, Li W, He Z, Guan KL", "evidence": [ { "database": "UniProtKB", "id": "O43157", "url": "https://www.uniprot.org/uniprot/O43157" }, { "database": "Reactome", "id": "R-HSA-416550", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416550" } ], "reference": [ { "type": "PubMed", "id": "11035813", "url": "https://glygen.org/publication/PubMed/11035813" } ] }, { "title": "Membrane blebbing during apoptosis results from caspase-mediated activation of ROCK I.", "journal": "Nature cell biology", "date": "2001", "authors": "Coleman ML, Sahai EA, Yeo M, Bosch M, Dewar A, Olson MF", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "11283606", "url": "https://glygen.org/publication/PubMed/11283606" } ] }, { "title": "Arachidonic acid-induced Ca2+ sensitization of smooth muscle contraction through activation of Rho-kinase.", "journal": "Pflugers Archiv : European journal of physiology", "date": "2001", "authors": "Araki S, Ito M, Kureishi Y, Feng J, Machida H, Isaka N, Amano M, Kaibuchi K, Hartshorne DJ, Nakano T", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "11294240", "url": "https://glygen.org/publication/PubMed/11294240" } ] }, { "title": "RGS-containing RhoGEFs: the missing link between transforming G proteins and Rho?", "journal": "Oncogene", "date": "2001", "authors": "Fukuhara S, Chikumi H, Gutkind JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "11313914", "url": "https://glygen.org/publication/PubMed/11313914" } ] }, { "title": "Competing modes of self-association in the regulatory domains of Bruton's tyrosine kinase: intramolecular contact versus asymmetric homodimerization.", "journal": "Protein science : a publication of the Protein Society", "date": "2002", "authors": "Laederach A, Cradic KW, Brazin KN, Zamoon J, Fulton DB, Huang XY, Andreotti AH", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "11742120", "url": "https://glygen.org/publication/PubMed/11742120" } ] }, { "title": "Antagonistic effects of Rnd1 and RhoD GTPases regulate receptor activity in Semaphorin 3A-induced cytoskeletal collapse.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2002", "authors": "Zanata SM, Hovatta I, Rohm B, Puschel AW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013405", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013405" } ], "reference": [ { "type": "PubMed", "id": "11784792", "url": "https://glygen.org/publication/PubMed/11784792" } ] }, { "title": "The plexin-B1/Rac interaction inhibits PAK activation and enhances Sema4D ligand binding.", "journal": "Genes & development", "date": "2002", "authors": "Vikis HG, Li W, Guan KL", "evidence": [ { "database": "Reactome", "id": "R-HSA-416550", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416550" }, { "database": "RefSeq", "id": "NP_001123554", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001123554" } ], "reference": [ { "type": "PubMed", "id": "11937491", "url": "https://glygen.org/publication/PubMed/11937491" } ] }, { "title": "Guanine nucleotide exchange factors for Rho GTPases: turning on the switch.", "journal": "Genes & development", "date": "2002", "authors": "Schmidt A, Hall A", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "12101119", "url": "https://glygen.org/publication/PubMed/12101119" } ] }, { "title": "Plexin-B1 directly interacts with PDZ-RhoGEF/LARG to regulate RhoA and growth cone morphology.", "journal": "Neuron", "date": "2002", "authors": "Swiercz JM, Kuner R, Behrens J, Offermanns S", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "12123608", "url": "https://glygen.org/publication/PubMed/12123608" } ] }, { "title": "Rho-kinase contributes to diphosphorylation of myosin II regulatory light chain in nonmuscle cells.", "journal": "Oncogene", "date": "2002", "authors": "Ueda K, Murata-Hori M, Tatsuka M, Hosoya H", "evidence": [ { "database": "Reactome", "id": "R-HSA-416572", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416572" } ], "reference": [ { "type": "PubMed", "id": "12185584", "url": "https://glygen.org/publication/PubMed/12185584" } ] }, { "title": "The semaphorin receptor plexin-B1 signals through a direct interaction with the Rho-specific nucleotide exchange factor, LARG.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Aurandt J, Vikis HG, Gutkind JS, Ahn N, Guan KL", "evidence": [ { "database": "UniProtKB", "id": "O43157", "url": "https://www.uniprot.org/uniprot/O43157" }, { "database": "Reactome", "id": "R-HSA-416572", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416572" } ], "reference": [ { "type": "PubMed", "id": "12196628", "url": "https://glygen.org/publication/PubMed/12196628" } ] }, { "title": "The semaphorin 4D receptor controls invasive growth by coupling with Met.", "journal": "Nature cell biology", "date": "2002", "authors": "Giordano S, Corso S, Conrotto P, Artigiani S, Gilestro G, Barberis D, Tamagnone L, Comoglio PM", "evidence": [ { "database": "UniProtKB", "id": "O43157", "url": "https://www.uniprot.org/uniprot/O43157" }, { "database": "Reactome", "id": "R-HSA-416550", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416550" } ], "reference": [ { "type": "PubMed", "id": "12198496", "url": "https://glygen.org/publication/PubMed/12198496" } ] }, { "title": "Interaction of plexin-B1 with PDZ domain-containing Rho guanine nucleotide exchange factors.", "journal": "Biochemical and biophysical research communications", "date": "2002", "authors": "Hirotani M, Ohoka Y, Yamamoto T, Nirasawa H, Furuyama T, Kogo M, Matsuya T, Inagaki S", "evidence": [ { "database": "Reactome", "id": "R-HSA-416572", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416572" } ], "reference": [ { "type": "PubMed", "id": "12220504", "url": "https://glygen.org/publication/PubMed/12220504" } ] }, { "title": "Galpha(12/13) mediates alpha(1)-adrenergic receptor-induced cardiac hypertrophy.", "journal": "Circulation research", "date": "2002", "authors": "Maruyama Y, Nishida M, Sugimoto Y, Tanabe S, Turner JH, Kozasa T, Wada T, Nagao T, Kurose H", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "12433842", "url": "https://glygen.org/publication/PubMed/12433842" } ] }, { "title": "Galpha 12 activates Rho GTPase through tyrosine-phosphorylated leukemia-associated RhoGEF.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2003", "authors": "Suzuki N, Nakamura S, Mano H, Kozasa T", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "12515866", "url": "https://glygen.org/publication/PubMed/12515866" } ] }, { "title": "Functional regulation of semaphorin receptors by proprotein convertases.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Artigiani S, Barberis D, Fazzari P, Longati P, Angelini P, van de Loo JW, Comoglio PM, Tamagnone L", "evidence": [ { "database": "UniProtKB", "id": "O43157", "url": "https://www.uniprot.org/uniprot/O43157" } ], "reference": [ { "type": "PubMed", "id": "12533544", "url": "https://glygen.org/publication/PubMed/12533544" } ] }, { "title": "RhoD regulates endosome dynamics through Diaphanous-related Formin and Src tyrosine kinase.", "journal": "Nature cell biology", "date": "2003", "authors": "Gasman S, Kalaidzidis Y, Zerial M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013405", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013405" } ], "reference": [ { "type": "PubMed", "id": "12577064", "url": "https://glygen.org/publication/PubMed/12577064" } ] }, { "title": "Direct interaction of Rnd1 with Plexin-B1 regulates PDZ-RhoGEF-mediated Rho activation by Plexin-B1 and induces cell contraction in COS-7 cells.", "journal": "J. Biol. Chem.", "date": "2003", "authors": "Oinuma I, Katoh H, Harada A, Negishi M", "evidence": [ { "database": "UniProtKB", "id": "O43157", "url": "https://www.uniprot.org/uniprot/O43157" }, { "database": "Reactome", "id": "R-HSA-416550", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416550" } ], "reference": [ { "type": "PubMed", "id": "12730235", "url": "https://glygen.org/publication/PubMed/12730235" } ] }, { "title": "Interplay between scatter factor receptors and B plexins controls invasive growth.", "journal": "Oncogene", "date": "2004", "authors": "Conrotto P, Corso S, Gamberini S, Comoglio PM, Giordano S", "evidence": [ { "database": "UniProtKB", "id": "O43157", "url": "https://www.uniprot.org/uniprot/O43157" } ], "reference": [ { "type": "PubMed", "id": "15184888", "url": "https://glygen.org/publication/PubMed/15184888" } ] }, { "title": "Plexin-B1/RhoGEF-mediated RhoA activation involves the receptor tyrosine kinase ErbB-2.", "journal": "The Journal of cell biology", "date": "2004", "authors": "Swiercz JM, Kuner R, Offermanns S", "evidence": [ { "database": "UniProtKB", "id": "O43157", "url": "https://www.uniprot.org/uniprot/O43157" }, { "database": "Reactome", "id": "R-HSA-416572", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416572" } ], "reference": [ { "type": "PubMed", "id": "15210733", "url": "https://glygen.org/publication/PubMed/15210733" } ] }, { "title": "Direct cleavage of ROCK II by granzyme B induces target cell membrane blebbing in a caspase-independent manner.", "journal": "The Journal of experimental medicine", "date": "2005", "authors": "Sebbagh M, Hamelin J, Bertoglio J, Solary E, Breard J", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "15699075", "url": "https://glygen.org/publication/PubMed/15699075" } ] }, { "title": "Receptors coupled to heterotrimeric G proteins of the G12 family.", "journal": "Trends in pharmacological sciences", "date": "2005", "authors": "Riobo NA, Manning DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "15749160", "url": "https://glygen.org/publication/PubMed/15749160" } ] }, { "title": "The GAPs, GEFs, and GDIs of heterotrimeric G-protein alpha subunits.", "journal": "International journal of biological sciences", "date": "2005", "authors": "Siderovski DP, Willard FS", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "15951850", "url": "https://glygen.org/publication/PubMed/15951850" } ] }, { "title": "p190 Rho-GTPase activating protein associates with plexins and it is required for semaphorin signalling.", "journal": "Journal of cell science", "date": "2005", "authors": "Barberis D, Casazza A, Sordella R, Corso S, Artigiani S, Settleman J, Comoglio PM, Tamagnone L", "evidence": [ { "database": "Reactome", "id": "R-HSA-416550", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416550" } ], "reference": [ { "type": "PubMed", "id": "16188938", "url": "https://glygen.org/publication/PubMed/16188938" } ] }, { "title": "Rho GTPases: biochemistry and biology.", "journal": "Annual review of cell and developmental biology", "date": "2005", "authors": "Jaffe AB, Hall A", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "16212495", "url": "https://glygen.org/publication/PubMed/16212495" } ] }, { "title": "Regulation of LIM-kinase 1 and cofilin in thrombin-stimulated platelets.", "journal": "Blood", "date": "2006", "authors": "Pandey D, Goyal P, Bamburg JR, Siess W", "evidence": [ { "database": "Reactome", "id": "R-HSA-416572", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416572" } ], "reference": [ { "type": "PubMed", "id": "16219803", "url": "https://glygen.org/publication/PubMed/16219803" } ] }, { "title": "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.", "journal": "Journal of proteome research", "date": "2005", "authors": "Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD", "evidence": [ { "database": "UniProtKB", "id": "O43157", "url": "https://www.uniprot.org/uniprot/O43157#ptm_processing" }, { "database": "UniProtKB", "id": "O43157", "url": "https://www.uniprot.org/uniprot/O43157" } ], "reference": [ { "type": "PubMed", "id": "16335952", "url": "https://glygen.org/publication/PubMed/16335952" } ] }, { "title": "Semaphorin 4D/Plexin-B1-mediated R-Ras GAP activity inhibits cell migration by regulating beta(1) integrin activity.", "journal": "The Journal of cell biology", "date": "2006", "authors": "Oinuma I, Katoh H, Negishi M", "evidence": [ { "database": "Reactome", "id": "R-HSA-416550", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416550" } ], "reference": [ { "type": "PubMed", "id": "16702230", "url": "https://glygen.org/publication/PubMed/16702230" } ] }, { "title": "Sema4D/plexin-B1 activates GSK-3beta through R-Ras GAP activity, inducing growth cone collapse.", "journal": "EMBO reports", "date": "2006", "authors": "Ito Y, Oinuma I, Katoh H, Kaibuchi K, Negishi M", "evidence": [ { "database": "Reactome", "id": "R-HSA-416550", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416550" } ], "reference": [ { "type": "PubMed", "id": "16799460", "url": "https://glygen.org/publication/PubMed/16799460" } ] }, { "title": "Structural basis of function in heterotrimeric G proteins.", "journal": "Quarterly reviews of biophysics", "date": "2006", "authors": "Oldham WM, Hamm HE", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "16923326", "url": "https://glygen.org/publication/PubMed/16923326" } ] }, { "title": "The consensus coding sequences of human breast and colorectal cancers.", "journal": "Science (New York, N.Y.)", "date": "2006", "authors": "Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE", "evidence": [ { "database": "UniProtKB", "id": "O43157", "url": "https://www.uniprot.org/uniprot/O43157" } ], "reference": [ { "type": "PubMed", "id": "16959974", "url": "https://glygen.org/publication/PubMed/16959974" } ] }, { "title": "Multiple Rho proteins regulate the subcellular targeting of PAK5.", "journal": "Biochemical and biophysical research communications", "date": "2006", "authors": "Wu X, Frost JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013405", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013405" } ], "reference": [ { "type": "PubMed", "id": "17064668", "url": "https://glygen.org/publication/PubMed/17064668" } ] }, { "title": "Regulation of myosin II dynamics by phosphorylation and dephosphorylation of its light chain in epithelial cells.", "journal": "Molecular biology of the cell", "date": "2007", "authors": "Watanabe T, Hosoya H, Yonemura S", "evidence": [ { "database": "Reactome", "id": "R-HSA-416572", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416572" } ], "reference": [ { "type": "PubMed", "id": "17151359", "url": "https://glygen.org/publication/PubMed/17151359" } ] }, { "title": "Binding of Rac1, Rnd1, and RhoD to a novel Rho GTPase interaction motif destabilizes dimerization of the plexin-B1 effector domain.", "journal": "J. Biol. Chem.", "date": "2007", "authors": "Tong Y, Chugha P, Hota PK, Alviani RS, Li M, Tempel W, Shen L, Park HW, Buck M", "evidence": [ { "database": "UniProtKB", "id": "O43157", "url": "https://www.uniprot.org/uniprot/O43157" }, { "database": "Reactome", "id": "R-HSA-9013405", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013405" } ], "reference": [ { "type": "PubMed", "id": "17916560", "url": "https://glygen.org/publication/PubMed/17916560" } ] }, { "title": "ErbB-2 and met reciprocally regulate cellular signaling via plexin-B1.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Swiercz JM, Worzfeld T, Offermanns S", "evidence": [ { "database": "Reactome", "id": "R-HSA-416572", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416572" } ], "reference": [ { "type": "PubMed", "id": "18025083", "url": "https://glygen.org/publication/PubMed/18025083" } ] }, { "title": "Insights into oncogenic mutations of plexin-B1 based on the solution structure of the Rho GTPase binding domain.", "journal": "Structure (London, England : 1993)", "date": "2008", "authors": "Tong Y, Hota PK, Hamaneh MB, Buck M", "evidence": [ { "database": "UniProtKB", "id": "O43157", "url": "https://www.uniprot.org/uniprot/O43157" } ], "reference": [ { "type": "PubMed", "id": "18275816", "url": "https://glygen.org/publication/PubMed/18275816" } ] }, { "title": "Thromboxane A2: physiology/pathophysiology, cellular signal transduction and pharmacology.", "journal": "Pharmacology & therapeutics", "date": "2008", "authors": "Nakahata N", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "18374420", "url": "https://glygen.org/publication/PubMed/18374420" } ] }, { "title": "Conformational change upon ligand binding and dynamics of the PDZ domain from leukemia-associated Rho guanine nucleotide exchange factor.", "journal": "Protein Sci.", "date": "2008", "authors": "Liu Jiangxin, Zhang Jiahai, Yang Yinshan, Huang Hongda, Shen Weiqun, Hu Qi, Wang Xingsheng, Wu Jihui, Shi Yunyu", "evidence": [ { "database": "UniProtKB", "id": "O43157", "url": "https://www.uniprot.org/uniprot/O43157" } ], "reference": [ { "type": "PubMed", "id": "18411422", "url": "https://glygen.org/publication/PubMed/18411422" } ] }, { "title": "Dissociation of heterotrimeric g proteins in cells.", "journal": "Science signaling", "date": "2008", "authors": "Lambert NA", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "18577758", "url": "https://glygen.org/publication/PubMed/18577758" } ] }, { "title": "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.", "journal": "Journal of proteome research", "date": "2009", "authors": "Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H", "evidence": [ { "database": "UniProtKB", "id": "O43157", "url": "https://www.uniprot.org/uniprot/O43157#ptm_processing" }, { "database": "UniProtKB", "id": "O43157", "url": "https://www.uniprot.org/uniprot/O43157" } ], "reference": [ { "type": "PubMed", "id": "19159218", "url": "https://glygen.org/publication/PubMed/19159218" } ] }, { "title": "Regulation and physiological functions of G12/13-mediated signaling pathways.", "journal": "Neuro-Signals", "date": "2009", "authors": "Suzuki N, Hajicek N, Kozasa T", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "19212140", "url": "https://glygen.org/publication/PubMed/19212140" } ] }, { "title": "Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.", "journal": "Nature biotechnology", "date": "2009", "authors": "Wollscheid B, Bausch-Fluck D, Henderson C, O'Brien R, Bibel M, Schiess R, Aebersold R, Watts JD", "evidence": [ { "database": "UniProtKB", "id": "O43157", "url": "https://www.uniprot.org/uniprot/O43157#ptm_processing" }, { "database": "UniProtKB", "id": "O43157", "url": "https://www.uniprot.org/uniprot/O43157" } ], "reference": [ { "type": "PubMed", "id": "19349973", "url": "https://glygen.org/publication/PubMed/19349973" } ] }, { "title": "Structure and function of the intracellular region of the plexin-b1 transmembrane receptor.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Tong Y, Hota PK, Penachioni JY, Hamaneh MB, Kim S, Alviani RS, Shen L, He H, Tempel W, Tamagnone L, Park HW, Buck M", "evidence": [ { "database": "UniProtKB", "id": "O43157", "url": "https://www.uniprot.org/uniprot/O43157" } ], "reference": [ { "type": "PubMed", "id": "19843518", "url": "https://glygen.org/publication/PubMed/19843518" } ] }, { "title": "Structural basis of semaphorin-plexin signalling.", "journal": "Nature", "date": "2010", "authors": "Janssen BJ, Robinson RA, Perez-Branguli F, Bell CH, Mitchell KJ, Siebold C, Jones EY", "evidence": [ { "database": "UniProtKB", "id": "O43157", "url": "https://www.uniprot.org/uniprot/O43157" } ], "reference": [ { "type": "PubMed", "id": "20877282", "url": "https://glygen.org/publication/PubMed/20877282" } ] }, { "title": "A dual binding mode for RhoGTPases in plexin signalling.", "journal": "PLoS biology", "date": "2011-08", "authors": "Bell Christian H, Aricescu A Radu, Jones E Yvonne, Siebold Christian", "evidence": [ { "database": "UniProtKB", "id": "O43157", "url": "https://www.uniprot.org/uniprot/O43157" } ], "reference": [ { "type": "PubMed", "id": "21912513", "url": "https://glygen.org/publication/PubMed/21912513" } ] }, { "title": "Activation of p115-RhoGEF requires direct association of Galpha13 and the Dbl homology domain.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Chen Z, Guo L, Hadas J, Gutowski S, Sprang SR, Sternweis PC", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "22661716", "url": "https://glygen.org/publication/PubMed/22661716" } ] }, { "title": "RhoD participates in the regulation of cell-cycle progression and centrosome duplication.", "journal": "Oncogene", "date": "2013", "authors": "Kyrkou A, Soufi M, Bahtz R, Ferguson C, Bai M, Parton RG, Hoffmann I, Zerial M, Fotsis T, Murphy C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013405", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013405" } ], "reference": [ { "type": "PubMed", "id": "22665057", "url": "https://glygen.org/publication/PubMed/22665057" } ] }, { "title": "RhoD regulates cytoskeletal dynamics via the actin nucleation-promoting factor WASp homologue associated with actin Golgi membranes and microtubules.", "journal": "Molecular biology of the cell", "date": "2012", "authors": "Gad AK, Nehru V, Ruusala A, Aspenstrom P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013405", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013405" } ], "reference": [ { "type": "PubMed", "id": "23087206", "url": "https://glygen.org/publication/PubMed/23087206" } ] }, { "title": "Quantification of the N-glycosylated secretome by super-SILAC during breast cancer progression and in human blood samples.", "journal": "Molecular & cellular proteomics : MCP", "date": "2013", "authors": "Boersema PJ, Geiger T, Wisniewski JR, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "23090970", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "title": "New insight into the molecular switch mechanism of human Rho family proteins: shifting a paradigm.", "journal": "Biological chemistry", "date": "2013", "authors": "Jaiswal M, Fansa EK, Dvorsky R, Ahmadian MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013405", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013405" } ], "reference": [ { "type": "PubMed", "id": "23096567", "url": "https://glygen.org/publication/PubMed/23096567" } ] }, { "title": "Precision mapping of the human O-GalNAc glycoproteome through SimpleCell technology.", "journal": "The EMBO journal", "date": "2013", "authors": "Steentoft C, Vakhrushev SY, Joshi HJ, Kong Y, Vester-Christensen MB, Schjoldager KT, Lavrsen K, Dabelsteen S, Pedersen NB, Marcos-Silva L, Gupta R, Bennett EP, Mandel U, Brunak S, Wandall HH, Levery SB, Clausen H", "evidence": [ { "database": "UniCarbKB", "id": "O43157", "url": "" } ], "reference": [ { "type": "PubMed", "id": "23584533", "url": "https://glygen.org/publication/PubMed/23584533" } ] }, { "title": "RhoD binds the Rab5 effector Rabankyrin-5 and has a role in trafficking of the platelet-derived growth factor receptor.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2013", "authors": "Nehru V, Voytyuk O, Lennartsson J, Aspenstrom P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013405", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013405" } ], "reference": [ { "type": "PubMed", "id": "24102721", "url": "https://glygen.org/publication/PubMed/24102721" } ] }, { "title": "N-linked glycosylation enrichment for in-depth cell surface proteomics of diffuse large B-cell lymphoma subtypes.", "journal": "Molecular & cellular proteomics : MCP", "date": "2014", "authors": "Deeb SJ, Cox J, Schmidt-Supprian M, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "24190977", "url": "https://glygen.org/publication/PubMed/24190977" } ] }, { "title": "Ripasudil: first global approval.", "journal": "Drugs", "date": "2014", "authors": "Garnock-Jones KP", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "25414122", "url": "https://glygen.org/publication/PubMed/25414122" } ] }, { "title": "RhoD is a Golgi component with a role in anterograde protein transport from the ER to the plasma membrane.", "journal": "Experimental cell research", "date": "2015", "authors": "Blom M, Reis K, Nehru V, Blom H, Gad AK, Aspenstrom P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013405", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013405" } ], "reference": [ { "type": "PubMed", "id": "25746724", "url": "https://glygen.org/publication/PubMed/25746724" } ] }, { "title": "Probing the O-glycoproteome of gastric cancer cell lines for biomarker discovery.", "journal": "Molecular & cellular proteomics : MCP", "date": "2015", "authors": "Campos D, Freitas D, Gomes J, Magalhaes A, Steentoft C, Gomes C, Vester-Christensen MB, Ferreira JA, Afonso LP, Santos LL, Pinto de Sousa J, Mandel U, Clausen H, Vakhrushev SY, Reis CA", "evidence": [ { "database": "UniCarbKB", "id": "O43157", "url": "" } ], "reference": [ { "type": "PubMed", "id": "25813380", "url": "https://glygen.org/publication/PubMed/25813380" } ] }, { "title": "Discovery of the ROCK inhibitor netarsudil for the treatment of open-angle glaucoma.", "journal": "Bioorganic & medicinal chemistry letters", "date": "2016", "authors": "Sturdivant JM, Royalty SM, Lin CW, Moore LA, Yingling JD, Laethem CL, Sherman B, Heintzelman GR, Kopczynski CC, deLong MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "27072905", "url": "https://glygen.org/publication/PubMed/27072905" } ] }, { "title": "Deciphering the Molecular and Functional Basis of RHOGAP Family Proteins: A SYSTEMATIC APPROACH TOWARD SELECTIVE INACTIVATION OF RHO FAMILY PROTEINS.", "journal": "The Journal of biological chemistry", "date": "2016", "authors": "Amin E, Jaiswal M, Derewenda U, Reis K, Nouri K, Koessmeier KT, Aspenstrom P, Somlyo AV, Dvorsky R, Ahmadian MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013405", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013405" } ], "reference": [ { "type": "PubMed", "id": "27481945", "url": "https://glygen.org/publication/PubMed/27481945" } ] }, { "title": "Quantitative GTPase Affinity Purification Identifies Rho Family Protein Interaction Partners.", "journal": "Molecular & cellular proteomics : MCP", "date": "2017", "authors": "Paul F, Zauber H, von Berg L, Rocks O, Daumke O, Selbach M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013405", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013405" } ], "reference": [ { "type": "PubMed", "id": "27852748", "url": "https://glygen.org/publication/PubMed/27852748" } ] }, { "title": "RhoD Inhibits RhoC-ROCK-Dependent Cell Contraction via PAK6.", "journal": "Developmental cell", "date": "2017", "authors": "Durkin CH, Leite F, Cordeiro JV, Handa Y, Arakawa Y, Valderrama F, Way M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013405", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013405" } ], "reference": [ { "type": "PubMed", "id": "28486133", "url": "https://glygen.org/publication/PubMed/28486133" } ] }, { "title": "HINT2 triggers mitochondrial Ca(2+) influx by regulating the mitochondrial Ca(2+) uniporter (MCU) complex and enhances gemcitabine apoptotic effect in pancreatic cancer.", "journal": "Cancer letters", "date": "2017", "authors": "Chen L, Sun Q, Zhou D, Song W, Yang Q, Ju B, Zhang L, Xie H, Zhou L, Hu Z, Yao H, Zheng S, Wang W", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013405", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013405" } ], "reference": [ { "type": "PubMed", "id": "28947137", "url": "https://glygen.org/publication/PubMed/28947137" } ] }, { "title": "Large-scale intact glycopeptide identification by Mascot database search.", "journal": "Scientific reports", "date": "2018", "authors": "Bollineni RC, Koehler CJ, Gislefoss RE, Anonsen JH, Thiede B", "evidence": [ { "database": "GlyConnect", "id": "1612", "url": "https://glyconnect.expasy.org/browser/proteins/1612" } ], "reference": [ { "type": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "title": "Effects of phosphorylation of light chain residues threonine 18 and serine 19 on the properties and conformation of smooth muscle myosin.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Ikebe M, Koretz J, Hartshorne DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-416572", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416572" } ], "reference": [ { "type": "PubMed", "id": "2966156", "url": "https://glygen.org/publication/PubMed/2966156" } ] }, { "title": "Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and alpha-1B-Glycoprotein.", "journal": "Analytical chemistry", "date": "2018", "authors": "Sun S, Hu Y, Jia L, Eshghi ST, Liu Y, Shah P, Zhang H", "evidence": [ { "database": "UniCarbKB", "id": "O43157", "url": "" }, { "database": "GlyConnect", "id": "1612", "url": "https://glyconnect.expasy.org/browser/proteins/1612" } ], "reference": [ { "type": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "title": "RhoD localization and function is dependent on its GTP/GDP-bound state and unique N-terminal motif.", "journal": "European journal of cell biology", "date": "2018", "authors": "Blom M, Reis K, Aspenstrom P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013405", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013405" } ], "reference": [ { "type": "PubMed", "id": "29776664", "url": "https://glygen.org/publication/PubMed/29776664" } ] }, { "title": "Rho Kinase Inhibitors as a Novel Treatment for Glaucoma and Ocular Hypertension.", "journal": "Ophthalmology", "date": "2018", "authors": "Tanna AP, Johnson M", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "30007591", "url": "https://glygen.org/publication/PubMed/30007591" } ] }, { "title": "Mapping the O-glycoproteome using site-specific extraction of O-linked glycopeptides (EXoO).", "journal": "Molecular systems biology", "date": "2018", "authors": "Yang W, Ao M, Hu Y, Li QK, Zhang H", "evidence": [ { "database": "UniCarbKB", "id": "O43157", "url": "" } ], "reference": [ { "type": "PubMed", "id": "30459171", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "title": "Mapping the proximity interaction network of the Rho-family GTPases reveals signalling pathways and regulatory mechanisms.", "journal": "Nature cell biology", "date": "2020", "authors": "Bagci H, Sriskandarajah N, Robert A, Boulais J, Elkholi IE, Tran V, Lin ZY, Thibault MP, Dube N, Faubert D, Hipfner DR, Gingras AC, Cote JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013405", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013405" } ], "reference": [ { "type": "PubMed", "id": "31871319", "url": "https://glygen.org/publication/PubMed/31871319" } ] }, { "title": "Plexin-Bs enhance their GAP activity with a novel activation switch loop generating a cooperative enzyme.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2021", "authors": "Li ZL, Muller-Greven J, Kim S, Tamagnone L, Buck M", "evidence": [ { "database": "RefSeq", "id": "NP_001123554", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001123554" } ], "reference": [ { "type": "PubMed", "id": "32601713", "url": "https://glygen.org/publication/PubMed/32601713" } ] }, { "title": "Sema4D/Plexin-B1 promotes the progression of osteosarcoma cells by activating Pyk2-PI3K-AKT pathway.", "journal": "Journal of musculoskeletal & neuronal interactions", "date": "2021", "authors": "Li C, Wan L, Wang P, Guan X, Li C, Wang X", "evidence": [ { "database": "RefSeq", "id": "NP_001123554", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001123554" } ], "reference": [ { "type": "PubMed", "id": "34854398", "url": "https://glygen.org/publication/PubMed/34854398" } ] }, { "title": "PLXNB1 mutations in the etiology of idiopathic hypogonadotropic hypogonadism.", "journal": "Journal of neuroendocrinology", "date": "2022", "authors": "Welch BA, Cho HJ, Ucakturk SA, Farmer SM, Cetinkaya S, Abaci A, Akkus G, Simsek E, Kotan LD, Turan I, Gurbuz F, Yuksel B, Wray S, Topaloglu AK", "evidence": [ { "database": "RefSeq", "id": "NP_001123554", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001123554" } ], "reference": [ { "type": "PubMed", "id": "35170806", "url": "https://glygen.org/publication/PubMed/35170806" } ] }, { "title": "Neurite outgrowth deficits caused by rare PLXNB1 mutation in pediatric bipolar disorder.", "journal": "Molecular psychiatry", "date": "2023-04-10", "authors": "Yang Guang, Ullah H M Arif, Parker Ethan, Gorsi Bushra, Libowitz Mark, Maguire Colin, King Jace B, Coon Hilary, Lopez-Larson Melissa, Anderson Jeffrey S, Yandell Mark, Shcheglovitov Alex", "evidence": [ { "database": "RefSeq", "id": "NP_001123554", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001123554" } ], "reference": [ { "type": "PubMed", "id": "37032361", "url": "https://glygen.org/publication/PubMed/37032361" } ] }, { "title": "Semaphorin4A promotes lung cancer by activation of NF-\u03baB pathway mediated by PlexinB1.", "journal": "PeerJ", "date": "2023", "authors": "Wei Xiang, Liu Zhili, Shen Yili, Dong Hui, Chen Kai, Shi Xuefei, Chen Yi, Wang Bin, Dong Shunli", "evidence": [ { "database": "RefSeq", "id": "NP_001123554", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001123554" } ], "reference": [ { "type": "PubMed", "id": "37901456", "url": "https://glygen.org/publication/PubMed/37901456" } ] }, { "title": "Phosphorylation of smooth muscle myosin at two distinct sites by myosin light chain kinase.", "journal": "The Journal of biological chemistry", "date": "1985", "authors": "Ikebe M, Hartshorne DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-416572", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416572" } ], "reference": [ { "type": "PubMed", "id": "3839510", "url": "https://glygen.org/publication/PubMed/3839510" } ] }, { "title": "Mechanism of GTP hydrolysis by G-protein alpha subunits.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Kleuss C, Raw AS, Lee E, Sprang SR, Gilman AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "7937899", "url": "https://glygen.org/publication/PubMed/7937899" } ] }, { "title": "A family of transmembrane proteins with homology to the MET-hepatocyte growth factor receptor.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1996", "authors": "Maestrini E, Tamagnone L, Longati P, Cremona O, Gulisano M, Bione S, Tamanini F, Neel BG, Toniolo D, Comoglio PM", "evidence": [ { "database": "UniProtKB", "id": "O43157", "url": "https://www.uniprot.org/uniprot/O43157" } ], "reference": [ { "type": "PubMed", "id": "8570614", "url": "https://glygen.org/publication/PubMed/8570614" } ] }, { "title": "The small GTP-binding protein Rho binds to and activates a 160 kDa Ser/Thr protein kinase homologous to myotonic dystrophy kinase.", "journal": "The EMBO journal", "date": "1996", "authors": "Ishizaki T, Maekawa M, Fujisawa K, Okawa K, Iwamatsu A, Fujita A, Watanabe N, Saito Y, Kakizuka A, Morii N, Narumiya S", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "8617235", "url": "https://glygen.org/publication/PubMed/8617235" } ] }, { "title": "Phosphorylation and activation of myosin by Rho-associated kinase (Rho-kinase).", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Amano M, Ito M, Kimura K, Fukata Y, Chihara K, Nakano T, Matsuura Y, Kaibuchi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-416572", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416572" } ], "reference": [ { "type": "PubMed", "id": "8702756", "url": "https://glygen.org/publication/PubMed/8702756" } ] }, { "title": "The p160 RhoA-binding kinase ROK alpha is a member of a kinase family and is involved in the reorganization of the cytoskeleton.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Leung T, Chen XQ, Manser E, Lim L", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "8816443", "url": "https://glygen.org/publication/PubMed/8816443" } ] }, { "title": "Endosome dynamics regulated by a Rho protein.", "journal": "Nature", "date": "1996", "authors": "Murphy C, Saffrich R, Grummt M, Gournier H, Rybin V, Rubino M, Auvinen P, Lutcke A, Parton RG, Zerial M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013405", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013405" } ], "reference": [ { "type": "PubMed", "id": "8945468", "url": "https://glygen.org/publication/PubMed/8945468" } ] }, { "title": "Rho GTPases and signaling networks.", "journal": "Genes & development", "date": "1997", "authors": "Van Aelst L, D'Souza-Schorey C", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "9308960", "url": "https://glygen.org/publication/PubMed/9308960" } ] }, { "title": "The G protein G alpha12 stimulates Bruton's tyrosine kinase and a rasGAP through a conserved PH/BM domain.", "journal": "Nature", "date": "1998", "authors": "Jiang Y, Ma W, Wan Y, Kozasa T, Hattori S, Huang XY", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "9796816", "url": "https://glygen.org/publication/PubMed/9796816" } ] } ], "pathway": [ { "id": "hsa:5364", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:5364", "resource": "KEGG Pathway" }, { "id": "R-HSA-416482", "name": "G alpha (12/13) signalling events", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482", "resource": "Reactome", "description": "G alpha (12/13) signalling events" }, { "id": "R-HSA-416550", "name": "Sema4D mediated inhibition of cell attachment and migration", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416550", "resource": "Reactome", "description": "Sema4D mediated inhibition of cell attachment and migration" }, { "id": "R-HSA-416572", "name": "Sema4D induced cell migration and growth-cone collapse", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416572", "resource": "Reactome", "description": "Sema4D induced cell migration and growth-cone collapse" }, { "id": "R-HSA-9013405", "name": "RHOD GTPase cycle", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013405", "resource": "Reactome", "description": "RHOD GTPase cycle" } ], "orthologs": [ { "uniprot_canonical_ac": "D3ZDX5-1", "protein_name": "Plexin B1", "gene_name": "Plxnb1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MSVLGPVLLQVFWAGCVLTLQFPVPAAFTANGTHLQHLARDPTTGTLYVGATNFLFQLSPGLQLEAVVSTGPVNDSRDCLPPVIPDECPQAQPTNNPNQLLLVSPEALVVCGSVHQGICELRSLGQIRQLLLRPERPGDTQYVAANDPAVSTVGLVAQGLAGEPLLFVGRGYTSRGVGGGIPPITTRALRPPDPQAAFSYEETAKLAVGRLSEYSHHFVSAFVRGTSAYFLFLRRDLKAPSRAFRAYVSRVCLQDQHYYSYVELPLACQGGRYGLIQAAAVATSKEAARGEILFAAFSSVAPPTVDWPLSASTGASGTSVLCAFPLDEVDQLANDTRDACYTREGRAENGTKVADIAYDVLSDCAQLPVDTPDAFPCGSDHTPSPMVSCVPLEATPILELPGVQLTAVAVTMEDGHTIAFLGDSQGQLHRVYLGPGRSAAPYSKQSIQPGSAVNRDLTFDGTFEHLYVATQTTLVKVPVAPCAQHLDCDSCLAHRDPYCGWCVLLGRCSRRSECSRAQGPEQWLWSFQSELGCLRVVAVSPANISRGERREVFLSVPGLPSLWPEESYFCYFGDQQSPALLTSSGVMCPSPDPSEAPVLQRGADHISVNVELRFGAVVIANTSLSFYDCMAVTEFFPSAPCRACVSSRWGCNWCVWQQLCTHKASCDSGPMVASQQSPLLPLIPPARDVLTPFPLTVPRATATPTPNTFPAEPRAPSIASDVLPGAKPSRLSLWGPWAGPGPILSPTSTESPLHEKPLPPEPPTTPGTTVPAPADLGPLTTPEDLLASYPFPSDAAAVSPTEPGPETLPSMVALDQPPGTAPATLFPGATGSMKPVLDWLTKGGGELLEAEEWMGGDTPAFSTSTLLSGDGDSAEHEGPSAPLILLSSLDYQYDTPGLWELGEVNQRVSSCPCVENVQGSLLIPVHVKREVQLRGRNLWLFQDGPRSSECVLVLEGLEVAVEAQVECEPPPDTWCHIKCQQHQFSYEASKPELQVGLFLRWAGGLRVDSADGLHVVLYDCSVGHGDCSRCQTAMPQYDCVWCEGEHPRCVAREACNEAETVATQCPAPLIHSVEPLTGPIDGGTRVTIRGSNLGQHVQDVLGMVRVAGVPCAVDVGEYDVSSSLVCITGSSGEEVTGAVAVEVPGRGHGVSEFSFAYQDPKVLSIFPVHGPRAGGTHLTLHGSKLLTGRLEDIRVVVGDQPCHLLLEQQSEQLHCETSPNPVPAELPVMVWFGATERRLQHSQFKYTADPNITSVGPAKSFFSGGREIWVRGQNLDVVQMPRIRVTVIPRVPQHGQGLGQKHHVVPEKIEEPCLVNSSHLIMCRSPALPGPPQDPWVQVEFILDNMVFDFATLSPTPFSYEADPTLRSLNPEDPTTPFRHKPGSVFSVEGENLDLAMSKEEVVAMIGDGPCVVKTLTRHHLYCEPPVEQPLPHHHALREAPDALPEFTVQMGNLRFSLGHVQYDGESPVAFPVAAQVGLGVGVSLLALGVIVIVLIYRRKSKQALRDYKKVQIQLENLESSVRDRCKKEFTDLMTEMTDLTSDLLGSGIPFLDYKVYAERVFFPGHQESPLHRDLGVPDSRRPTVEQGLGQLSNLLNSKLFLTKFIHTLESQRTFSARDRAYVASLLTVALHGKLEYFTDILRTLLSDLVAQCVAKNPKLMLRRTETVVEKLLTNWMSICLYTFVRDSVGEPLYMLFRGIKHQVDKGPVDSVTGKAKYTLNDNRLLREDVEYRPLTLNALLAVGPGAGEAQSVPVKVLDCDTISQAKEKMLDQLYKGVPLAQRPDSRTLDVEWRSGVAGHLILSDEDVTSELEGLWRRLNTLQHYKVPDGATVALVPCLTKHILRENQDYVPGERTPMLEDVDEGGIRPWHLVKPSDEPEPPRPRRGSLRGGERERAKAIPEIYLTRLLSMKGTLQKFVDDLFQVILSTSRPVPLAVKYFFDLLDEQAQQHGISDQDTIHIWKTNSLPLRFWINIIKNPQFVFDVQTSDNMDAVLLVIAQTFMDACTLADHKLGRDSPINKLLYARDIPRYKQMVERYYADIRQTVPASDQEMNSVLAELSRNCSADLGARVALHELYKYINKYYDQIITALEEDGTAQKMQLGYRLQQIAAAVENKVTDL", "length": 2121 }, "evidence": [ { "id": "45922562", "url": "http://www.informatics.jax.org/homology/45922562", "database": "MGI" }, { "id": "O43157", "url": "https://omabrowser.org/oma/group/O43157/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q8CJH3-1", "protein_name": "Plexin-B1", "gene_name": "Plxnb1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSVLGPVLLQVFWAGCVVTLRSPLPAAFTANGTHLQHLARDPTTGTLYVGATNFLFQLSPGLQLEAVVSTGPVNDSRDCLPPVIPDECPQAQPTNNPNQLLLVSPEALVVCGSVHQGICELRSLGQIRQLLLRPERPGDTQYVAANDPAVSTVGLVAQGLVGEPLLFVGRGYTSRGVGGGIPPITTRALRPPDPQAAFSYEETAKLAVGRLSEYSHHFVSAFVRGASAYFLFLRRDLKAPSRAFRAYVSRVCLQDQHYYSYVELPLACQGGRYGLIQAAAVATSKEVARGDVLFAAFSSVAPPTVDWPLSASTGASGTSVLCAFPLDEVDQLANYTRDACYTREGRAENGTKVADIAYDVLSDCAQLPVDTPDAFPCGSDHTPSPMVSCVPLEATPILELPGVQLTAVAVTMEDGHTIAFLGDSQGQLHRVYLGPGRSAAPYSKQSIQPGSPVNRDLTFDGTFEHLYVATQTTLVKVPVAPCAQHLDCDSCLAHRDPYCGWCVLLGRCSRRSECSRDQGPEQWLWSFQPELGCLRVVAVSPANISREERREVFLSVPGLPSLWPGESYFCYFGDQQSPALLTSSGVMCPSPDPSEAPVLQRGADHISVNVELRFGAVVIASTSLSFYDCVAVTASSPSAPCRACVSSRWGCNWCVWQQLCTHKASCDAGPMVASQQSPLLPLIPPARDELTPFPPTVPQTTVTPTPNSFPIEPRAPSTASDVLPGAKPSRLSLWGPWAGPGPILSPTSTESPLHEKPLPPDPPTIPGTTVPAPTGLGPSTTPEDLLASYPFPSDAAAVSPAEPGPEALPSMVALDQPPGTVPDTTFPGAPGSMKPVLDWLTKGGGELPEADEWMGGDTPAFSTSTLLSGDGDSAEHEGPPAPLILLSSLDYQYDTPGLWELGEVNQRVSSCPCVETVQGSLLIPVHVEREVQLRGRNLWLFQDGPRSSECVLELGSREVAVEAQVECAPPPDVWCHIKCQQHQFSYEALKPELQVGLFLRWAGGLRVDSADGLHVVLYDCSVGHGDCSRCQTAMPQYDCVWCEGERPRCVAREACNEAETVATQCPAPLIHSVDPLTGPIDGGTRVTIRGSNLGQHVQDVLDMVRVAGVPCAVDAGEYDVSSSLVCITGASGEEVTGTVAVEVPGRGHGVSEFSFAYQDPKVHSIFPARGPRAGGTRLTLHGSKLLTGRLEDIRVVVGDQPCHLLLEQQSEQLHCETGPYPVPAELPVTVLFGATERRLQHGQFKYTSDPNVTSVGPSKSFFSGGREIWVRGQDLDVVQRPRIRVTVVPRQHGQGLAQKQHVVPEKFEEPCLVNSSHLLMCRTPALPGPPWDSGVQVEFILDNMVFDFAALSPTPFSYEADPTLRSLNPEDPSTPFRHKPGSVFSVEGENLDLAMSKEEVVAMIGDGPCVVKTLTRNHLYCEPPVEQPLPHPHALREAPDALPEFTVQMGNLRFSLGHVQYDGESPVAFPVAAQVGLGVGTSLLALGVIIIVLIYRRKSKQALRDYKKVQIQLENLESSVRDRCKKEFTDLMTEMTDLTSDLLGSGIPFLDYKVYAERVFFPGYRESPLHRDLGVPDSRRPTVEQGLGQLSNLLNSKLFLTKFIHTLESQRTFSARDRAYVASLLTVALHGKLEYFTDILRTLLSDLVAQYVAKNPKLMLRRTETVVEKLLTNWMSICLYTFVRDSVGEPLYMLFRGIKHQVDKGPVDSVTGKAKYTLNDNRLLREDVEYRPLTLNALLAVGPGAGEAQCVPVKVLDCDTISQAKEKMLDQLYKGVPLAQRPDSCTLDVEWRSGVAGHLILSDEDVTSELQGLWRRLNTLQHYKVPDGATVALVPCLTKHILRENQDYVPGERTPMLEDVDEGGIRPWHLVKPSDEPEPPRPRRGSLRGGERERAKAIPEIYLTRLLSMKGTLQKFVDDLFQVILSTSRPVPLAVKYFFDLLDEQAQQHGISDQDTIHIWKTNSLPLRFWINIIKNPQFVFDVQTSDNMDAVLLVIAQTFMDACTLADHKLGRDSPINKLLYARDIPRYKQMVERYYADIRQTVPASDQEMNSVLAELSRNCSADLGARVALHELYKYINKYYDQIITALEEDGTAQKMQLGYRLQQIAAAVENKVTDL", "length": 2119 }, "evidence": [ { "id": "45922562", "url": "http://www.informatics.jax.org/homology/45922562", "database": "MGI" }, { "id": "O43157", "url": "https://omabrowser.org/oma/group/O43157/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 16, "go_terms": [ { "name": "ossification involved in bone maturation", "id": "GO:0043931", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043931", "evidence": [ { "database": "UniProtKB", "id": "O43157", "url": "https://www.uniprot.org/uniprot/O43157" } ], "pmid": "" }, { "name": "negative regulation of cell adhesion", "id": "GO:0007162", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007162", "evidence": [ { "database": "UniProtKB", "id": "O43157", "url": "https://www.uniprot.org/uniprot/O43157" } ], "pmid": "" }, { "name": "cell migration", "id": "GO:0016477", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016477", "evidence": [ { "database": "UniProtKB", "id": "O43157", "url": "https://www.uniprot.org/uniprot/O43157" } ], "pmid": "" }, { "name": "intracellular signal transduction", "id": "GO:0035556", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035556", "evidence": [ { "database": "UniProtKB", "id": "O43157", "url": "https://www.uniprot.org/uniprot/O43157" } ], "pmid": "" }, { "name": "positive regulation of GTPase activity", "id": "GO:0043547", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043547", "evidence": [ { "database": "UniProtKB", "id": "O43157", "url": "https://www.uniprot.org/uniprot/O43157" } ], "pmid": "" }, { "name": "positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction", "id": "GO:0051897", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051897", "evidence": [ { "database": "UniProtKB", "id": "O43157", "url": "https://www.uniprot.org/uniprot/O43157" } ], "pmid": "" }, { "name": "semaphorin-plexin signaling pathway", "id": "GO:0071526", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071526", "evidence": [ { "database": "UniProtKB", "id": "O43157", "url": "https://www.uniprot.org/uniprot/O43157" } ], "pmid": "" }, { "name": "neuron projection morphogenesis", "id": "GO:0048812", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048812", "evidence": [ { "database": "UniProtKB", "id": "O43157", "url": "https://www.uniprot.org/uniprot/O43157" } ], "pmid": "" }, { "name": "regulation of cell migration", "id": "GO:0030334", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030334", "evidence": [ { "database": "UniProtKB", "id": "O43157", "url": "https://www.uniprot.org/uniprot/O43157" } ], "pmid": "" }, { "name": "positive regulation of Rho protein signal transduction", "id": "GO:0035025", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035025", "evidence": [ { "database": "UniProtKB", "id": "O43157", "url": "https://www.uniprot.org/uniprot/O43157" } ], "pmid": "" }, { "name": "regulation of cell shape", "id": "GO:0008360", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008360", "evidence": [ { "database": "UniProtKB", "id": "O43157", "url": "https://www.uniprot.org/uniprot/O43157" } ], "pmid": "" }, { "name": "positive regulation of axonogenesis", "id": "GO:0050772", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050772", "evidence": [ { "database": "UniProtKB", "id": "O43157", "url": "https://www.uniprot.org/uniprot/O43157" } ], "pmid": "" }, { "name": "regulation of cytoskeleton organization", "id": "GO:0051493", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051493", "evidence": [ { "database": "UniProtKB", "id": "O43157", "url": "https://www.uniprot.org/uniprot/O43157" } ], "pmid": "" }, { "name": "negative regulation of osteoblast proliferation", "id": "GO:0033689", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033689", "evidence": [ { "database": "UniProtKB", "id": "O43157", "url": "https://www.uniprot.org/uniprot/O43157" } ], "pmid": "" }, { "name": "semaphorin-plexin signaling pathway involved in axon guidance", "id": "GO:1902287", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902287", "evidence": [ { "database": "UniProtKB", "id": "O43157", "url": "https://www.uniprot.org/uniprot/O43157" } ], "pmid": "" }, { "name": "inhibitory synapse assembly", "id": "GO:1904862", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904862", "evidence": [ { "database": "UniProtKB", "id": "O43157", "url": "https://www.uniprot.org/uniprot/O43157" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "semaphorin receptor complex", "id": "GO:0002116", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002116", "evidence": [ { "database": "UniProtKB", "id": "O43157", "url": "https://www.uniprot.org/uniprot/O43157" } ], "pmid": "" }, { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "O43157", "url": "https://www.uniprot.org/uniprot/O43157" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "O43157", "url": "https://www.uniprot.org/uniprot/O43157" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 5, "go_terms": [ { "name": "transmembrane signaling receptor activity", "id": "GO:0004888", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004888", "evidence": [ { "database": "UniProtKB", "id": "O43157", "url": "https://www.uniprot.org/uniprot/O43157" } ], "pmid": "" }, { "name": "GTPase activator activity", "id": "GO:0005096", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005096", "evidence": [ { "database": "UniProtKB", "id": "O43157", "url": "https://www.uniprot.org/uniprot/O43157" } ], "pmid": "" }, { "name": "semaphorin receptor binding", "id": "GO:0030215", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030215", "evidence": [ { "database": "UniProtKB", "id": "O43157", "url": "https://www.uniprot.org/uniprot/O43157" } ], "pmid": "" }, { "name": "GTPase activating protein binding", "id": "GO:0032794", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032794", "evidence": [ { "database": "UniProtKB", "id": "O43157", "url": "https://www.uniprot.org/uniprot/O43157" } ], "pmid": "" }, { "name": "semaphorin receptor activity", "id": "GO:0017154", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0017154", "evidence": [ { "database": "UniProtKB", "id": "O43157", "url": "https://www.uniprot.org/uniprot/O43157" } ], "pmid": "" } ] } ] }, "pro_annotation": [ { "name": "plexin-B1 N-glycosylated 1 (human)", "definition": "A plexin-B1 (human) that has been N-glycosylated at the residue equivalent to Asn-1253 of the amino acid sequence represented by UniProtKB:O43157-1, in which the glycan composition is represented by GlyTouCan:G00912UN. Example: UniProtKB:O43157-1, Asn-1253, MOD:00160~GNO:G00912UN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000050727", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000050727" } ] }, { "name": "plexin-B1 N-glycosylated 2 (human)", "definition": "A plexin-B1 (human) that has been N-glycosylated at the residue equivalent to Asn-1253 of the amino acid sequence represented by UniProtKB:O43157-1, in which the glycan composition is represented by GlyTouCan:G27947YN. Example: UniProtKB:O43157-1, Asn-1253, MOD:00160~GNO:G27947YN. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000050728", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000050728" } ] }, { "name": "plexin-B1 N-glycosylated 3 (human)", "definition": "A plexin-B1 (human) that has been N-glycosylated at the residue equivalent to Asn-1253 of the amino acid sequence represented by UniProtKB:O43157-1, in which the glycan composition is represented by GlyTouCan:G59626AS. Example: UniProtKB:O43157-1, Asn-1253, MOD:00160~GNO:G59626AS. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000050729", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000050729" } ] }, { "name": "plexin-B1 N-glycosylated 4 (human)", "definition": "A plexin-B1 (human) that has been N-glycosylated at the residue equivalent to Asn-1253 of the amino acid sequence represented by UniProtKB:O43157-1, in which the glycan composition is represented by GlyTouCan:G88374WZ. Example: UniProtKB:O43157-1, Asn-1253, MOD:00160~GNO:G88374WZ. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000050730", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000050730" } ] }, { "name": "plexin-B1 O-glycosylated 1 (human)", "definition": "A plexin-B1 (human) that has been O-glycosylated at the residue equivalent to Ser-693 of the amino acid sequence represented by UniProtKB:O43157-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:O43157-1, Ser-693, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000050731", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000050731" } ] }, { "name": "plexin-B1 O-glycosylated 2 (human)", "definition": "A plexin-B1 (human) that has been O-glycosylated at the residue equivalent to Ser-790 of the amino acid sequence represented by UniProtKB:O43157-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:O43157-1, Ser-790, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000050732", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000050732" } ] }, { "name": "plexin-B1 O-glycosylated 3 (human)", "definition": "A plexin-B1 (human) that has been O-glycosylated at the residue equivalent to Ser-795 of the amino acid sequence represented by UniProtKB:O43157-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:O43157-1, Ser-795, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000050733", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000050733" } ] }, { "name": "plexin-B1 O-glycosylated 4 (human)", "definition": "A plexin-B1 (human) that has been O-glycosylated at the residue equivalent to Ser-834 of the amino acid sequence represented by UniProtKB:O43157-1, in which the glycan composition is represented by GlyTouCan:G29068FM. Example: UniProtKB:O43157-1, Ser-834, MOD:00002~GNO:G29068FM. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000050734", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000050734" } ] }, { "name": "plexin-B1 O-glycosylated 5 (human)", "definition": "A plexin-B1 (human) that has been O-glycosylated at the residue equivalent to Ser-834 of the amino acid sequence represented by UniProtKB:O43157-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:O43157-1, Ser-834, MOD:00002~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000050735", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000050735" } ] } ], "site_annotation": [ { "start_pos": 1183, "end_pos": 1185, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1253, "end_pos": 1255, "annotation": "n_glycosylation_sequon" }, { "start_pos": 1330, "end_pos": 1332, "annotation": "n_glycosylation_sequon" }, { "start_pos": 2077, "end_pos": 2079, "annotation": "n_glycosylation_sequon" }, { "start_pos": 31, "end_pos": 33, "annotation": "n_glycosylation_sequon" }, { "start_pos": 334, "end_pos": 336, "annotation": "n_glycosylation_sequon" }, { "start_pos": 543, "end_pos": 545, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Phosphorylated on tyrosine residues by ERBB2 and MET upon SEMA4D binding.", "evidence": [ { "database": "UniProtKB", "id": "O43157", "url": "https://www.uniprot.org/uniprot/O43157" }, { "database": "PubMed", "id": "15210733", "url": "https://glygen.org/publication/PubMed/15210733" }, { "database": "PubMed", "id": "10520995", "url": "https://glygen.org/publication/PubMed/10520995" } ] }, { "annotation": "Proteolytic processing favors heterodimerization with PLXNB2 and SEMA4D binding.", "evidence": [ { "database": "UniProtKB", "id": "O43157", "url": "https://www.uniprot.org/uniprot/O43157" }, { "database": "PubMed", "id": "12533544", "url": "https://glygen.org/publication/PubMed/12533544" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [ 31, 334, 543, 1183, 1253, 1330 ], "o_linked_sites": [ 688, 691, 693, 696, 790, 793, 795, 834, 1224 ], "snv_sites": [ 31, 33, 97, 148, 336, 543, 582, 693, 696, 768, 790, 952, 1185, 1224, 1253, 1255, 1260, 1330, 1369, 1553, 1737, 1926 ], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 1183, "end_pos": 1185 }, { "start_pos": 1253, "end_pos": 1255 }, { "start_pos": 1330, "end_pos": 1332 }, { "start_pos": 2077, "end_pos": 2079 }, { "start_pos": 31, "end_pos": 33 }, { "start_pos": 334, "end_pos": 336 }, { "start_pos": 543, "end_pos": 545 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 29 }, { "field": "total_sites", "count": 15 }, { "field": "n_linked_glycans", "count": 10 }, { "field": "n_linked_glycan_sites", "count": 8 }, { "field": "o_linked_glycans", "count": 3 }, { "field": "o_linked_glycan_sites", "count": 9 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 3 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 23 }, { "field": "total_sites", "count": 11 }, { "field": "n_linked_glycans", "count": 10 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 3 }, { "field": "o_linked_glycan_sites", "count": 9 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 3 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 31 }, { "field": "total_sites", "count": 22 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 5 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 25 }, { "field": "total_sites", "count": 18 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 87 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }