{ "uniprot_canonical_ac": "O21049-1", "uniprot_ac": "O21049", "uniprot_id": "COX3_DICDI", "mass": { "chemical_mass": 50234.0, "monoisotopic_mass": 50234.0 }, "refseq": { "ac": "NP_050071", "name": "cytochrome oxidase subunit 3", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_050071" }, "gene_names": [ { "name": "cox3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O21049", "id": "O21049" }, { "name": "DDB_G0294092", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O21049", "id": "O21049" }, { "name": "cox3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_050071", "id": "NP_050071" } ], "protein_names": [ { "name": "Cytochrome c oxidase subunit 3", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O21049" }, { "name": "7.1.1.9", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O21049" }, { "name": "Cytochrome c oxidase polypeptide III", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O21049" }, { "name": "cytochrome oxidase subunit 3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_050071", "id": "NP_050071" } ], "function": [ { "annotation": "Component of the cytochrome c oxidase, the last enzyme in the mitochondrial electron transport chain which drives oxidative phosphorylation. The respiratory chain contains 3 multisubunit complexes succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII) and cytochrome c oxidase (complex IV, CIV), that cooperate to transfer electrons derived from NADH and succinate to molecular oxygen, creating an electrochemical gradient over the inner membrane that drives transmembrane transport and the ATP synthase. Cytochrome c oxidase is the component of the respiratory chain that catalyzes the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred via the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1, a binuclear center (BNC) formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.", "evidence": [ { "database": "UniProtKB", "id": "O21049", "url": "https://www.uniprot.org/uniprot/O21049#function" }, { "database": "UniProtKB", "id": "P00420", "url": "https://www.uniprot.org/uniprot/P00420#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Dictyostelium discoideum", "taxid": 44689, "evidence": [ { "database": "UniProtKB", "id": "O21049", "url": "https://www.uniprot.org/uniprot/O21049" } ], "common_name": "Cellular slime molds" } ], "gene": [ { "name": "cox3", "url": "https://www.uniprot.org/uniprot/O21049", "locus": {} } ], "crossref": [ { "id": "cd01665", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01665", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "DDB_G0294092", "url": "http://dictybase.org/gene/DDB_G0294092", "database": "dictyBase", "categories": [ "Organism-specific" ] }, { "id": "2193893", "url": "https://www.ncbi.nlm.nih.gov/gene/2193893", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR000298", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000298", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013833", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013833", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR024791", "url": "https://www.ebi.ac.uk/interpro/entry/IPR024791", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR033945", "url": "https://www.ebi.ac.uk/interpro/entry/IPR033945", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR035973", "url": "https://www.ebi.ac.uk/interpro/entry/IPR035973", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "ddi:DidioMp04", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DidioMp04", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "PTHR11403", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11403", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11403:SF7", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11403:SF7", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00510", "url": "http://pfam.xfam.org/family/PF00510", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_O21049", "url": "http://purl.obolibrary.org/obo/PR_O21049", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_050071", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_050071", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "11436", "url": "https://www.rhea-db.org/rhea/11436", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "O21049", "url": "https://www.uniprot.org/uniprot/O21049", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O21049-1", "url": "https://www.uniprot.org/uniprot/O21049-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKGFFENLFRQNVRSVINTGKKVGARAAAREIINQEWGYPLANHEVLFLTNVYQPKHMKRHPFHIVRGTVAPLAVTLPLGFFVLNYFGVISSKLGLLIALSSFIGGLVIWTISIIFDSLYDQQHTYEVKRGLVMGMMMFIISEVMFFFSFFWSYFYISLSPNIAIGCVWPPYGLTVYSYMGLPLLNTVLLLLSGAILTDGYTILTEQKAVHEKNEKVLAVEEAFKNLMNLYKTKNSINTLTFVDERRDKFFGKESRQEDKIAEQKLIAISAGVKELRDLDWDLYFFENPENIEPNYKEPTNLSVIEYALITIYLKKRNKVIKTRLYFTLLCAVVFLACQGYEYFFAPFSMNDGIYGSLFFLLTGFHGFHVLVGSILIGIITIRFIVGNFNLLNVGTNFQIYKNKSTGFACTLFYWHFVDIVWIFLYIVIYWWGSR", "length": 435, "header": "sp|O21049-1|COX3_DICDI Isoform 1 of Cytochrome c oxidase subunit 3 OS=Dictyostelium discoideum OX=44689 GN=cox3 PE=3 SV=1 CANONICAL=O21049-1" }, "isoforms": [ { "isoform_ac": "O21049-1", "url": "", "sequence": { "sequence": "MKGFFENLFRQNVRSVINTGKKVGARAAAREIINQEWGYPLANHEVLFLTNVYQPKHMKRHPFHIVRGTVAPLAVTLPLGFFVLNYFGVISSKLGLLIALSSFIGGLVIWTISIIFDSLYDQQHTYEVKRGLVMGMMMFIISEVMFFFSFFWSYFYISLSPNIAIGCVWPPYGLTVYSYMGLPLLNTVLLLLSGAILTDGYTILTEQKAVHEKNEKVLAVEEAFKNLMNLYKTKNSINTLTFVDERRDKFFGKESRQEDKIAEQKLIAISAGVKELRDLDWDLYFFENPENIEPNYKEPTNLSVIEYALITIYLKKRNKVIKTRLYFTLLCAVVFLACQGYEYFFAPFSMNDGIYGSLFFLLTGFHGFHVLVGSILIGIITIRFIVGNFNLLNVGTNFQIYKNKSTGFACTLFYWHFVDIVWIFLYIVIYWWGSR", "length": 435, "header": "sp|O21049-1|COX3_DICDI Isoform 1 of Cytochrome c oxidase subunit 3 OS=Dictyostelium discoideum OX=44689 GN=cox3 PE=3 SV=1 CANONICAL=O21049-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "The mitochondrial DNA of Dictyostelium discoideum: complete sequence, gene content and genome organization.", "journal": "Mol. Gen. Genet.", "date": "2000", "authors": "Ogawa S, Yoshino R, Angata K, Iwamoto M, Pi M, Kuroe K, Matsuo K, Morio T, Urushihara H, Yanagisawa K, Tanaka Y", "evidence": [ { "database": "UniProtKB", "id": "O21049", "url": "https://www.uniprot.org/uniprot/O21049" } ], "reference": [ { "type": "PubMed", "id": "10821186", "url": "https://glygen.org/publication/PubMed/10821186" } ] }, { "title": "Group-I introns in the cytochrome c oxidase genes of Dictyostelium discoideum: two related ORFs in one loop of a group-I intron, a cox1/2 hybrid gene and an unusually large cox3 gene.", "journal": "Curr. Genet.", "date": "1997", "authors": "Ogawa S, Matsuo K, Angata K, Yanagisawa K, Tanaka Y", "evidence": [ { "database": "UniProtKB", "id": "O21049", "url": "https://www.uniprot.org/uniprot/O21049" } ], "reference": [ { "type": "PubMed", "id": "9000384", "url": "https://glygen.org/publication/PubMed/9000384" } ] } ], "pathway": [ { "id": "ddi:DidioMp04", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DidioMp04", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "mitochondrial inner membrane", "id": "GO:0005743", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005743", "evidence": [ { "database": "UniProtKB", "id": "O21049", "url": "https://www.uniprot.org/uniprot/O21049" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "mitochondrial electron transport, cytochrome c to oxygen", "id": "GO:0006123", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006123", "evidence": [ { "database": "UniProtKB", "id": "O21049", "url": "https://www.uniprot.org/uniprot/O21049" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "cytochrome-c oxidase activity", "id": "GO:0004129", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004129", "evidence": [ { "database": "UniProtKB", "id": "O21049", "url": "https://www.uniprot.org/uniprot/O21049" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 301, "end_pos": 303, "annotation": "n_glycosylation_sequon" }, { "start_pos": 403, "end_pos": 405, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "11436", "name": "", "equation": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P05505-1", "P00406-1", "P05503-1", "P00395-1", "P00414-1", "P00403-1", "P00416-1", "P00397-1", "P00405-1", "P00401-1", "P00410-1", "P00420-1", "O21049-1", "O21042-1", "P20609-1", "P20610-1", "P30815-1", "P00417-1", "P00408-1", "P00399-1" ], "evidence": [ { "id": "11436", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/11436" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "O21042", "gene_name": "2", "activity": [ { "ec_number": "7.1.1.9", "activity": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O.", "evidence": [ { "id": "O21042", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O21042" } ] }, { "ec_number": "7.1.1.9", "activity": "", "evidence": [ { "id": "O21042", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O21042" } ] } ] }, { "uniprot_ac": "O21049", "gene_name": "cox3", "activity": [ { "ec_number": "7.1.1.9", "activity": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O.", "evidence": [ { "id": "O21049", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O21049" } ] }, { "ec_number": "7.1.1.9", "activity": "", "evidence": [ { "id": "O21049", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O21049" } ] } ] }, { "uniprot_ac": "P00395", "gene_name": "MT-CO1", "activity": [ { "ec_number": "7.1.1.9", "activity": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O.", "evidence": [ { "id": "P00395", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00395" } ] }, { "ec_number": "7.1.1.9", "activity": "", "evidence": [ { "id": "P00395", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00395" } ] } ] }, { "uniprot_ac": "P00397", "gene_name": "Mtco1", "activity": [ { "ec_number": "7.1.1.9", "activity": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O.", "evidence": [ { "id": "P00397", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00397" } ] }, { "ec_number": "7.1.1.9", "activity": "", "evidence": [ { "id": "P00397", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00397" } ] } ] }, { "uniprot_ac": "P00399", "gene_name": "mt:CoI", "activity": [ { "ec_number": "7.1.1.9", "activity": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O.", "evidence": [ { "id": "P00399", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00399" } ] }, { "ec_number": "7.1.1.9", "activity": "", "evidence": [ { "id": "P00399", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00399" } ] } ] }, { "uniprot_ac": "P00401", "gene_name": "COX1", "activity": [ { "ec_number": "7.1.1.9", "activity": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O.", "evidence": [ { "id": "P00401", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00401" } ] }, { "ec_number": "7.1.1.9", "activity": "", "evidence": [ { "id": "P00401", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00401" } ] } ] }, { "uniprot_ac": "P00403", "gene_name": "MT-CO2", "activity": [ { "ec_number": "7.1.1.9", "activity": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O.", "evidence": [ { "id": "P00403", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00403" } ] }, { "ec_number": "7.1.1.9", "activity": "", "evidence": [ { "id": "P00403", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00403" } ] } ] }, { "uniprot_ac": "P00405", "gene_name": "Mtco2", "activity": [ { "ec_number": "7.1.1.9", "activity": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O.", "evidence": [ { "id": "P00405", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00405" } ] }, { "ec_number": "7.1.1.9", "activity": "", "evidence": [ { "id": "P00405", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00405" } ] } ] }, { "uniprot_ac": "P00406", "gene_name": "Mtco2", "activity": [ { "ec_number": "7.1.1.9", "activity": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O.", "evidence": [ { "id": "P00406", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00406" } ] }, { "ec_number": "7.1.1.9", "activity": "", "evidence": [ { "id": "P00406", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00406" } ] } ] }, { "uniprot_ac": "P00408", "gene_name": "mt:CoII", "activity": [ { "ec_number": "7.1.1.9", "activity": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O.", "evidence": [ { "id": "P00408", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00408" } ] }, { "ec_number": "7.1.1.9", "activity": "", "evidence": [ { "id": "P00408", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00408" } ] } ] }, { "uniprot_ac": "P00410", "gene_name": "COX2", "activity": [ { "ec_number": "7.1.1.9", "activity": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O.", "evidence": [ { "id": "P00410", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00410" } ] }, { "ec_number": "7.1.1.9", "activity": "", "evidence": [ { "id": "P00410", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00410" } ] } ] }, { "uniprot_ac": "P00414", "gene_name": "MT-CO3", "activity": [ { "ec_number": "7.1.1.9", "activity": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O.", "evidence": [ { "id": "P00414", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00414" } ] }, { "ec_number": "7.1.1.9", "activity": "", "evidence": [ { "id": "P00414", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00414" } ] } ] }, { "uniprot_ac": "P00416", "gene_name": "mt-Co3", "activity": [ { "ec_number": "7.1.1.9", "activity": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O.", "evidence": [ { "id": "P00416", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00416" } ] }, { "ec_number": "7.1.1.9", "activity": "", "evidence": [ { "id": "P00416", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00416" } ] } ] }, { "uniprot_ac": "P00417", "gene_name": "mt:CoIII", "activity": [ { "ec_number": "7.1.1.9", "activity": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O.", "evidence": [ { "id": "P00417", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00417" } ] }, { "ec_number": "7.1.1.9", "activity": "", "evidence": [ { "id": "P00417", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00417" } ] } ] }, { "uniprot_ac": "P00420", "gene_name": "COX3", "activity": [ { "ec_number": "7.1.1.9", "activity": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O.", "evidence": [ { "id": "P00420", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00420" } ] }, { "ec_number": "7.1.1.9", "activity": "", "evidence": [ { "id": "P00420", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00420" } ] } ] }, { "uniprot_ac": "P05503", "gene_name": "Mtco1", "activity": [ { "ec_number": "7.1.1.9", "activity": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O.", "evidence": [ { "id": "P05503", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05503" } ] }, { "ec_number": "7.1.1.9", "activity": "", "evidence": [ { "id": "P05503", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05503" } ] } ] }, { "uniprot_ac": "P05505", "gene_name": "Mtco3", "activity": [ { "ec_number": "7.1.1.9", "activity": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O.", "evidence": [ { "id": "P05505", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05505" } ] }, { "ec_number": "7.1.1.9", "activity": "", "evidence": [ { "id": "P05505", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P05505" } ] } ] }, { "uniprot_ac": "P20609", "gene_name": "cxgE", "activity": [ { "ec_number": "7.1.1.9", "activity": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O.", "evidence": [ { "id": "P20609", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20609" } ] }, { "ec_number": "7.1.1.9", "activity": "", "evidence": [ { "id": "P20609", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20609" } ] } ] }, { "uniprot_ac": "P20610", "gene_name": "cxgS", "activity": [ { "ec_number": "7.1.1.9", "activity": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O.", "evidence": [ { "id": "P20610", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20610" } ] }, { "ec_number": "7.1.1.9", "activity": "", "evidence": [ { "id": "P20610", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P20610" } ] } ] }, { "uniprot_ac": "P30815", "gene_name": "cxdA", "activity": [ { "ec_number": "7.1.1.9", "activity": "4 Fe(II)-[cytochrome c] + 8 H(+)(in) + O2 = 4 Fe(III)-[cytochrome c] + 4 H(+)(out) + 2 H2O.", "evidence": [ { "id": "P30815", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30815" } ] }, { "ec_number": "7.1.1.9", "activity": "", "evidence": [ { "id": "P30815", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30815" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 301, "end_pos": 303 }, { "start_pos": 403, "end_pos": 405 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 2 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }