{
    "uniprot_canonical_ac": "O21050-1",
    "uniprot_ac": "O21050",
    "uniprot_id": "MP05_DICDI",
    "mass": {
        "chemical_mass": 53253.0,
        "monoisotopic_mass": 53253.0
    },
    "refseq": {
        "ac": "NP_050072",
        "name": "ORF 447",
        "summary": "",
        "url": "https://www.ncbi.nlm.nih.gov/protein/NP_050072"
    },
    "gene_names": [
        {
            "name": "DidioMp05",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/O21050",
            "id": "O21050"
        },
        {
            "name": "DDB_G0294090",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/O21050",
            "id": "O21050"
        }
    ],
    "protein_names": [
        {
            "name": "Uncharacterized mitochondrial protein Mp05",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "O21050"
        },
        {
            "name": "ORF 447",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_050072",
            "id": "NP_050072"
        },
        {
            "name": "ORF447",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "O21050"
        }
    ],
    "function": [],
    "disease": [],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Dictyostelium discoideum",
            "taxid": 44689,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "O21050",
                    "url": "https://www.uniprot.org/uniprot/O21050"
                }
            ],
            "common_name": "Cellular slime molds"
        }
    ],
    "gene": [
        {
            "name": "DidioMp05",
            "url": "https://www.uniprot.org/uniprot/O21050",
            "locus": {}
        }
    ],
    "crossref": [
        {
            "id": "DDB_G0294090",
            "url": "http://dictybase.org/gene/DDB_G0294090",
            "database": "dictyBase",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "2193939",
            "url": "https://www.ncbi.nlm.nih.gov/gene/2193939",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "ddi:DidioMp05",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DidioMp05",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "PR_O21050",
            "url": "http://purl.obolibrary.org/obo/PR_O21050",
            "database": "PRO",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "NP_050072",
            "url": "https://www.ncbi.nlm.nih.gov/protein/NP_050072",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "O21050",
            "url": "https://www.uniprot.org/uniprot/O21050",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "O21050-1",
            "url": "https://www.uniprot.org/uniprot/O21050-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MLITKNNKKKIKKISKRGTNKAFLQKLLSVEKLTNLLKKKQRKVSLARKAQKKIYHKGKFKITDIISIPLRGEVIKRIIKPKLQGIDLVVDEMDHNPINDIEILFYTREQEEERRQEEPEDYPLDAWDKDVLGIVSEDEPQYKNPTDFIYHWEFGILHPVASFEEFFEIDFNHVALHKVDSYGDFAFYGNDPYVKTFEYPTEQYYISEEDAGQFEIDYLLHYSTKLERHSQYLLKRKENYNPKQPQILETDSRSEHYLMNYFYYNKLENVLEKKEGIDDAEVYKFIKLDFGEKMELKLEKFYDLNRERRFRVKKLSQSKLYEFEKAALKGIGFDCFMLIVGIIIFLASSPYLFSQLPWRVKYSLHNTWYHNLLEVIDVLFSMPKVINLEWLYLQAMWEGELTVLKIRGGISVLTAIETIMSVMSNYKDLSQTSQIINYLANFSFDIY",
        "length": 447,
        "header": "sp|O21050-1|MP05_DICDI Isoform 1 of Uncharacterized mitochondrial protein Mp05  OS=Dictyostelium discoideum OX=44689 GN=DidioMp05 PE=4 SV=1 CANONICAL=O21050-1"
    },
    "isoforms": [
        {
            "isoform_ac": "O21050-1",
            "url": "",
            "sequence": {
                "sequence": "MLITKNNKKKIKKISKRGTNKAFLQKLLSVEKLTNLLKKKQRKVSLARKAQKKIYHKGKFKITDIISIPLRGEVIKRIIKPKLQGIDLVVDEMDHNPINDIEILFYTREQEEERRQEEPEDYPLDAWDKDVLGIVSEDEPQYKNPTDFIYHWEFGILHPVASFEEFFEIDFNHVALHKVDSYGDFAFYGNDPYVKTFEYPTEQYYISEEDAGQFEIDYLLHYSTKLERHSQYLLKRKENYNPKQPQILETDSRSEHYLMNYFYYNKLENVLEKKEGIDDAEVYKFIKLDFGEKMELKLEKFYDLNRERRFRVKKLSQSKLYEFEKAALKGIGFDCFMLIVGIIIFLASSPYLFSQLPWRVKYSLHNTWYHNLLEVIDVLFSMPKVINLEWLYLQAMWEGELTVLKIRGGISVLTAIETIMSVMSNYKDLSQTSQIINYLANFSFDIY",
                "length": 447,
                "header": "sp|O21050-1|MP05_DICDI Isoform 1 of Uncharacterized mitochondrial protein Mp05  OS=Dictyostelium discoideum OX=44689 GN=DidioMp05 PE=4 SV=1 CANONICAL=O21050-1"
            },
            "locus": {}
        }
    ],
    "glycosylation": [],
    "phosphorylation": [],
    "glycation": [],
    "keywords": [],
    "publication": [
        {
            "title": "The mitochondrial DNA of Dictyostelium discoideum: complete sequence, gene content and genome organization.",
            "journal": "Mol. Gen. Genet.",
            "date": "2000",
            "authors": "Ogawa S, Yoshino R, Angata K, Iwamoto M, Pi M, Kuroe K, Matsuo K, Morio T, Urushihara H, Yanagisawa K, Tanaka Y",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "O21050",
                    "url": "https://www.uniprot.org/uniprot/O21050"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "10821186",
                    "url": "https://glygen.org/publication/PubMed/10821186"
                }
            ]
        },
        {
            "title": "Group-I introns in the cytochrome c oxidase genes of Dictyostelium discoideum: two related ORFs in one loop of a group-I intron, a cox1/2 hybrid gene and an unusually large cox3 gene.",
            "journal": "Curr. Genet.",
            "date": "1997",
            "authors": "Ogawa S, Matsuo K, Angata K, Yanagisawa K, Tanaka Y",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "O21050",
                    "url": "https://www.uniprot.org/uniprot/O21050"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9000384",
                    "url": "https://glygen.org/publication/PubMed/9000384"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "ddi:DidioMp05",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DidioMp05",
            "resource": "KEGG Pathway"
        }
    ],
    "orthologs": [],
    "go_annotation": {
        "categories": [
            {
                "name": "Biological Process",
                "total": 1,
                "go_terms": [
                    {
                        "name": "sexual reproduction",
                        "id": "GO:0019953",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019953",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O21050",
                                "url": "https://www.uniprot.org/uniprot/O21050"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Cellular Component",
                "total": 1,
                "go_terms": [
                    {
                        "name": "mitochondrion",
                        "id": "GO:0005739",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O21050",
                                "url": "https://www.uniprot.org/uniprot/O21050"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [
        {
            "start_pos": 441,
            "end_pos": 443,
            "annotation": "n_glycosylation_sequon"
        }
    ],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [],
    "sequence_features": {
        "n_linked_sites": [],
        "o_linked_sites": [],
        "snv_sites": [],
        "glycation_sites": [],
        "phosphorylation_sites": [],
        "sequon_annotation_sites": [
            {
                "start_pos": 441,
                "end_pos": 443
            }
        ]
    },
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 2
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}