{
    "uniprot_canonical_ac": "O15819-1",
    "uniprot_ac": "O15819",
    "uniprot_id": "H33A_DICDI",
    "mass": {
        "chemical_mass": 15702.0,
        "monoisotopic_mass": 15702.0
    },
    "refseq": {
        "ac": "XP_647577",
        "name": "histone H3",
        "summary": "",
        "url": "https://www.ncbi.nlm.nih.gov/protein/XP_647577"
    },
    "gene_names": [
        {
            "name": "H3a",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "https://www.uniprot.org/uniprot/O15819",
            "id": "O15819"
        },
        {
            "name": "DDB_G0267402",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/O15819",
            "id": "O15819"
        },
        {
            "name": "DdH3",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "https://www.uniprot.org/uniprot/O15819",
            "id": "O15819"
        },
        {
            "name": "H3a",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/XP_647577",
            "id": "XP_647577"
        }
    ],
    "protein_names": [
        {
            "name": "Histone H3.3 type a",
            "resource": "UniProtKB",
            "type": "recommended",
            "url": "",
            "id": "O15819"
        },
        {
            "name": "Histone 3, variant 3 type a",
            "resource": "UniProtKB",
            "type": "synonym",
            "url": "",
            "id": "O15819"
        },
        {
            "name": "histone H3",
            "resource": "RefSeq",
            "type": "synonym",
            "url": "https://www.ncbi.nlm.nih.gov/protein/XP_647577",
            "id": "XP_647577"
        }
    ],
    "function": [
        {
            "annotation": "Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "O15819",
                    "url": "https://www.uniprot.org/uniprot/O15819#function"
                },
                {
                    "database": "PubMed",
                    "id": "16469305",
                    "url": "https://glygen.org/publication/PubMed/16469305"
                }
            ]
        }
    ],
    "disease": [],
    "snv": [],
    "mutagenesis": [],
    "expression_tissue": [],
    "expression_disease": [],
    "species": [
        {
            "name": "Dictyostelium discoideum",
            "taxid": 44689,
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "O15819",
                    "url": "https://www.uniprot.org/uniprot/O15819"
                }
            ],
            "common_name": "Cellular slime molds"
        }
    ],
    "gene": [
        {
            "name": "H3a",
            "url": "https://www.uniprot.org/uniprot/O15819",
            "locus": {}
        }
    ],
    "crossref": [
        {
            "id": "DDB_G0267402",
            "url": "http://dictybase.org/gene/DDB_G0267402",
            "database": "dictyBase",
            "categories": [
                "Organism-specific"
            ]
        },
        {
            "id": "8616389",
            "url": "https://www.ncbi.nlm.nih.gov/gene/8616389",
            "database": "GeneID",
            "categories": [
                "Genome Annotation"
            ]
        },
        {
            "id": "IPR000164",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR000164",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR007125",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR007125",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "IPR009072",
            "url": "https://www.ebi.ac.uk/interpro/entry/IPR009072",
            "database": "InterPro",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "ddi:DDB_G0267402",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0267402",
            "database": "KEGG Pathway",
            "categories": [
                "Enzyme and Pathway"
            ]
        },
        {
            "id": "ANDCAIH",
            "url": "https://omabrowser.org/oma/group/ANDCAIH/",
            "database": "OMA",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR11426",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11426",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PTHR11426:SF258",
            "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11426:SF258",
            "database": "PANTHER",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PF00125",
            "url": "http://pfam.xfam.org/family/PF00125",
            "database": "Pfam",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "PR_O15819",
            "url": "http://purl.obolibrary.org/obo/PR_O15819",
            "database": "PRO",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "R-DDI-1266695",
            "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-1266695",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-DDI-2299718",
            "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-2299718",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-DDI-2559580",
            "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-2559580",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-DDI-3214815",
            "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-3214815",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-DDI-3214841",
            "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-3214841",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-DDI-3214842",
            "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-3214842",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-DDI-3214847",
            "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-3214847",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-DDI-3214858",
            "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-3214858",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-DDI-3247509",
            "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-3247509",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-DDI-427359",
            "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-427359",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-DDI-5625886",
            "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-5625886",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-DDI-5693565",
            "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-5693565",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-DDI-68616",
            "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-68616",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-DDI-73772",
            "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-73772",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "R-DDI-983231",
            "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-983231",
            "database": "Reactome",
            "categories": [
                "Protein Classification"
            ]
        },
        {
            "id": "XP_647577",
            "url": "https://www.ncbi.nlm.nih.gov/protein/XP_647577",
            "database": "RefSeq",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "O15819",
            "url": "https://www.uniprot.org/uniprot/O15819",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        },
        {
            "id": "O15819-1",
            "url": "https://www.uniprot.org/uniprot/O15819-1",
            "database": "UniProtKB",
            "categories": [
                "Protein"
            ]
        }
    ],
    "sequence": {
        "sequence": "MARTKQTARKSTGAKVPRKHIGSKQAHKQTPVSSSSGGVKKVHRFRPGTVALREIRKYQKSTDLLIRKLPFQRLVREIAQEFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIHLARRIRGERS",
        "length": 139,
        "header": "sp|O15819-1|H33A_DICDI Isoform 1 of Histone H3.3 type a  OS=Dictyostelium discoideum OX=44689 GN=H3a PE=1 SV=1 CANONICAL=O15819-1"
    },
    "isoforms": [
        {
            "isoform_ac": "O15819-1",
            "url": "",
            "sequence": {
                "sequence": "MARTKQTARKSTGAKVPRKHIGSKQAHKQTPVSSSSGGVKKVHRFRPGTVALREIRKYQKSTDLLIRKLPFQRLVREIAQEFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIHLARRIRGERS",
                "length": 139,
                "header": "sp|O15819-1|H33A_DICDI Isoform 1 of Histone H3.3 type a  OS=Dictyostelium discoideum OX=44689 GN=H3a PE=1 SV=1 CANONICAL=O15819-1"
            },
            "locus": {}
        }
    ],
    "glycosylation": [],
    "phosphorylation": [
        {
            "start_pos": 11,
            "end_pos": 11,
            "kinase_uniprot_canonical_ac": "",
            "kinase_gene_name": "",
            "residue": "Ser",
            "comment": "Phosphoserine",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "O15819",
                    "url": "https://www.uniprot.org/uniprot/O15819"
                }
            ],
            "site_lbl": "Ser11"
        }
    ],
    "glycation": [],
    "keywords": [],
    "publication": [
        {
            "title": "The genome of the social amoeba Dictyostelium discoideum.",
            "journal": "Nature",
            "date": "2005",
            "authors": "Eichinger L, Pachebat J A, Gl\u00f6ckner G, Rajandream M-A, Sucgang R, Berriman M, Song J, Olsen R, Szafranski K, Xu Q, Tunggal B, Kummerfeld S, Madera M, Konfortov B A, Rivero F, Bankier A T, Lehmann R, Hamlin N, Davies R, Gaudet P, Fey P, Pilcher K, Chen G, Saunders D, Sodergren E, Davis P, Kerhornou A, Nie X, Hall N, Anjard C, Hemphill L, Bason N, Farbrother P, Desany B, Just E, Morio T, Rost R, Churcher C, Cooper J, Haydock S, van Driessche N, Cronin A, Goodhead I, Muzny D, Mourier T, Pain A, Lu M, Harper D, Lindsay R, Hauser H, James K, Quiles M, Madan Babu M, Saito T, Buchrieser C, Wardroper A, Felder M, Thangavelu M, Johnson D, Knights A, Loulseged H, Mungall K, Oliver K, Price C, Quail M A, Urushihara H, Hernandez J, Rabbinowitsch E, Steffen D, Sanders M, Ma J, Kohara Y, Sharp S, Simmonds M, Spiegler S, Tivey A, Sugano S, White B, Walker D, Woodward J, Winckler T, Tanaka Y, Shaulsky G, Schleicher M, Weinstock G, Rosenthal A, Cox E C, Chisholm R L, Gibbs R, Loomis W F, Platzer M, Kay R R, Williams J, Dear P H, Noegel A A, Barrell B, Kuspa A",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "O15819",
                    "url": "https://www.uniprot.org/uniprot/O15819"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "15875012",
                    "url": "https://glygen.org/publication/PubMed/15875012"
                }
            ]
        },
        {
            "title": "Developmental timing in Dictyostelium is regulated by the Set1 histone methyltransferase.",
            "journal": "Developmental biology",
            "date": "2006-04-15",
            "authors": "Chubb Jonathan R, Bloomfield Gareth, Xu Qikai, Kaller Markus, Ivens Al, Skelton Jason, Turner Bryan M, Nellen Wolfgang, Shaulsky Gad, Kay Robert R, Bickmore Wendy A, Singer Robert H",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "O15819",
                    "url": "https://www.uniprot.org/uniprot/O15819"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16469305",
                    "url": "https://glygen.org/publication/PubMed/16469305"
                }
            ]
        },
        {
            "title": "Differential effects of heterochromatin protein 1 isoforms on mitotic chromosome distribution and growth in Dictyostelium discoideum.",
            "journal": "Eukaryotic cell",
            "date": "2006-03",
            "authors": "Kaller Markus, Euteneuer Ursula, Nellen Wolfgang",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "O15819",
                    "url": "https://www.uniprot.org/uniprot/O15819"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "16524908",
                    "url": "https://glygen.org/publication/PubMed/16524908"
                }
            ]
        },
        {
            "title": "Global transcriptional responses to cisplatin in Dictyostelium discoideum identify potential drug targets.",
            "journal": "Proc. Natl. Acad. Sci. U.S.A.",
            "date": "2007",
            "authors": "Van Driessche Nancy, Alexander Hannah, Min Junxia, Kuspa Adam, Alexander Stephen, Shaulsky Gad",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "O15819",
                    "url": "https://www.uniprot.org/uniprot/O15819"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "17878305",
                    "url": "https://glygen.org/publication/PubMed/17878305"
                }
            ]
        },
        {
            "title": "The histone methyltransferase Dot1 is required for DNA damage repair and proper development in Dictyostelium.",
            "journal": "Biochemical and biophysical research communications",
            "date": "2011-01-28",
            "authors": "M\u00fcller-Taubenberger Annette, B\u00f6nisch Clemens, F\u00fcrbringer Marlis, Wittek Finni, Hake Sandra B",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "O15819",
                    "url": "https://www.uniprot.org/uniprot/O15819"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "21187070",
                    "url": "https://glygen.org/publication/PubMed/21187070"
                }
            ]
        },
        {
            "title": "Purification and the histones of Dictyostelium discoideum chromatin.",
            "journal": "Biochemistry",
            "date": "1979",
            "authors": "Bakke A C, Bonner J",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "O15819",
                    "url": "https://www.uniprot.org/uniprot/O15819"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "497154",
                    "url": "https://glygen.org/publication/PubMed/497154"
                }
            ]
        },
        {
            "title": "Molecular cloning of a cDNA encoding the nucleosome core histone H3 from Dictyostelium discoideum by genetic screening in yeast.",
            "journal": "Biochim. Biophys. Acta",
            "date": "1997",
            "authors": "Bukenberger M, Horn J, Dingermann T, Dottin R P, Winckler T",
            "evidence": [
                {
                    "database": "UniProtKB",
                    "id": "O15819",
                    "url": "https://www.uniprot.org/uniprot/O15819"
                }
            ],
            "reference": [
                {
                    "type": "PubMed",
                    "id": "9177486",
                    "url": "https://glygen.org/publication/PubMed/9177486"
                }
            ]
        }
    ],
    "pathway": [
        {
            "id": "ddi:DDB_G0267402",
            "name": "",
            "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+ddi:DDB_G0267402",
            "resource": "KEGG Pathway"
        },
        {
            "id": "R-DDI-1266695",
            "name": "Interleukin-7 signaling",
            "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-1266695",
            "resource": "Reactome",
            "description": "Interleukin-7 signaling"
        },
        {
            "id": "R-DDI-2299718",
            "name": "Condensation of Prophase Chromosomes",
            "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-2299718",
            "resource": "Reactome",
            "description": "Condensation of Prophase Chromosomes"
        },
        {
            "id": "R-DDI-2559580",
            "name": "Oxidative Stress Induced Senescence",
            "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-2559580",
            "resource": "Reactome",
            "description": "Oxidative Stress Induced Senescence"
        },
        {
            "id": "R-DDI-3214815",
            "name": "HDACs deacetylate histones",
            "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-3214815",
            "resource": "Reactome",
            "description": "HDACs deacetylate histones"
        },
        {
            "id": "R-DDI-3214841",
            "name": "PKMTs methylate histone lysines",
            "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-3214841",
            "resource": "Reactome",
            "description": "PKMTs methylate histone lysines"
        },
        {
            "id": "R-DDI-3214842",
            "name": "HDMs demethylate histones",
            "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-3214842",
            "resource": "Reactome",
            "description": "HDMs demethylate histones"
        },
        {
            "id": "R-DDI-3214847",
            "name": "HATs acetylate histones",
            "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-3214847",
            "resource": "Reactome",
            "description": "HATs acetylate histones"
        },
        {
            "id": "R-DDI-3214858",
            "name": "RMTs methylate histone arginines",
            "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-3214858",
            "resource": "Reactome",
            "description": "RMTs methylate histone arginines"
        },
        {
            "id": "R-DDI-3247509",
            "name": "Chromatin modifying enzymes",
            "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-3247509",
            "resource": "Reactome",
            "description": "Chromatin modifying enzymes"
        },
        {
            "id": "R-DDI-427359",
            "name": "SIRT1 negatively regulates rRNA expression",
            "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-427359",
            "resource": "Reactome",
            "description": "SIRT1 negatively regulates rRNA expression"
        },
        {
            "id": "R-DDI-5625886",
            "name": "Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3",
            "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-5625886",
            "resource": "Reactome",
            "description": "Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3"
        },
        {
            "id": "R-DDI-5693565",
            "name": "Recruitment and ATM-mediated phosphorylation of repair and signaling proteins at DNA double strand breaks",
            "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-5693565",
            "resource": "Reactome",
            "description": "Recruitment and ATM-mediated phosphorylation of repair and signaling proteins at DNA double strand breaks"
        },
        {
            "id": "R-DDI-68616",
            "name": "Assembly of the ORC complex at the origin of replication",
            "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-68616",
            "resource": "Reactome",
            "description": "Assembly of the ORC complex at the origin of replication"
        },
        {
            "id": "R-DDI-73772",
            "name": "RNA Polymerase I Promoter Escape",
            "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-73772",
            "resource": "Reactome",
            "description": "RNA Polymerase I Promoter Escape"
        },
        {
            "id": "R-DDI-983231",
            "name": "Factors involved in megakaryocyte development and platelet production",
            "url": "https://www.reactome.org/PathwayBrowser/#R-DDI-983231",
            "resource": "Reactome",
            "description": "Factors involved in megakaryocyte development and platelet production"
        }
    ],
    "orthologs": [],
    "go_annotation": {
        "categories": [
            {
                "name": "Molecular Function",
                "total": 3,
                "go_terms": [
                    {
                        "name": "DNA binding",
                        "id": "GO:0003677",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O15819",
                                "url": "https://www.uniprot.org/uniprot/O15819"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "protein heterodimerization activity",
                        "id": "GO:0046982",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046982",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O15819",
                                "url": "https://www.uniprot.org/uniprot/O15819"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "structural constituent of chromatin",
                        "id": "GO:0030527",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030527",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O15819",
                                "url": "https://www.uniprot.org/uniprot/O15819"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Cellular Component",
                "total": 3,
                "go_terms": [
                    {
                        "name": "nucleus",
                        "id": "GO:0005634",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O15819",
                                "url": "https://www.uniprot.org/uniprot/O15819"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "nucleosome",
                        "id": "GO:0000786",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000786",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O15819",
                                "url": "https://www.uniprot.org/uniprot/O15819"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "nucleolar chromatin",
                        "id": "GO:0030874",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030874",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O15819",
                                "url": "https://www.uniprot.org/uniprot/O15819"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            },
            {
                "name": "Biological Process",
                "total": 3,
                "go_terms": [
                    {
                        "name": "chromatin remodeling",
                        "id": "GO:0006338",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006338",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O15819",
                                "url": "https://www.uniprot.org/uniprot/O15819"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "response to mercury ion",
                        "id": "GO:0046689",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046689",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O15819",
                                "url": "https://www.uniprot.org/uniprot/O15819"
                            }
                        ],
                        "pmid": ""
                    },
                    {
                        "name": "epigenetic regulation of gene expression",
                        "id": "GO:0040029",
                        "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0040029",
                        "evidence": [
                            {
                                "database": "UniProtKB",
                                "id": "O15819",
                                "url": "https://www.uniprot.org/uniprot/O15819"
                            }
                        ],
                        "pmid": ""
                    }
                ]
            }
        ]
    },
    "pro_annotation": [],
    "site_annotation": [],
    "ptm_annotation": [],
    "interactions": [],
    "reactions": [],
    "reaction_participants": [],
    "reaction_enzymes": [],
    "biomarkers": [],
    "synthesized_glycans": [],
    "cluster_types": [],
    "sequence_features": {
        "n_linked_sites": [],
        "o_linked_sites": [],
        "snv_sites": [],
        "glycation_sites": [],
        "phosphorylation_sites": [
            11
        ],
        "sequon_annotation_sites": []
    },
    "section_stats": [
        {
            "table_id": "glycosylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_reported_with_glycan",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_predicted",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "glycosylation_automatic_literature_mining",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                },
                {
                    "field": "n_linked_glycans",
                    "count": 0
                },
                {
                    "field": "n_linked_glycan_sites",
                    "count": 0
                },
                {
                    "field": "o_linked_glycans",
                    "count": 0
                },
                {
                    "field": "o_linked_glycan_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "phosphorylation",
            "table_stats": [
                {
                    "field": "total",
                    "count": 1
                },
                {
                    "field": "total_sites",
                    "count": 1
                }
            ],
            "sort_fields": [
                "start_pos",
                "end_pos",
                "kinase_uniprot_canonical_ac",
                "kinase_gene_name",
                "residue",
                "comment",
                "site_lbl"
            ]
        },
        {
            "table_id": "snv",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "snv_non_disease",
            "table_stats": [
                {
                    "field": "total",
                    "count": 0
                },
                {
                    "field": "total_sites",
                    "count": 0
                }
            ],
            "sort_fields": []
        },
        {
            "table_id": "publication",
            "table_stats": [
                {
                    "field": "total",
                    "count": 7
                }
            ],
            "sort_fields": [
                "title",
                "journal",
                "date",
                "authors"
            ]
        }
    ]
}