{ "uniprot_canonical_ac": "O21044-1", "uniprot_ac": "O21044", "uniprot_id": "AI2B_DICDI", "mass": { "chemical_mass": 30614.0, "monoisotopic_mass": 30614.0 }, "refseq": { "ac": "NP_050075", "name": "hypothetical protein", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_050075" }, "gene_names": [ { "name": "ai2b", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O21044", "id": "O21044" }, { "name": "DDB_G0294423", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O21044", "id": "O21044" } ], "protein_names": [ { "name": "Intron-encoded DNA endonuclease ai2b", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O21044" }, { "name": "3.1.-.-", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O21044" }, { "name": "hypothetical protein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_050075", "id": "NP_050075" } ], "function": [ { "annotation": "Mitochondrial DNA endonuclease involved in intron homing.", "evidence": [ { "database": "UniProtKB", "id": "O21044", "url": "https://www.uniprot.org/uniprot/O21044#function" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Dictyostelium discoideum", "taxid": 44689, "evidence": [ { "database": "UniProtKB", "id": "O21044", "url": "https://www.uniprot.org/uniprot/O21044" } ], "common_name": "Cellular slime molds" } ], "gene": [ { "name": "ai2b", "url": "https://www.uniprot.org/uniprot/O21044", "locus": {} } ], "crossref": [ { "id": "DDB_G0294423", "url": "http://dictybase.org/gene/DDB_G0294423", "database": "dictyBase", "categories": [ "Organism-specific" ] }, { "id": "2193941", "url": "https://www.ncbi.nlm.nih.gov/gene/2193941", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "IPR004860", "url": "https://www.ebi.ac.uk/interpro/entry/IPR004860", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR027434", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027434", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "ddi:DidioMp08", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DidioMp08", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "PTHR37520", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR37520", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR37520:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR37520:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00961", "url": "http://pfam.xfam.org/family/PF00961", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PR_O21044", "url": "http://purl.obolibrary.org/obo/PR_O21044", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_050075", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_050075", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "O21044", "url": "https://www.uniprot.org/uniprot/O21044", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O21044-1", "url": "https://www.uniprot.org/uniprot/O21044-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MRIQIEKDQLGWVAGLLDSCGNIMFSKTHVSGNIEIKLKLTDYECLENMKTKYGGAVKVSRTGTRYRLNHSEGLKKLLEDINGQIRIPVRVKKVKEVCEKNNIEIKYPDKELSLDTAWLSGFFDGVGSIVINQTTLENKKQLVLTFNQKNNQILIKIQRIVGGNFYINTNTQSGKYKYALYFTSKEEILQLYEYFKKYPSRAYKNKRIGLIPQYYELQTLMTSIHDNQLQETLWKKFMIQWDYKEIDEIQSGEILKQKGVIR", "length": 262, "header": "sp|O21044-1|AI2B_DICDI Isoform 1 of Intron-encoded DNA endonuclease ai2b OS=Dictyostelium discoideum OX=44689 GN=ai2b PE=3 SV=1 CANONICAL=O21044-1" }, "isoforms": [ { "isoform_ac": "O21044-1", "url": "", "sequence": { "sequence": "MRIQIEKDQLGWVAGLLDSCGNIMFSKTHVSGNIEIKLKLTDYECLENMKTKYGGAVKVSRTGTRYRLNHSEGLKKLLEDINGQIRIPVRVKKVKEVCEKNNIEIKYPDKELSLDTAWLSGFFDGVGSIVINQTTLENKKQLVLTFNQKNNQILIKIQRIVGGNFYINTNTQSGKYKYALYFTSKEEILQLYEYFKKYPSRAYKNKRIGLIPQYYELQTLMTSIHDNQLQETLWKKFMIQWDYKEIDEIQSGEILKQKGVIR", "length": 262, "header": "sp|O21044-1|AI2B_DICDI Isoform 1 of Intron-encoded DNA endonuclease ai2b OS=Dictyostelium discoideum OX=44689 GN=ai2b PE=3 SV=1 CANONICAL=O21044-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "The mitochondrial DNA of Dictyostelium discoideum: complete sequence, gene content and genome organization.", "journal": "Mol. Gen. Genet.", "date": "2000", "authors": "Ogawa S, Yoshino R, Angata K, Iwamoto M, Pi M, Kuroe K, Matsuo K, Morio T, Urushihara H, Yanagisawa K, Tanaka Y", "evidence": [ { "database": "UniProtKB", "id": "O21044", "url": "https://www.uniprot.org/uniprot/O21044" } ], "reference": [ { "type": "PubMed", "id": "10821186", "url": "https://glygen.org/publication/PubMed/10821186" } ] }, { "title": "Group-I introns in the cytochrome c oxidase genes of Dictyostelium discoideum: two related ORFs in one loop of a group-I intron, a cox1/2 hybrid gene and an unusually large cox3 gene.", "journal": "Curr. Genet.", "date": "1997", "authors": "Ogawa S, Matsuo K, Angata K, Yanagisawa K, Tanaka Y", "evidence": [ { "database": "UniProtKB", "id": "O21044", "url": "https://www.uniprot.org/uniprot/O21044" } ], "reference": [ { "type": "PubMed", "id": "9000384", "url": "https://glygen.org/publication/PubMed/9000384" } ] }, { "title": "Subunits I and II of Dictyostelium cytochrome c oxidase are specified by a single open reading frame transcribed into a large polycistronic RNA.", "journal": "Biochim. Biophys. Acta", "date": "1997", "authors": "Pellizzari R, Anjard C, Bisson R", "evidence": [ { "database": "UniProtKB", "id": "O21044", "url": "https://www.uniprot.org/uniprot/O21044" } ], "reference": [ { "type": "PubMed", "id": "9186775", "url": "https://glygen.org/publication/PubMed/9186775" } ] }, { "title": "A site-specific DNA endonuclease specified by one of two ORFs encoded by a group I intron in Dictyostelium discoideum mitochondrial DNA.", "journal": "Gene", "date": "1997", "authors": "Ogawa S, Naito K, Angata K, Morio T, Urushihara H, Tanaka Y", "evidence": [ { "database": "UniProtKB", "id": "O21044", "url": "https://www.uniprot.org/uniprot/O21044" } ], "reference": [ { "type": "PubMed", "id": "9210597", "url": "https://glygen.org/publication/PubMed/9210597" } ] } ], "pathway": [ { "id": "ddi:DidioMp08", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DidioMp08", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "O21044", "url": "https://www.uniprot.org/uniprot/O21044" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "endonuclease activity", "id": "GO:0004519", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004519", "evidence": [ { "database": "UniProtKB", "id": "O21044", "url": "https://www.uniprot.org/uniprot/O21044" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "intron homing", "id": "GO:0006314", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006314", "evidence": [ { "database": "UniProtKB", "id": "O21044", "url": "https://www.uniprot.org/uniprot/O21044" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 132, "end_pos": 134, "annotation": "n_glycosylation_sequon" }, { "start_pos": 69, "end_pos": 71, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 132, "end_pos": 134 }, { "start_pos": 69, "end_pos": 71 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 4 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }