{
"uniprot_canonical_ac": "O15550-1",
"uniprot_ac": "O15550",
"uniprot_id": "KDM6A_HUMAN",
"mass": {
"chemical_mass": 154177.0,
"monoisotopic_mass": 154177.0
},
"refseq": {
"ac": "NP_066963",
"name": "lysine-specific demethylase 6A isoform 3",
"summary": "This gene is located on the X chromosome and is the corresponding locus to a Y-linked gene which encodes a tetratricopeptide repeat (TPR) protein. The encoded protein of this gene contains a JmjC-domain and catalyzes the demethylation of tri/dimethylated histone H3. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Apr 2014].",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_066963"
},
"gene_names": [
{
"name": "KDM6A",
"resource": "UniProtKB",
"type": "recommended",
"url": "https://www.uniprot.org/uniprot/O15550",
"id": "O15550"
},
{
"name": "KDM6A",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_066963",
"id": "NP_066963"
},
{
"name": "UTX",
"resource": "UniProtKB",
"type": "synonym",
"url": "https://www.uniprot.org/uniprot/O15550",
"id": "O15550"
},
{
"name": "bA386N14.2; KABUK2; UTX",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_066963",
"id": "NP_066963"
}
],
"protein_names": [
{
"name": "Lysine-specific demethylase 6A",
"resource": "UniProtKB",
"type": "recommended",
"url": "",
"id": "O15550"
},
{
"name": "1.14.11.68",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "O15550"
},
{
"name": "Histone demethylase UTX",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "O15550"
},
{
"name": "Ubiquitously-transcribed TPR protein on the X chromosome",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "O15550"
},
{
"name": "Ubiquitously-transcribed X chromosome tetratricopeptide repeat protein",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "O15550"
},
{
"name": "[histone H3]-trimethyl-L-lysine(27) demethylase 6A",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "O15550"
},
{
"name": "lysine-specific demethylase 6A isoform 3",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_066963",
"id": "NP_066963"
},
{
"name": "ubiquitously-transcribed TPR gene on the X chromosome; ubiquitously transcribed tetratricopeptide repeat protein X-linked; lysine (K)-specific demethylase 6A; bA386N14.2 (ubiquitously transcribed X chromosome tetratricopeptide repeat protein (UTX)); histone demethylase UTX; [histone H3]-trimethyl-L-lysine(27) demethylase 6A",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_066963",
"id": "NP_066963"
}
],
"function": [
{
"annotation": "Histone demethylase that specifically demethylates 'Lys-27' of histone H3, thereby playing a central role in histone code (PubMed:17851529, PubMed:17713478, PubMed:17761849). Demethylates trimethylated and dimethylated but not monomethylated H3 'Lys-27' (PubMed:17851529, PubMed:17713478, PubMed:17761849). Plays a central role in regulation of posterior development, by regulating HOX gene expression (PubMed:17851529). Demethylation of 'Lys-27' of histone H3 is concomitant with methylation of 'Lys-4' of histone H3, and regulates the recruitment of the PRC1 complex and monoubiquitination of histone H2A (PubMed:17761849). Plays a demethylase-independent role in chromatin remodeling to regulate T-box family member-dependent gene expression (By similarity).",
"evidence": [
{
"database": "UniProtKB",
"id": "O15550",
"url": "https://www.uniprot.org/uniprot/O15550#function"
},
{
"database": "PubMed",
"id": "17851529",
"url": "https://glygen.org/publication/PubMed/17851529"
},
{
"database": "UniProtKB",
"id": "O70546",
"url": "https://www.uniprot.org/uniprot/O70546#function"
},
{
"database": "PubMed",
"id": "17761849",
"url": "https://glygen.org/publication/PubMed/17761849"
},
{
"database": "PubMed",
"id": "18003914",
"url": "https://glygen.org/publication/PubMed/18003914"
},
{
"database": "PubMed",
"id": "17713478",
"url": "https://glygen.org/publication/PubMed/17713478"
}
]
},
{
"annotation": "SETting up the genome: KMT2D and KDM6A genomic function in the Kabuki syndrome craniofacial developmental disorder. Review article",
"evidence": [
{
"database": "RefSeq",
"id": "NP_066963",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_066963"
},
{
"database": "PubMed",
"id": "37800171",
"url": "https://glygen.org/publication/PubMed/37800171"
}
]
},
{
"annotation": "Study shows that UTX is a di- and trimethyl H3K27 demethylase; results suggest a concerted mechanism for transcriptional activation in which cycles of H3K4 methylation by MLL2/3 are linked with the demethylation of H3K27 through UTX",
"evidence": [
{
"database": "RefSeq",
"id": "NP_066963",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_066963"
},
{
"database": "PubMed",
"id": "17761849",
"url": "https://glygen.org/publication/PubMed/17761849"
}
]
},
{
"annotation": "The X-linked histone demethylases KDM5C and KDM6A as regulators of T cell-driven autoimmunity in the central nervous system.",
"evidence": [
{
"database": "RefSeq",
"id": "NP_066963",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_066963"
},
{
"database": "PubMed",
"id": "37657612",
"url": "https://glygen.org/publication/PubMed/37657612"
}
]
},
{
"annotation": "This gene is located on the X chromosome and is the corresponding locus to a Y-linked gene which encodes a tetratricopeptide repeat (TPR) protein. The encoded protein of this gene contains a JmjC-domain and catalyzes the demethylation of tri/dimethylated histone H3. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Apr 2014].",
"evidence": [
{
"database": "RefSeq",
"id": "NP_066963",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_066963"
}
]
},
{
"annotation": "[Clinical characteristics and genetic counseling for a three-generation Chinese pedigree with recurrent fetal Kabuki syndrome due to variant of KDM6A gene].",
"evidence": [
{
"database": "RefSeq",
"id": "NP_066963",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_066963"
},
{
"database": "PubMed",
"id": "38171564",
"url": "https://glygen.org/publication/PubMed/38171564"
}
]
}
],
"disease": [
{
"disease_id": "DOID:0060473",
"recommended_name": {
"id": "DOID:0060473",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:0060473",
"name": "Kabuki syndrome",
"description": "A syndrome characterized by multiple congenital anomalies and mental retardation. Other characteristics include a peculiar facial gestalt, short stature, skeletal and visceral abnormalities, cardiac anomalies, and immunological defects."
},
"synonyms": [
{
"id": "DOID:0060473",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:0060473",
"name": "KMS",
"description": ""
},
{
"id": "DOID:0060473",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:0060473",
"name": "Kabuki make up syndrome",
"description": ""
},
{
"id": "DOID:0060473",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:0060473",
"name": "Niikawa-Kuroki syndrome",
"description": ""
},
{
"id": "MONDO:0010465",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010465",
"name": "Kabuki syndrome 2",
"description": ""
},
{
"id": "MONDO:0010465",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010465",
"name": "Kabuki syndrome 2",
"description": ""
},
{
"id": "MONDO:0010465",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010465",
"name": "Kabuki syndrome 2, X-linked dominant",
"description": ""
},
{
"id": "MONDO:0010465",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010465",
"name": "Kabuki syndrome type 2",
"description": ""
},
{
"id": "MONDO:0010465",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010465",
"name": "KABUK2",
"description": ""
},
{
"id": "MONDO:0010465",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010465",
"name": "KABUKI syndrome 2",
"description": ""
},
{
"id": "MONDO:0007843",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007843",
"name": "Kabuki syndrome 1",
"description": ""
},
{
"id": "MONDO:0007843",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007843",
"name": "Kabuki syndrome 1",
"description": ""
},
{
"id": "MONDO:0007843",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007843",
"name": "Kabuki syndrome type 1",
"description": ""
},
{
"id": "MONDO:0007843",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007843",
"name": "KABUK1",
"description": ""
},
{
"id": "MONDO:0007843",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007843",
"name": "KABUKI syndrome 1",
"description": ""
},
{
"id": "MONDO:0007843",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007843",
"name": "Kabuki make-Up syndrome",
"description": ""
},
{
"id": "MONDO:0007843",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007843",
"name": "Kabuki syndrome",
"description": ""
},
{
"id": "MONDO:0007843",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007843",
"name": "Niikawa-Kuroki syndrome",
"description": ""
},
{
"id": "MIM:300867",
"resource": "MIM",
"url": "https://www.omim.org/entry/300867",
"name": "Kabuki syndrome 2",
"description": "Kabuki syndrome 2"
},
{
"id": "MIM:147920",
"resource": "MIM",
"url": "https://www.omim.org/entry/147920",
"name": "Kabuki syndrome 1",
"description": "Kabuki syndrome 1"
}
],
"evidence": [
{
"id": "300867",
"database": "MIM",
"url": "https://www.omim.org/entry/300867"
}
]
}
],
"snv": [
{
"evidence": [
{
"id": "rs1305135674",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1305135674"
},
{
"id": "rs1305135674",
"database": "TOPMed",
"url": "https://www.ncbi.nlm.nih.gov/snp/rs1305135674#frequency_tab"
}
],
"glycoeffect": [
"n-glyco-sequon-gain"
],
"start_pos": 1059,
"end_pos": 1059,
"sequence_org": "D",
"sequence_mut": "N",
"comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DHS->NHS).",
"chr_id": "X",
"chr_pos": "45082782",
"ref_nt": "A",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "D1059",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "rs1569538272",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1569538272"
},
{
"id": "rs1569538272",
"database": "ENSEMBL",
"url": "https://www.ensembl.org/id/rs1569538272"
}
],
"glycoeffect": [
"n-glyco-sequon-gain"
],
"start_pos": 1069,
"end_pos": 1069,
"sequence_org": "D",
"sequence_mut": "N",
"comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DNS->NNS).",
"chr_id": "X",
"chr_pos": "45082615",
"ref_nt": "A",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "D1069",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "O15550",
"database": "BioMuta",
"url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O15550"
},
{
"id": "rs1479629068",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1479629068"
},
{
"id": "rs1479629068",
"database": "TOPMed",
"url": "https://www.ncbi.nlm.nih.gov/snp/rs1479629068#frequency_tab"
},
{
"id": "rs1479629068",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs1479629068"
},
{
"id": "rs374939363",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs374939363"
},
{
"id": "rs374939363",
"database": "ExAC",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs374939363"
},
{
"id": "rs374939363",
"database": "NCI-TCGA",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs374939363"
},
{
"id": "rs374939363",
"database": "TOPMed",
"url": "https://www.ncbi.nlm.nih.gov/snp/rs374939363#frequency_tab"
},
{
"id": "rs374939363",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs374939363"
}
],
"glycoeffect": [
"n-glyco-sequon-gain"
],
"start_pos": 1151,
"end_pos": 1151,
"subjects_tested": "0",
"subjects_positive": "0",
"frequency": "0.0",
"sequence_org": "N",
"sequence_mut": "S",
"comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NNN->NNS).",
"chr_id": "X",
"chr_pos": "45085883",
"ref_nt": "A",
"alt_nt": "G",
"minor_allelic_frequency": "",
"site_lbl": "N1151",
"disease": [
{
"disease_id": "DOID:1612",
"recommended_name": {
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "breast cancer",
"description": "A thoracic cancer that originates in the mammary gland."
},
"synonyms": [
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "breast tumor",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "malignant neoplasm of breast",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "malignant tumor of the breast",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "mammary cancer",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "mammary tumor",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "primary breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast carcinoma",
"description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma."
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer susceptibility, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, lobular, somatic",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, protection against, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, somatic",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial breast carcinoma",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial cancer of breast",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial cancer of the breast",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast carcinoma",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, familial",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, familial Male",
"description": ""
},
{
"id": "MIM:114480",
"resource": "MIM",
"url": "https://www.omim.org/entry/114480",
"name": "Breast cancer",
"description": "Breast cancer"
}
]
}
],
"keywords": [
"biomuta",
"somatic",
"cancer",
"disease",
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "O15550",
"database": "BioMuta",
"url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O15550"
}
],
"glycoeffect": [],
"start_pos": 1255,
"end_pos": 1255,
"subjects_tested": "0",
"subjects_positive": "0",
"frequency": "0.0",
"sequence_org": "R",
"sequence_mut": "W",
"comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).",
"chr_id": "X",
"chr_pos": "45090749",
"ref_nt": "C",
"alt_nt": "T",
"minor_allelic_frequency": "",
"site_lbl": "R1255",
"disease": [
{
"disease_id": "DOID:10534",
"recommended_name": {
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "stomach cancer",
"description": "A gastrointestinal system cancer that is located_in the stomach."
},
"synonyms": [
{
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "gastric cancer",
"description": ""
},
{
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer",
"description": "A primary or metastatic malignant neoplasm involving the stomach."
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "Ca lesser curvature - stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "cancer of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer risk after h. pylori infection",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer, somatic",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric tumor",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric tumour",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant stomach neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of greater curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of greater curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "stomach cancer",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "Ca body - stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "ca greater curvature of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer, intestinal",
"description": ""
},
{
"id": "MIM:613659",
"resource": "MIM",
"url": "https://www.omim.org/entry/613659",
"name": "Gastric cancer",
"description": "Gastric cancer"
}
]
},
{
"disease_id": "DOID:10283",
"recommended_name": {
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate cancer",
"description": "A male reproductive organ cancer that is located_in the prostate."
},
"synonyms": [
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "NGP - new growth of prostate",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "hereditary prostate cancer",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "malignant tumor of the prostate",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate cancer, familial",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate neoplasm",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostatic cancer",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostatic neoplasm",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "tumor of the prostate",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, type 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "HPC9",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, 12",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene."
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "EHBP1 familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "familial prostate cancer caused by mutation in EHBP1",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, 12",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, type 12",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "HPC12",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, type 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "HPC5",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, type 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, susceptibility to, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "HPC3",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, type 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, susceptibility to, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "HPC4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, on chromosome 7",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, 13",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene."
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "MSMB familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "familial prostate cancer caused by mutation in MSMB",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, 13",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, type 13",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "HPC13",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, type 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "HPC8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "predisposing for prostate cancer",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, type 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "HPC6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "prostate cancer, hereditary, 10",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "HPC10",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "prostate cancer, hereditary, 10",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "familial prostate carcinoma",
"description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma."
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "hereditary prostate cancer",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "hereditary prostate carcinoma",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, somatic",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, familial",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, hereditary",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer, hereditary, 7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "HPC7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer, hereditary, 7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer aggressiveness",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, 1",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene."
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "RNASEL familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "familial prostate cancer caused by mutation in RNASEL",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, type 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "HPC1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "Prca1",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "prostate cancer, hereditary, 11",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "HPC11",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "prostate cancer, hereditary, 11",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "prostate cancer, hereditary, 14",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "HPC14",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "prostate cancer, hereditary, 14",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "prostate cancer, hereditary, 15",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "HPC15",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "prostate cancer, hereditary, 15",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer, hereditary, X-linked 1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "HPCX1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer, hereditary, X-linked 1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer susceptibility, X-linked",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "prostate cancer, hereditary, X-linked 2",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "HPCX2",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "prostate cancer, hereditary, X-linked 2",
"description": ""
},
{
"id": "MIM:611868",
"resource": "MIM",
"url": "https://www.omim.org/entry/611868",
"name": "Prostate cancer, hereditary, 12",
"description": "Prostate cancer, hereditary, 12"
},
{
"id": "MIM:611928",
"resource": "MIM",
"url": "https://www.omim.org/entry/611928",
"name": "Prostate cancer, hereditary, 13",
"description": "Prostate cancer, hereditary, 13"
},
{
"id": "MIM:176807",
"resource": "MIM",
"url": "https://www.omim.org/entry/176807",
"name": "Prostate cancer",
"description": "Prostate cancer"
},
{
"id": "MIM:601518",
"resource": "MIM",
"url": "https://www.omim.org/entry/601518",
"name": "Prostate cancer, hereditary, 1",
"description": "Prostate cancer, hereditary, 1"
},
{
"id": "MIM:611955",
"resource": "MIM",
"url": "https://www.omim.org/entry/611955",
"name": "Prostate cancer, hereditary, 11",
"description": "Prostate cancer, hereditary, 11"
}
]
},
{
"disease_id": "DOID:363",
"recommended_name": {
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine cancer",
"description": "A female reproductive organ cancer that is located_in the uterus."
},
"synonyms": [
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "CA - cancer of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "Tumour of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterus neoplasm",
"description": ""
}
]
}
],
"keywords": [
"biomuta",
"somatic",
"cancer",
"disease"
]
},
{
"evidence": [
{
"id": "O15550",
"database": "BioMuta",
"url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O15550"
},
{
"id": "rs1233195241",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1233195241"
},
{
"id": "rs1233195241",
"database": "NCI-TCGA",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1233195241"
},
{
"id": "rs1233195241",
"database": "TOPMed",
"url": "https://www.ncbi.nlm.nih.gov/snp/rs1233195241#frequency_tab"
}
],
"glycoeffect": [
"n-glyco-sequon-gain"
],
"start_pos": 1272,
"end_pos": 1272,
"subjects_tested": "0",
"subjects_positive": "0",
"frequency": "0.0",
"sequence_org": "H",
"sequence_mut": "N",
"comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (HLS->NLS).",
"chr_id": "X",
"chr_pos": "45090800",
"ref_nt": "C",
"alt_nt": "A",
"minor_allelic_frequency": "",
"site_lbl": "H1272",
"disease": [
{
"disease_id": "DOID:363",
"recommended_name": {
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine cancer",
"description": "A female reproductive organ cancer that is located_in the uterus."
},
"synonyms": [
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "CA - cancer of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "Tumour of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterus neoplasm",
"description": ""
}
]
}
],
"keywords": [
"biomuta",
"somatic",
"cancer",
"disease",
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "rs1199031204",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1199031204"
},
{
"id": "rs1199031204",
"database": "TOPMed",
"url": "https://www.ncbi.nlm.nih.gov/snp/rs1199031204#frequency_tab"
}
],
"glycoeffect": [
"n-glyco-sequon-gain"
],
"start_pos": 131,
"end_pos": 131,
"sequence_org": "A",
"sequence_mut": "T",
"comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NAA->NAT).",
"chr_id": "X",
"chr_pos": "45010967",
"ref_nt": "A",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "A131",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "rs868036172",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs868036172"
},
{
"id": "rs868036172",
"database": "ENSEMBL",
"url": "https://www.ensembl.org/id/rs868036172"
}
],
"glycoeffect": [
"n-glyco-sequon-gain",
"n-glyco-sequon-loss",
"o-glyco-site-loss"
],
"start_pos": 1348,
"end_pos": 1348,
"sequence_org": "S",
"sequence_mut": "N",
"comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SNS->NNS).",
"chr_id": "X",
"chr_pos": "45110116",
"ref_nt": "A",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "S1348",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "O15550",
"database": "BioMuta",
"url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O15550"
},
{
"id": "rs1204365436",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1204365436"
},
{
"id": "rs1204365436",
"database": "NCI-TCGA",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1204365436"
},
{
"id": "rs1204365436",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs1204365436"
},
{
"id": "rs746233805",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746233805"
},
{
"id": "rs746233805",
"database": "ExAC",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs746233805"
},
{
"id": "rs746233805",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs746233805"
}
],
"glycoeffect": [
"o-glyco-site-loss"
],
"start_pos": 181,
"end_pos": 181,
"subjects_tested": "0",
"subjects_positive": "0",
"frequency": "0.0",
"sequence_org": "T",
"sequence_mut": "I",
"comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (T->I).",
"chr_id": "X",
"chr_pos": "45020708",
"ref_nt": "C",
"alt_nt": "T",
"minor_allelic_frequency": "",
"site_lbl": "T181",
"disease": [
{
"disease_id": "DOID:10534",
"recommended_name": {
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "stomach cancer",
"description": "A gastrointestinal system cancer that is located_in the stomach."
},
"synonyms": [
{
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "gastric cancer",
"description": ""
},
{
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer",
"description": "A primary or metastatic malignant neoplasm involving the stomach."
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "Ca lesser curvature - stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "cancer of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer risk after h. pylori infection",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer, somatic",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric tumor",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric tumour",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant stomach neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of greater curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of greater curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "stomach cancer",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "Ca body - stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "ca greater curvature of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer, intestinal",
"description": ""
},
{
"id": "MIM:613659",
"resource": "MIM",
"url": "https://www.omim.org/entry/613659",
"name": "Gastric cancer",
"description": "Gastric cancer"
}
]
}
],
"keywords": [
"biomuta",
"somatic",
"cancer",
"disease",
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "rs752296871",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752296871"
},
{
"id": "rs752296871",
"database": "ExAC",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752296871"
},
{
"id": "rs752296871",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs752296871"
}
],
"glycoeffect": [
"n-glyco-sequon-gain",
"o-glyco-site-loss"
],
"start_pos": 221,
"end_pos": 221,
"sequence_org": "Y",
"sequence_mut": "N",
"comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (YHS->NHS).",
"chr_id": "X",
"chr_pos": "45051715",
"ref_nt": "A",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "Y221",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "O15550",
"database": "BioMuta",
"url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O15550"
}
],
"glycoeffect": [],
"start_pos": 324,
"end_pos": 324,
"subjects_tested": "80",
"subjects_positive": "1",
"frequency": "1.3",
"sequence_org": "I",
"sequence_mut": "V",
"comment": "Somatic mutation passed 1 out of 6 filters: patient freq. (1.3%).",
"chr_id": "X",
"chr_pos": "45059100",
"ref_nt": "A",
"alt_nt": "G",
"minor_allelic_frequency": "",
"site_lbl": "I324",
"keywords": [
"biomuta",
"somatic",
"cancer"
]
},
{
"evidence": [
{
"id": "rs1254571597",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1254571597"
},
{
"id": "rs1254571597",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs1254571597"
}
],
"glycoeffect": [
"n-glyco-sequon-gain",
"o-glyco-site-loss"
],
"start_pos": 381,
"end_pos": 381,
"sequence_org": "S",
"sequence_mut": "N",
"comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SKS->NKS).",
"chr_id": "X",
"chr_pos": "45059414",
"ref_nt": "A",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "S381",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "O15550",
"database": "BioMuta",
"url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O15550"
}
],
"glycoeffect": [
"n-glyco-sequon-gain"
],
"start_pos": 405,
"end_pos": 405,
"subjects_tested": "0",
"subjects_positive": "0",
"frequency": "0.0",
"sequence_org": "P",
"sequence_mut": "S",
"comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NLP->NLS).",
"chr_id": "X",
"chr_pos": "45060040",
"ref_nt": "C",
"alt_nt": "T",
"minor_allelic_frequency": "",
"site_lbl": "P405",
"disease": [
{
"disease_id": "DOID:363",
"recommended_name": {
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine cancer",
"description": "A female reproductive organ cancer that is located_in the uterus."
},
"synonyms": [
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "CA - cancer of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "Tumour of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterus neoplasm",
"description": ""
}
]
}
],
"keywords": [
"biomuta",
"somatic",
"cancer",
"disease"
]
},
{
"evidence": [
{
"id": "rs771764815",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771764815"
},
{
"id": "rs771764815",
"database": "ExAC",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs771764815"
},
{
"id": "rs771764815",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs771764815"
}
],
"glycoeffect": [
"n-glyco-sequon-gain"
],
"start_pos": 485,
"end_pos": 485,
"sequence_org": "N",
"sequence_mut": "S",
"comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NRN->NRS).",
"chr_id": "X",
"chr_pos": "45062675",
"ref_nt": "G",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "N485",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "O15550",
"database": "BioMuta",
"url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O15550"
}
],
"glycoeffect": [
"n-glyco-sequon-gain",
"o-glyco-site-loss"
],
"start_pos": 580,
"end_pos": 580,
"subjects_tested": "0",
"subjects_positive": "0",
"frequency": "0.0",
"sequence_org": "S",
"sequence_mut": "N",
"comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (STS->NTS).",
"chr_id": "X",
"chr_pos": "45063633",
"ref_nt": "G",
"alt_nt": "A",
"minor_allelic_frequency": "",
"site_lbl": "S580",
"disease": [
{
"disease_id": "DOID:363",
"recommended_name": {
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine cancer",
"description": "A female reproductive organ cancer that is located_in the uterus."
},
"synonyms": [
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "CA - cancer of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "Tumour of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterus neoplasm",
"description": ""
}
]
}
],
"keywords": [
"biomuta",
"somatic",
"cancer",
"disease"
]
},
{
"evidence": [
{
"id": "rs752105957",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752105957"
},
{
"id": "rs752105957",
"database": "ExAC",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs752105957"
},
{
"id": "rs752105957",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs752105957"
}
],
"glycoeffect": [
"n-glyco-sequon-gain"
],
"start_pos": 608,
"end_pos": 608,
"sequence_org": "P",
"sequence_mut": "S",
"comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NVP->NVS).",
"chr_id": "X",
"chr_pos": "45069615",
"ref_nt": "T",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "P608",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "rs1057524607",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1057524607"
},
{
"id": "rs1057524607",
"database": "TOPMed",
"url": "https://www.ncbi.nlm.nih.gov/snp/rs1057524607#frequency_tab"
}
],
"glycoeffect": [
"n-glyco-sequon-loss",
"o-glyco-site-loss"
],
"start_pos": 622,
"end_pos": 622,
"sequence_org": "T",
"sequence_mut": "K",
"comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->K).",
"chr_id": "X",
"chr_pos": "45063759",
"ref_nt": "A",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "T622",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "rs764983125",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764983125"
},
{
"id": "rs764983125",
"database": "ExAC",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs764983125"
},
{
"id": "rs764983125",
"database": "TOPMed",
"url": "https://www.ncbi.nlm.nih.gov/snp/rs764983125#frequency_tab"
},
{
"id": "rs764983125",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs764983125"
}
],
"glycoeffect": [
"n-glyco-sequon-loss",
"o-glyco-site-loss"
],
"start_pos": 625,
"end_pos": 625,
"sequence_org": "T",
"sequence_mut": "A",
"comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->A).",
"chr_id": "X",
"chr_pos": "45063689",
"ref_nt": "G",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "T625",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "rs773022554",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773022554"
},
{
"id": "rs773022554",
"database": "ExAC",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs773022554"
},
{
"id": "rs773022554",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs773022554"
},
{
"id": "rs1364809829",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1364809829"
},
{
"id": "rs1364809829",
"database": "TOPMed",
"url": "https://www.ncbi.nlm.nih.gov/snp/rs1364809829#frequency_tab"
}
],
"glycoeffect": [
"n-glyco-sequon-loss",
"o-glyco-site-loss"
],
"start_pos": 625,
"end_pos": 625,
"sequence_org": "T",
"sequence_mut": "I",
"comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->I).",
"chr_id": "X",
"chr_pos": "45063690",
"ref_nt": "T",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "T625",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "rs767946867",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767946867"
},
{
"id": "rs767946867",
"database": "ExAC",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767946867"
},
{
"id": "rs767946867",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs767946867"
}
],
"glycoeffect": [
"n-glyco-sequon-gain",
"n-glyco-sequon-loss",
"o-glyco-site-loss"
],
"start_pos": 741,
"end_pos": 741,
"sequence_org": "T",
"sequence_mut": "N",
"comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (TAS->NAS).",
"chr_id": "X",
"chr_pos": "45069799",
"ref_nt": "A",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "T741",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "rs891682432",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs891682432"
},
{
"id": "rs891682432",
"database": "TOPMed",
"url": "https://www.ncbi.nlm.nih.gov/snp/rs891682432#frequency_tab"
},
{
"id": "rs951647317",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs951647317"
},
{
"id": "rs951647317",
"database": "TOPMed",
"url": "https://www.ncbi.nlm.nih.gov/snp/rs951647317#frequency_tab"
},
{
"id": "rs951647317",
"database": "gnomAD",
"url": "http://gnomad.broadinstitute.org/awesome?query=rs951647317"
}
],
"glycoeffect": [
"n-glyco-sequon-gain"
],
"start_pos": 791,
"end_pos": 791,
"sequence_org": "N",
"sequence_mut": "S",
"comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NNN->NNS).",
"chr_id": "X",
"chr_pos": "45069871",
"ref_nt": "G",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "N791",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "rs967604567",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs967604567"
},
{
"id": "rs967604567",
"database": "ENSEMBL",
"url": "https://www.ensembl.org/id/rs967604567"
}
],
"glycoeffect": [
"n-glyco-sequon-gain"
],
"start_pos": 803,
"end_pos": 803,
"sequence_org": "I",
"sequence_mut": "T",
"comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NNI->NNT).",
"chr_id": "X",
"chr_pos": "45070063",
"ref_nt": "C",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "I803",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "rs1360545217",
"database": "dbSNP",
"url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1360545217"
},
{
"id": "rs1360545217",
"database": "TOPMed",
"url": "https://www.ncbi.nlm.nih.gov/snp/rs1360545217#frequency_tab"
}
],
"glycoeffect": [
"n-glyco-sequon-gain"
],
"start_pos": 812,
"end_pos": 812,
"sequence_org": "D",
"sequence_mut": "N",
"comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DNS->NNS).",
"chr_id": "X",
"chr_pos": "45070089",
"ref_nt": "A",
"alt_nt": "null",
"minor_allelic_frequency": "",
"site_lbl": "D812",
"keywords": [
"ebi",
"germline"
]
},
{
"evidence": [
{
"id": "O15550",
"database": "BioMuta",
"url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O15550"
}
],
"glycoeffect": [
"n-glyco-sequon-gain"
],
"start_pos": 966,
"end_pos": 966,
"subjects_tested": "0",
"subjects_positive": "0",
"frequency": "0.0",
"sequence_org": "P",
"sequence_mut": "T",
"comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NNP->NNT).",
"chr_id": "X",
"chr_pos": "45078463",
"ref_nt": "C",
"alt_nt": "A",
"minor_allelic_frequency": "",
"site_lbl": "P966",
"disease": [
{
"disease_id": "DOID:10283",
"recommended_name": {
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate cancer",
"description": "A male reproductive organ cancer that is located_in the prostate."
},
"synonyms": [
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "NGP - new growth of prostate",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "hereditary prostate cancer",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "malignant tumor of the prostate",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate cancer, familial",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate neoplasm",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostatic cancer",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostatic neoplasm",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "tumor of the prostate",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, type 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "HPC9",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, 12",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene."
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "EHBP1 familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "familial prostate cancer caused by mutation in EHBP1",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, 12",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, type 12",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "HPC12",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, type 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "HPC5",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, type 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, susceptibility to, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "HPC3",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, type 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, susceptibility to, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "HPC4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, on chromosome 7",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, 13",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene."
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "MSMB familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "familial prostate cancer caused by mutation in MSMB",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, 13",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, type 13",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "HPC13",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, type 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "HPC8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "predisposing for prostate cancer",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, type 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "HPC6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "prostate cancer, hereditary, 10",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "HPC10",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "prostate cancer, hereditary, 10",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "familial prostate carcinoma",
"description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma."
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "hereditary prostate cancer",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "hereditary prostate carcinoma",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, somatic",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, familial",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, hereditary",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer, hereditary, 7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "HPC7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer, hereditary, 7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer aggressiveness",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, 1",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene."
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "RNASEL familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "familial prostate cancer caused by mutation in RNASEL",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, type 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "HPC1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "Prca1",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "prostate cancer, hereditary, 11",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "HPC11",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "prostate cancer, hereditary, 11",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "prostate cancer, hereditary, 14",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "HPC14",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "prostate cancer, hereditary, 14",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "prostate cancer, hereditary, 15",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "HPC15",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "prostate cancer, hereditary, 15",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer, hereditary, X-linked 1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "HPCX1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer, hereditary, X-linked 1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer susceptibility, X-linked",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "prostate cancer, hereditary, X-linked 2",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "HPCX2",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "prostate cancer, hereditary, X-linked 2",
"description": ""
},
{
"id": "MIM:611868",
"resource": "MIM",
"url": "https://www.omim.org/entry/611868",
"name": "Prostate cancer, hereditary, 12",
"description": "Prostate cancer, hereditary, 12"
},
{
"id": "MIM:611928",
"resource": "MIM",
"url": "https://www.omim.org/entry/611928",
"name": "Prostate cancer, hereditary, 13",
"description": "Prostate cancer, hereditary, 13"
},
{
"id": "MIM:176807",
"resource": "MIM",
"url": "https://www.omim.org/entry/176807",
"name": "Prostate cancer",
"description": "Prostate cancer"
},
{
"id": "MIM:601518",
"resource": "MIM",
"url": "https://www.omim.org/entry/601518",
"name": "Prostate cancer, hereditary, 1",
"description": "Prostate cancer, hereditary, 1"
},
{
"id": "MIM:611955",
"resource": "MIM",
"url": "https://www.omim.org/entry/611955",
"name": "Prostate cancer, hereditary, 11",
"description": "Prostate cancer, hereditary, 11"
}
]
}
],
"keywords": [
"biomuta",
"somatic",
"cancer",
"disease"
]
}
],
"mutagenesis": [
{
"start_pos": 1146,
"end_pos": 1146,
"sequence_org": "H",
"sequence_mut": "A",
"comment": "Abolishes histone demethylase activity.",
"evidence": [
{
"database": "UniProtKB",
"id": "O15550",
"url": "https://www.uniprot.org/uniprot/O15550"
},
{
"database": "PubMed",
"id": "17851529",
"url": "https://glygen.org/publication/PubMed/17851529"
},
{
"database": "PubMed",
"id": "17761849",
"url": "https://glygen.org/publication/PubMed/17761849"
},
{
"database": "PubMed",
"id": "18003914",
"url": "https://glygen.org/publication/PubMed/18003914"
}
]
}
],
"expression_tissue": [
{
"tissue": {
"name": "Adult mammalian kidney",
"namespace": "UBERON",
"id": "0000082",
"url": "http://purl.obolibrary.org/obo/UBERON_0000082"
},
"score": "77.23",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000147050",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000147050"
}
]
},
{
"tissue": {
"name": "Oral cavity",
"namespace": "UBERON",
"id": "0000167",
"url": "http://purl.obolibrary.org/obo/UBERON_0000167"
},
"score": "79.26",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000147050",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000147050"
}
]
},
{
"tissue": {
"name": "Stomach",
"namespace": "UBERON",
"id": "0000945",
"url": "http://purl.obolibrary.org/obo/UBERON_0000945"
},
"score": "84.32",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000147050",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000147050"
}
]
},
{
"tissue": {
"name": "Uterus",
"namespace": "UBERON",
"id": "0000995",
"url": "http://purl.obolibrary.org/obo/UBERON_0000995"
},
"score": "70.13",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000147050",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000147050"
}
]
},
{
"tissue": {
"name": "Esophagus",
"namespace": "UBERON",
"id": "0001043",
"url": "http://purl.obolibrary.org/obo/UBERON_0001043"
},
"score": "91.55",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000147050",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000147050"
}
]
},
{
"tissue": {
"name": "Rectum",
"namespace": "UBERON",
"id": "0001052",
"url": "http://purl.obolibrary.org/obo/UBERON_0001052"
},
"score": "88.24",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000147050",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000147050"
}
]
},
{
"tissue": {
"name": "Colon",
"namespace": "UBERON",
"id": "0001155",
"url": "http://purl.obolibrary.org/obo/UBERON_0001155"
},
"score": "69.58",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000147050",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000147050"
}
]
},
{
"tissue": {
"name": "Urinary bladder",
"namespace": "UBERON",
"id": "0001255",
"url": "http://purl.obolibrary.org/obo/UBERON_0001255"
},
"score": "86.66",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000147050",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000147050"
}
]
},
{
"tissue": {
"name": "Thyroid gland",
"namespace": "UBERON",
"id": "0002046",
"url": "http://purl.obolibrary.org/obo/UBERON_0002046"
},
"score": "88.24",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000147050",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000147050"
}
]
},
{
"tissue": {
"name": "Lung",
"namespace": "UBERON",
"id": "0002048",
"url": "http://purl.obolibrary.org/obo/UBERON_0002048"
},
"score": "71.15",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000147050",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000147050"
}
]
},
{
"tissue": {
"name": "Liver",
"namespace": "UBERON",
"id": "0002107",
"url": "http://purl.obolibrary.org/obo/UBERON_0002107"
},
"score": "87.02",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000147050",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000147050"
}
]
},
{
"tissue": {
"name": "Prostate gland",
"namespace": "UBERON",
"id": "0002367",
"url": "http://purl.obolibrary.org/obo/UBERON_0002367"
},
"score": "87.94",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000147050",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000147050"
}
]
},
{
"tissue": {
"name": "Thoracic mammary gland",
"namespace": "UBERON",
"id": "0005200",
"url": "http://purl.obolibrary.org/obo/UBERON_0005200"
},
"score": "92.14",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000147050",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000147050"
}
]
}
],
"expression_disease": [
{
"significant": "No",
"trend": "up",
"name": "Prostate cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:10283",
"evidence": [
{
"database": "BioXpress",
"id": "O15550",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15550"
}
],
"disease": [
{
"disease_id": "DOID:10283",
"recommended_name": {
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate cancer",
"description": "A male reproductive organ cancer that is located_in the prostate."
},
"synonyms": [
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "NGP - new growth of prostate",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "hereditary prostate cancer",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "malignant tumor of the prostate",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate cancer, familial",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate neoplasm",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostatic cancer",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostatic neoplasm",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "tumor of the prostate",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, type 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "HPC9",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, 12",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene."
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "EHBP1 familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "familial prostate cancer caused by mutation in EHBP1",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, 12",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, type 12",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "HPC12",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, type 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "HPC5",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, type 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, susceptibility to, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "HPC3",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, type 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, susceptibility to, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "HPC4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, on chromosome 7",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, 13",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene."
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "MSMB familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "familial prostate cancer caused by mutation in MSMB",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, 13",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, type 13",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "HPC13",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, type 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "HPC8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "predisposing for prostate cancer",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, type 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "HPC6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "prostate cancer, hereditary, 10",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "HPC10",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "prostate cancer, hereditary, 10",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "familial prostate carcinoma",
"description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma."
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "hereditary prostate cancer",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "hereditary prostate carcinoma",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, somatic",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, familial",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, hereditary",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer, hereditary, 7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "HPC7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer, hereditary, 7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer aggressiveness",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, 1",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene."
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "RNASEL familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "familial prostate cancer caused by mutation in RNASEL",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, type 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "HPC1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "Prca1",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "prostate cancer, hereditary, 11",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "HPC11",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "prostate cancer, hereditary, 11",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "prostate cancer, hereditary, 14",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "HPC14",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "prostate cancer, hereditary, 14",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "prostate cancer, hereditary, 15",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "HPC15",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "prostate cancer, hereditary, 15",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer, hereditary, X-linked 1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "HPCX1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer, hereditary, X-linked 1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer susceptibility, X-linked",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "prostate cancer, hereditary, X-linked 2",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "HPCX2",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "prostate cancer, hereditary, X-linked 2",
"description": ""
},
{
"id": "MIM:611868",
"resource": "MIM",
"url": "https://www.omim.org/entry/611868",
"name": "Prostate cancer, hereditary, 12",
"description": "Prostate cancer, hereditary, 12"
},
{
"id": "MIM:611928",
"resource": "MIM",
"url": "https://www.omim.org/entry/611928",
"name": "Prostate cancer, hereditary, 13",
"description": "Prostate cancer, hereditary, 13"
},
{
"id": "MIM:176807",
"resource": "MIM",
"url": "https://www.omim.org/entry/176807",
"name": "Prostate cancer",
"description": "Prostate cancer"
},
{
"id": "MIM:601518",
"resource": "MIM",
"url": "https://www.omim.org/entry/601518",
"name": "Prostate cancer, hereditary, 1",
"description": "Prostate cancer, hereditary, 1"
},
{
"id": "MIM:611955",
"resource": "MIM",
"url": "https://www.omim.org/entry/611955",
"name": "Prostate cancer, hereditary, 11",
"description": "Prostate cancer, hereditary, 11"
}
]
}
]
},
{
"significant": "No",
"trend": "down",
"name": "Stomach cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:10534",
"evidence": [
{
"database": "BioXpress",
"id": "O15550",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15550"
}
],
"disease": [
{
"disease_id": "DOID:10534",
"recommended_name": {
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "stomach cancer",
"description": "A gastrointestinal system cancer that is located_in the stomach."
},
"synonyms": [
{
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "gastric cancer",
"description": ""
},
{
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer",
"description": "A primary or metastatic malignant neoplasm involving the stomach."
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "Ca lesser curvature - stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "cancer of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer risk after h. pylori infection",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer, somatic",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric tumor",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric tumour",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant stomach neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of greater curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of greater curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "stomach cancer",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "Ca body - stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "ca greater curvature of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer, intestinal",
"description": ""
},
{
"id": "MIM:613659",
"resource": "MIM",
"url": "https://www.omim.org/entry/613659",
"name": "Gastric cancer",
"description": "Gastric cancer"
}
]
}
]
},
{
"significant": "No",
"trend": "down",
"name": "Urinary bladder cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:11054",
"evidence": [
{
"database": "BioXpress",
"id": "O15550",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15550"
}
],
"disease": [
{
"disease_id": "DOID:11054",
"recommended_name": {
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "urinary bladder cancer",
"description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder."
},
"synonyms": [
{
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "bladder cancer",
"description": ""
},
{
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder cancer",
"description": "A primary or metastatic malignant neoplasm involving the bladder."
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "tumour of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "bladder cancer, somatic",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "cancer of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder tumour",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm, bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm, urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor, urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder tumour",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder cancer",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant tumour",
"description": ""
},
{
"id": "MIM:109800",
"resource": "MIM",
"url": "https://www.omim.org/entry/109800",
"name": "Bladder cancer",
"description": "Bladder cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Head and neck cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:11934",
"evidence": [
{
"database": "BioXpress",
"id": "O15550",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15550"
}
],
"disease": [
{
"disease_id": "DOID:11934",
"recommended_name": {
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck cancer",
"description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx."
},
"synonyms": [
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck neoplasm",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck tumours",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head/neck neoplasm",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "tumor of head and neck",
"description": ""
}
]
}
]
},
{
"significant": "No",
"trend": "up",
"name": "Lung cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1324",
"evidence": [
{
"database": "BioXpress",
"id": "O15550",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15550"
}
],
"disease": [
{
"disease_id": "DOID:1324",
"recommended_name": {
"id": "DOID:1324",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1324",
"name": "lung cancer",
"description": "A respiratory system cancer that is located_in the lung."
},
"synonyms": [
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility 1",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "LNCR1",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility 1",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "lung cancer susceptibility 3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "LNCR3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "lung cancer susceptibility 3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "adenocarcinoma of lung, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "lung cancer susceptibility 4",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "LNCR4",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "lung cancer susceptibility 4",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "lung cancer susceptibility 5",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "LNCR5",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "lung cancer susceptibility 5",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer",
"description": "A malignant neoplasm involving the lung."
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "adenocarcinoma of lung, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "cancer of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, protection against, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, resistance to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung neoplasm",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung tumor",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung tumour",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant neoplasm of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant neoplasm of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumor of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumor of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumour of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumour of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "Nonsmall cell lung cancer",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "alveolar cell carcinoma",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, protection against",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung neoplasm",
"description": ""
},
{
"id": "MIM:211980",
"resource": "MIM",
"url": "https://www.omim.org/entry/211980",
"name": "Lung cancer",
"description": "Lung cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Breast cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1612",
"evidence": [
{
"database": "BioXpress",
"id": "O15550",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15550"
}
],
"disease": [
{
"disease_id": "DOID:1612",
"recommended_name": {
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "breast cancer",
"description": "A thoracic cancer that originates in the mammary gland."
},
"synonyms": [
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "breast tumor",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "malignant neoplasm of breast",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "malignant tumor of the breast",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "mammary cancer",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "mammary tumor",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "primary breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast carcinoma",
"description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma."
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer susceptibility, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, lobular, somatic",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, protection against, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, somatic",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial breast carcinoma",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial cancer of breast",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial cancer of the breast",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast carcinoma",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, familial",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, familial Male",
"description": ""
},
{
"id": "MIM:114480",
"resource": "MIM",
"url": "https://www.omim.org/entry/114480",
"name": "Breast cancer",
"description": "Breast cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Thyroid cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1781",
"evidence": [
{
"database": "BioXpress",
"id": "O15550",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15550"
}
],
"disease": [
{
"disease_id": "DOID:1781",
"recommended_name": {
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid cancer",
"description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage."
},
"synonyms": [
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid gland cancer",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "Thyroid gland neoplasm",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "malignant neoplasm of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "malignant tumour of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "neoplasm of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid neoplasm",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Kidney cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:263",
"evidence": [
{
"database": "BioXpress",
"id": "O15550",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15550"
}
],
"disease": [
{
"disease_id": "DOID:263",
"recommended_name": {
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "kidney cancer",
"description": "A urinary system cancer that is located_in the kidney."
},
"synonyms": [
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "malignant neoplasm of kidney except pelvis",
"description": ""
},
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "malignant tumour of kidney",
"description": ""
},
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "renal cancer",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Liver cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:3571",
"evidence": [
{
"database": "BioXpress",
"id": "O15550",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15550"
}
],
"disease": [
{
"disease_id": "DOID:3571",
"recommended_name": {
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "liver cancer",
"description": "A hepatobiliary system cancer that is located_in the liver."
},
"synonyms": [
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "Ca liver - primary",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "Resectable malignant neoplasm of Liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "hepatic cancer",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "hepatic neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant hepato-biliary neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver, primary",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant tumor of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "non-resectable primary hepatic malignant neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "primary liver cancer",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "primary malignant neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "resectable malignant neoplasm of the liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver, not specified as primary or secondary",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Uterine cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:363",
"evidence": [
{
"database": "BioXpress",
"id": "O15550",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15550"
}
],
"disease": [
{
"disease_id": "DOID:363",
"recommended_name": {
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine cancer",
"description": "A female reproductive organ cancer that is located_in the uterus."
},
"synonyms": [
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "CA - cancer of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "Tumour of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterus neoplasm",
"description": ""
}
]
}
]
},
{
"significant": "No",
"trend": "down",
"name": "Esophageal cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:5041",
"evidence": [
{
"database": "BioXpress",
"id": "O15550",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15550"
}
],
"disease": [
{
"disease_id": "DOID:5041",
"recommended_name": {
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "esophageal cancer",
"description": "A gastrointestinal system cancer that is located_in the esophagus."
},
"synonyms": [
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "Ca lower third oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "Ca middle third oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "esophagus cancer",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of distal third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of lower third of oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of middle third of oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of proximal third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of upper third esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of Distal Third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of Proximal Third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of abdominal esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of the middle Third of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer",
"description": "A primary or metastatic malignant neoplasm involving the esophagus."
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "cancer of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "cancer of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal carcinoma, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal squamous cell carcinoma, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophagus cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal tumor",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal tumour",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophagus neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophagus tumor",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant oesophagus neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant oesophagus tumour",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "oesophagus cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca lower third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca lower third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca middle third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca middle third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of distal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of distal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of lower third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of lower third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of middle third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of middle third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of proximal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of proximal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of upper third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of upper third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of abdominal esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of distal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of proximal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of the middle third of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of abdominal oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of distal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of proximal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of the middle third of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Aerodigestive tract cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Escc, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal squamous cell carcinoma, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "gastric cardia adenocarcinoma, susceptibility to",
"description": ""
},
{
"id": "MIM:133239",
"resource": "MIM",
"url": "https://www.omim.org/entry/133239",
"name": "Esophageal cancer",
"description": "Esophageal cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Colorectal cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:9256",
"evidence": [
{
"database": "BioXpress",
"id": "O15550",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15550"
}
],
"disease": [
{
"disease_id": "DOID:9256",
"recommended_name": {
"id": "DOID:9256",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:9256",
"name": "colorectal cancer",
"description": "A large intestine cancer that is located_in the colon and/or located_in the rectum."
},
"synonyms": [
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma."
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, advanced, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer with chromosomal instability, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectum cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectum neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "CRC",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "large intestine cancer",
"description": ""
},
{
"id": "MIM:114500",
"resource": "MIM",
"url": "https://www.omim.org/entry/114500",
"name": "Colorectal cancer",
"description": "Colorectal cancer"
}
]
}
]
}
],
"species": [
{
"name": "Homo sapiens",
"taxid": 9606,
"evidence": [
{
"database": "UniProtKB",
"id": "O15550",
"url": "https://www.uniprot.org/uniprot/O15550"
}
],
"common_name": "Human"
}
],
"gene": [
{
"name": "KDM6A",
"url": "https://www.uniprot.org/uniprot/O15550",
"locus": {
"chromosome": "X",
"start_pos": 45112779,
"end_pos": 44873188,
"strand": "-",
"evidence": [
{
"database": "Ensembl Gene",
"id": "ENSG00000147050",
"url": "https://www.ensembl.org/id/ENSG00000147050"
}
]
}
}
],
"crossref": [
{
"id": "ENSG00000147050",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000147050",
"database": "Bgee",
"categories": [
"Gene Expression"
]
},
{
"id": "O15550",
"url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O15550",
"database": "BioMuta",
"categories": [
"Variation"
]
},
{
"id": "1.14.11.68",
"url": "https://www.brenda-enzymes.org/enzyme.php?ecno=1.14.11.68&UniProtAcc=O15550",
"database": "BRENDA",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "CHEMBL2069164",
"url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL2069164",
"database": "ChEMBL",
"categories": [
"Other"
]
},
{
"id": "KDM6A",
"url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=KDM6A",
"database": "GeneCards",
"categories": [
"Gene Annotation",
"Organism-specific"
]
},
{
"id": "7403",
"url": "https://www.ncbi.nlm.nih.gov/gene/7403",
"database": "GeneID",
"categories": [
"Genome Annotation"
]
},
{
"id": "12637",
"url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=12637",
"database": "HGNC",
"categories": [
"Organism-specific"
]
},
{
"id": "A0A087X0R0",
"url": "https://www.ebi.ac.uk/intact/interactors/id:A0A087X0R0*",
"database": "IntAct",
"categories": [
"Other"
]
},
{
"id": "F5H5V6",
"url": "https://www.ebi.ac.uk/intact/interactors/id:F5H5V6*",
"database": "IntAct",
"categories": [
"Other"
]
},
{
"id": "O15550",
"url": "https://www.ebi.ac.uk/intact/interactors/id:O15550*",
"database": "IntAct",
"categories": [
"Other"
]
},
{
"id": "IPR001440",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR001440",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR003347",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR003347",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR011990",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR011990",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR019734",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR019734",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR046941",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR046941",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR048560",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR048560",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR048562",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR048562",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "hsa:7403",
"url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:7403",
"database": "KEGG Pathway",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "300128",
"url": "http://www.omim.org/entry/300128",
"database": "MIM",
"categories": [
"Other"
]
},
{
"id": "300867",
"url": "http://www.omim.org/entry/300867",
"database": "MIM",
"categories": [
"Other"
]
},
{
"id": "NX_O15550",
"url": "https://www.nextprot.org/entry/NX_O15550",
"database": "neXtProt",
"categories": [
"Protein",
"Organism-specific"
]
},
{
"id": "O15550",
"url": "https://oglcnac.org/atlas/detail/O15550",
"database": "O-GlcNAc Atlas",
"categories": [
"Glycoproteomics"
]
},
{
"id": "O15550",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=O15550",
"database": "O-GlcNAc Database",
"categories": [
"Glycoproteomics"
]
},
{
"id": "NCISHRS",
"url": "https://omabrowser.org/oma/group/NCISHRS/",
"database": "OMA",
"categories": [
"Protein Classification"
]
},
{
"id": "20251at2759",
"url": "http://www.orthodb.org/?query=20251at2759",
"database": "OrthoDB",
"categories": [
"Protein Classification"
]
},
{
"id": "PTHR14017",
"url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR14017",
"database": "PANTHER",
"categories": [
"Protein Classification"
]
},
{
"id": "PTHR14017:SF9",
"url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR14017:SF9",
"database": "PANTHER",
"categories": [
"Protein Classification"
]
},
{
"id": "3AVR",
"url": "https://www.rcsb.org/structure/3AVR",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "3AVS",
"url": "https://www.rcsb.org/structure/3AVS",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6FUK",
"url": "https://www.rcsb.org/structure/6FUK",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6FUL",
"url": "https://www.rcsb.org/structure/6FUL",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "PF00515",
"url": "http://pfam.xfam.org/family/PF00515",
"database": "Pfam",
"categories": [
"Protein Classification"
]
},
{
"id": "PF02373",
"url": "http://pfam.xfam.org/family/PF02373",
"database": "Pfam",
"categories": [
"Protein Classification"
]
},
{
"id": "PF13181",
"url": "http://pfam.xfam.org/family/PF13181",
"database": "Pfam",
"categories": [
"Protein Classification"
]
},
{
"id": "PF13432",
"url": "http://pfam.xfam.org/family/PF13432",
"database": "Pfam",
"categories": [
"Protein Classification"
]
},
{
"id": "PF21322",
"url": "http://pfam.xfam.org/family/PF21322",
"database": "Pfam",
"categories": [
"Protein Classification"
]
},
{
"id": "PF21326",
"url": "http://pfam.xfam.org/family/PF21326",
"database": "Pfam",
"categories": [
"Protein Classification"
]
},
{
"id": "O15550",
"url": "https://pharos.nih.gov/targets/O15550",
"database": "PHAROS",
"categories": [
"Organism-specific"
]
},
{
"id": "PR_O15550",
"url": "http://purl.obolibrary.org/obo/PR_O15550",
"database": "PRO",
"categories": [
"Protein"
]
},
{
"id": "R-HSA-3214842",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214842",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-5617472",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-9821002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9821002",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "NP_066963",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_066963",
"database": "RefSeq",
"categories": [
"Protein"
]
},
{
"id": "60224",
"url": "https://www.rhea-db.org/rhea/60224",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "A0A087WUN6",
"url": "https://www.uniprot.org/uniprot/A0A087WUN6",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "A0A087WUN6-1",
"url": "https://www.uniprot.org/uniprot/A0A087WUN6-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "A0A087X0R0",
"url": "https://www.uniprot.org/uniprot/A0A087X0R0",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "A0A087X0R0-1",
"url": "https://www.uniprot.org/uniprot/A0A087X0R0-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "A0A6Q8PFD0",
"url": "https://www.uniprot.org/uniprot/A0A6Q8PFD0",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "A0A6Q8PFD0-1",
"url": "https://www.uniprot.org/uniprot/A0A6Q8PFD0-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "A0A6Q8PFK0",
"url": "https://www.uniprot.org/uniprot/A0A6Q8PFK0",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "A0A6Q8PFK0-1",
"url": "https://www.uniprot.org/uniprot/A0A6Q8PFK0-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "A0A6Q8PG32",
"url": "https://www.uniprot.org/uniprot/A0A6Q8PG32",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "A0A6Q8PG32-1",
"url": "https://www.uniprot.org/uniprot/A0A6Q8PG32-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "A0A6Q8PG92",
"url": "https://www.uniprot.org/uniprot/A0A6Q8PG92",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "A0A6Q8PG92-1",
"url": "https://www.uniprot.org/uniprot/A0A6Q8PG92-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "A0A6Q8PGG6",
"url": "https://www.uniprot.org/uniprot/A0A6Q8PGG6",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "A0A6Q8PGG6-1",
"url": "https://www.uniprot.org/uniprot/A0A6Q8PGG6-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "A0A6Q8PGN0",
"url": "https://www.uniprot.org/uniprot/A0A6Q8PGN0",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "A0A6Q8PGN0-1",
"url": "https://www.uniprot.org/uniprot/A0A6Q8PGN0-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "A0A6Q8PH94",
"url": "https://www.uniprot.org/uniprot/A0A6Q8PH94",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "A0A6Q8PH94-1",
"url": "https://www.uniprot.org/uniprot/A0A6Q8PH94-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "A0A6Q8PHB6",
"url": "https://www.uniprot.org/uniprot/A0A6Q8PHB6",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "A0A6Q8PHB6-1",
"url": "https://www.uniprot.org/uniprot/A0A6Q8PHB6-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "A0A6Q8PHJ0",
"url": "https://www.uniprot.org/uniprot/A0A6Q8PHJ0",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "A0A6Q8PHJ0-1",
"url": "https://www.uniprot.org/uniprot/A0A6Q8PHJ0-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "A0A804HIZ7",
"url": "https://www.uniprot.org/uniprot/A0A804HIZ7",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "A0A804HIZ7-1",
"url": "https://www.uniprot.org/uniprot/A0A804HIZ7-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "A0A804HJA2",
"url": "https://www.uniprot.org/uniprot/A0A804HJA2",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "A0A804HJA2-1",
"url": "https://www.uniprot.org/uniprot/A0A804HJA2-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "A0A804HLJ3",
"url": "https://www.uniprot.org/uniprot/A0A804HLJ3",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "A0A804HLJ3-1",
"url": "https://www.uniprot.org/uniprot/A0A804HLJ3-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "F5H5V6",
"url": "https://www.uniprot.org/uniprot/F5H5V6",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "F5H5V6-1",
"url": "https://www.uniprot.org/uniprot/F5H5V6-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "F5H6S1",
"url": "https://www.uniprot.org/uniprot/F5H6S1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "F5H6S1-1",
"url": "https://www.uniprot.org/uniprot/F5H6S1-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "F8W8R6",
"url": "https://www.uniprot.org/uniprot/F8W8R6",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "F8W8R6-1",
"url": "https://www.uniprot.org/uniprot/F8W8R6-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "H0Y6V5",
"url": "https://www.uniprot.org/uniprot/H0Y6V5",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "H0Y6V5-1",
"url": "https://www.uniprot.org/uniprot/H0Y6V5-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "O15550",
"url": "https://www.uniprot.org/uniprot/O15550",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "O15550-1",
"url": "https://www.uniprot.org/uniprot/O15550-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
}
],
"sequence": {
"sequence": "MKSCGVSLATAAAAAAAFGDEEKKMAAGKASGESEEASPSLTAEEREALGGLDSRLFGFVRFHEDGARTKALLGKAVRCYESLILKAEGKVESDFFCQLGHFNLLLEDYPKALSAYQRYYSLQSDYWKNAAFLYGLGLVYFHYNAFQWAIKAFQEVLYVDPSFCRAKEIHLRLGLMFKVNTDYESSLKHFQLALVDCNPCTLSNAEIQFHIAHLYETQRKYHSAKEAYEQLLQTENLSAQVKATVLQQLGWMHHTVDLLGDKATKESYAIQYLQKSLEADPNSGQSWYFLGRCYSSIGKVQDAFISYRQSIDKSEASADTWCSIGVLYQQQNQPMDALQAYICAVQLDHGHAAAWMDLGTLYESCNQPQDAIKCYLNATRSKSCSNTSALAARIKYLQAQLCNLPQGSLQNKTKLLPSIEEAWSLPIPAELTSRQGAMNTAQQNTSDNWSGGHAVSHPPVQQQAHSWCLTPQKLQHLEQLRANRNNLNPAQKLMLEQLESQFVLMQQHQMRPTGVAQVRSTGIPNGPTADSSLPTNSVSGQQPQLALTRVPSVSQPGVRPACPGQPLANGPFSAGHVPCSTSRTLGSTDTILIGNNHITGSGSNGNVPYLQRNALTLPHNRTNLTSSAEEPWKNQLSNSTQGLHKGQSSHSAGPNGERPLSSTGPSQHLQAAGSGIQNQNGHPTLPSNSVTQGAALNHLSSHTATSGGQQGITLTKESKPSGNILTVPETSRHTGETPNSTASVEGLPNHVHQMTADAVCSPSHGDSKSPGLLSSDNPQLSALLMGKANNNVGTGTCDKVNNIHPAVHTKTDNSVASSPSSAISTATPSPKSTEQTTTNSVTSLNSPHSGLHTINGEGMEESQSPMKTDLLLVNHKPSPQIIPSMSVSIYPSSAEVLKACRNLGKNGLSNSSILLDKCPPPRPPSSPYPPLPKDKLNPPTPSIYLENKRDAFFPPLHQFCTNPNNPVTVIRGLAGALKLDLGLFSTKTLVEANNEHMVEVRTQLLQPADENWDPTGTKKIWHCESNRSHTTIAKYAQYQASSFQESLREENEKRSHHKDHSDSESTSSDNSGRRRKGPFKTIKFGTNIDLSDDKKWKLQLHELTKLPAFVRVVSAGNLLSHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFVVPEGYWGVLNDFCEKNNLNFLMGSWWPNLEDLYEANVPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNIAWNVGPLTACQYKLAVERYEWNKLQSVKSIVPMVHLSWNMARNIKVSDPKLFEMIKYCLLRTLKQCQTLREALIAAGKEIIWHGRTKEEPAHYCSICEVEVFDLLFVTNESNSRKTYIVHCQDCARKTSGNLENFVVLEQYKMEDLMQVYDQFTLAPPLPSASS",
"length": 1401,
"header": "sp|O15550-1|KDM6A_HUMAN Isoform 1 of Lysine-specific demethylase 6A OS=Homo sapiens OX=9606 GN=KDM6A PE=1 SV=2 CANONICAL=O15550-1"
},
"isoforms": [
{
"isoform_ac": "A0A087WUN6-1",
"url": "",
"sequence": {
"sequence": "MKSCGVSLATAAAAAAAFGDEEKKMAAGKASGESEEASPSLTAEEREALGGLDSRLFGFVRFHEDGARTKALLGKAVRCYESLILKAEGKVESDFFCQLGHFNLLLEDYPKALSAYQRYYSLQSDYWKNAAFLYGLGLVYFHYNAFQWAIKAFQEVLYVDPSFCRAKEIHLRLGLMFKVNTDYESSLKHFQLALVDCNPCTLSNAEIQFHIAHLYETQVGCITL",
"length": 224,
"header": "tr|A0A087WUN6-1|A0A087WUN6_HUMAN Computationally mapped isoform of [histone H3]-trimethyl-L-lysine(27) demethylase OS=Homo sapiens OX=9606 GN=KDM6A PE=1 SV=1 CANONICAL=O15550-1"
},
"locus": {
"chromosome": "X",
"start_pos": 45053846,
"end_pos": 44873552,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000621147.5",
"url": "https://www.ensembl.org/id/ENST00000621147.5"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000478793.1",
"url": "https://www.ensembl.org/id/ENSP00000478793.1"
}
]
}
},
{
"isoform_ac": "A0A087X0R0-1",
"url": "",
"sequence": {
"sequence": "MKSCGVSLATAAAAAAAFGDEEKKMAAGKASGESEEASPSLTAEEREALGGLDSRLFGFVRFHEDGARTKALLGKAVRCYESLILKAEGKVESDFFCQLGHFNLLLEDYPKALSAYQRYYSLQSDYWKNAAFLYGLGLVYFHYNAFQWAIKAFQEVLYVDPSFCRAKEIHLRLGLMFKVNTDYESSLKHFQLALVDCNPCTLSNAEIQFHIAHLYETQRKYHSAKEAYEQLLQTENLSAQVKATVLQQLGWMHHTVDLLGDKATKESYAIQYLQKSLEADPNSGQSWYFLGRCYSSIGKVQDAFISYRQSIDKSEASADTWCSIGVLYQQQNQPMDALQAYICAVQLDHGHAAAWMDLGTLYESCNQPQDAIKCYLNATRSKSCSNTSALAARIKYLQAQLCNLPQGSLQNKTKLLPSIEEAWSLPIPAELTSRQGAMNTAQQACKPHHPNTEPVLGLSQTPISQQSLPLHMIPSSQVDDLSSPAKRKRTSSPTKNTSDNWSGGHAVSHPPVQQQAHSWCLTPQKLQHLEQLRANRNNLNPAQKLMLEQLESQFVLMQQHQMRPTGVAQVRSTGIPNGPTADSSLPTNSVSGQQPQLALTRVPSVSQPGVRPACPGQPLANGPFSAGHVPCSTSRTLGSTDTILIGNNHITGSGSNGNVPYLQRNALTLPHNRTNLTSSAEEPWKNQLSNSTQGLHKGQSSHSAGPNGERPLSSTGPSQHLQAAGSGIQNQNGHPTLPSNSVTQGAALNHLSSHTATSGGQQGITLTKESKPSGNILTVPETSRHTGETPNSTASVEGLPNHVHQMTADAVCSPSHGDSKSPGLLSSDNPQLSALLMGKANNNVGTGTCDKVNNIHPAVHTKTDNSVASSPSSAISTATPSPKSTEQTTTNSVTSLNSPHSGLHTINGEGMEESQSPMKTDLLLVNHKPSPQIIPSMSVSIYPSSAEVLKACRNLGKNGLSNSSILLDKCPPPRPPSSPYPPLPKDKLNPPTPSIYLENKRDAFFPPLHQFCTNPNNPVTVIRGLAGALKLDLGLFSTKTLVEANNEHMVEVRTQLLQPADENWDPTGTKKIWHCESNRSHTTIAKYAQYQASSFQESLREENEKRSHHKDHSDSESTSSDNSGRRRKGPFKTIKFGTNIDLSDDKKWKLQLHELTKLPAFVRVVSAGNLLSHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFVVPEGYWGVLNDFCEKNNLNFLMGSWWPNLEDLYEANVPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNIAWNVGPLTACQYKLAVERYEWNKLQSVKSIVPMVHLSWNMARNIKVSDPKLFEMIKYCLLRTLKQCQTLREALIAAGKEIIWHGRTKEEPAHYCSICEVEVFDLLFVTNESNSRKTYIVHCQDCARKTSGNLENFVVLEQYKMEDLMQVYDQFTLAPPLPSASS",
"length": 1453,
"header": "tr|A0A087X0R0-1|A0A087X0R0_HUMAN Computationally mapped isoform of [histone H3]-trimethyl-L-lysine(27) demethylase OS=Homo sapiens OX=9606 GN=KDM6A PE=1 SV=2 CANONICAL=O15550-1"
},
"locus": {
"chromosome": "X",
"start_pos": 45111408,
"end_pos": 44873552,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000611820.5",
"url": "https://www.ensembl.org/id/ENST00000611820.5"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000483595.2",
"url": "https://www.ensembl.org/id/ENSP00000483595.2"
}
]
}
},
{
"isoform_ac": "A0A6Q8PFD0-1",
"url": "",
"sequence": {
"sequence": "MKSCGVSLATAAAAAAAFGDEEKKMAAGKASGESEEASPSLTAEEREALGGLDSRLFGFVRFHEDGARTKALLGKAVRCYESLILKAEGKVESDFFCQLGHFNLLLEDYPKALSAYQRYYSLQSDYWKNAAFLYGLGLVYFHYNAFQWAIKAFQEVLYVDPSFCRAKEIHLRLGLMFKVNTDYESSLKHFQLALVDCNPCTLSNAEIQFHIAHLYETQRKYHSAKEAYEQLLQTENLSAQVKATVLQQLGWMHHTVDLLGDKATKESYAIQYLQKSLEADPNSGQSWYFLGRCYSSIGKVQDAFISYRQSIDKSEASADTWCSIGVLYQQQNQPMDALQAYICAVQLDHGHAAAWMDLGTLYESCNQPQDAIKCYLNATRSKSCSNTSALAARIKYLQACKPHHPNTEPVLGLSQTPISQQSLPLHMIPSSQVDDLSSPAKRKRTSSPTKNTSDNWSGGHAVSHPPVQQQAHSWCLTPQKLQHLEQLRANRNNLNPAQKLMLEQLESQFVLMQQHQMRPTGVAQVRSTGIPNGPTADSSLPTNSVSGQQPQLALTRVPSVSQPGVRPACPGQPLANGPFSAGHVPCSTSRTLGSTDTILIGNNHITGSGSNGNVPYLQRNALTLPHNRTNLTSSAEEPWKNQLSNSTQGLHKGQSSHSAGPNGERPLSSTGPSQHLQAAGSGIQNQNGHPTLPSNSVTQGAALNHLSSHTATSGGQQGITLTKESKPSGNILTVPETSRHTGETPNSTASVEGLPNHVHQMTADAVCSPSHGDSKSPGLLSSDNPQLSALLMGKANNNVGTGTCDKVNNIHPAVHTKTDNSVASSPSSAISTATPSPKSTEQTTTNSVTSLNSPHSGLHTINGEGMEESQSPMKTDLLLVNHKPSPQIIPSMSVSIYPSSAEVLKACRNLGKNGLSNSSILLDKCPPPRPPSSPYPPLPKDKLNPPTPSIYLENKRDAFFPPLHQFCTNPNNPVTVIRGLAGALKLDLGLFSTKTLVEANNEHMVEVRTQLLQPADENWDPTGTKKIWHCESNRSHTTIAKYAQYQASSFQESLREENEKRSHHKDHSDSESTSSDNSGRRRKGPFKTIKFGTNIDLSDDKKWKLQLHELTKLPAFVRVVSAGNLLSHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFVVPEGYWGVLNDFCEKNNLNFLMGSWWPNLEDLYEANVPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNIAWNVGPLTGIVF",
"length": 1256,
"header": "tr|A0A6Q8PFD0-1|KDM6A_HUMAN Computationally mapped isoform of Lysine-specific demethylase 6A OS=Homo sapiens OX=9606 GN=KDM6A PE=1 SV=1 CANONICAL=O15550-1"
},
"locus": {
"chromosome": "X",
"start_pos": 45107420,
"end_pos": 44873552,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000676343.1",
"url": "https://www.ensembl.org/id/ENST00000676343.1"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000501761.1",
"url": "https://www.ensembl.org/id/ENSP00000501761.1"
}
]
}
},
{
"isoform_ac": "A0A6Q8PFK0-1",
"url": "",
"sequence": {
"sequence": "MKSCGVSLATAAAAAAAFGDEEKKMAAGKASGESEEASPSLTAEEREALGGLDSRLFGFVRFHEDGARTKALLGKAVRCYESLILKAEGKVESDFFCQLGHFNLLLEDYPKALSAYQRYYSLQSDYWKNAAFLYGLGLVYFHYNAFQWAIKAFQEVLYVDPSFCRAKEIHLRLGLMFKVNTDYESSLKHFQLALVDCNPCTLSNAEIQFHIAHLYETQRKYHSAKEAYEQLLQTENLSAQVKATVLQQLGWMHHTVDLLGDKATKESYAIQYLQKSLEADPNSGQSWYFLGRCYSSIGKVQDAFISYRQSIDKSEASADTWCSIGVLYQQQNQPMDALQAYICAVQLDHGHAAAWMDLGTLYESCNQPQDAIKCYLNATRSKSCSNTSALAARIKYLQAQLCNLPQGSLQNKTKLLPSIEEAWSLPIPAELTSRQGAMNTAQQNTSDNWSGGHAVSHPPVQQQAHSWCLTPQKLQMRPTGVAQVRSTGIPNGPTADSSLPTNSVSGQQPQLALTRVPSVSQPGVRPACPGQPLANGPFSAGHVPCSTSRTLGSTDTILIGNNHITGSGSNGNVPYLQRNALTLPHNRTNLTSSAEEPWKNQLSNSTQGLHKGQSSHSAGPNGERPLSSTGPSQHLQAAGSGIQNQNGHPTLPSNSVTQGAALNHLSSHTATSGGQQGITLTKESKPSGNILTVPETSRHTGETPNSTASVEGLPNHVHQMTADAVCSPSHGDSKSPGLLSSDNPQLSALLMGKANNNVGTGTCDKVNNIHPAVHTKTDNSVASSPSSAISTATPSPKSTEQTTTNSVTSLNSPHSGLHTINGEGMEESQSPMKTDLLLVNHKPSPQIIPSMSVSIYPSSAEVLKACRNLGKNGLSNSSILLDKCPPPRPPSSPYPPLPKDKLNPPTPSIYLENKRDAFFPPLHQFCTNPNNPVTVIRGLAGALKLDLGLFSTKTLVEANNEHMVEVRTQLLQPADENWDPTGTKKIWHCESNRSHTTIAKYAQYQASSFQESLREENEKRSHHKDHSDSESTSSDNSGRRRKGPFKTIKFGTNIDLSDDKKWKLQLHELTKLPAFVRVVSAGNLLSHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFVVPEGYWGVLNDFCEKNNLNFLMGSWWPNLEDLYEANVPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNIAWNVGPLTACQYKLAVERYEWNKLQSVKSIVPMVHLSWNMARNIKVSDPKLFEMIKYCLLRTLKQCQTLREALIAAGKEIIWHGRTKEEPAHYCSICEVEVFDLLFVTNESNSRKTYIVHCQDCARKTSGNLENFVVLEQYKMEDLMQVYDQFTLAPPLPSASS",
"length": 1367,
"header": "tr|A0A6Q8PFK0-1|A0A6Q8PFK0_HUMAN Computationally mapped isoform of [histone H3]-trimethyl-L-lysine(27) demethylase OS=Homo sapiens OX=9606 GN=KDM6A PE=1 SV=1 CANONICAL=O15550-1"
},
"locus": {
"chromosome": "X",
"start_pos": 45111408,
"end_pos": 44873552,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000675577.1",
"url": "https://www.ensembl.org/id/ENST00000675577.1"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000501855.1",
"url": "https://www.ensembl.org/id/ENSP00000501855.1"
}
]
}
},
{
"isoform_ac": "A0A6Q8PG32-1",
"url": "",
"sequence": {
"sequence": "MKSCGVSLATAAAAAAAFGDEEKKMAAGKASGESEEASPSLTAEEREALGGLDSRLFGFVRFHEDGARTKALLGKNAAFLYGLGLVYFHYNAFQWAIKAFQEVLYVDPSFCRAKEIHLRLGLMFKVNTDYESSLKHFQLALVDCNPCTLSNAEIQFHIAHLYETQRKYHSAKEAYEQLLQTENLSAQVKATVLQQLGWMHHTVDLLGDKATKESYAIQYLQKSLEADPNSGQSWYFLGRCYSSIGKVQDAFISYRQSIDKSEASADTWCSIGVLYQQQNQPMDALQAYICAVQLDHGHAAAWMDLGTLYESCNQPQDAIKCYLNATRSKSCSNTSALAARIKYLQACKPHHPNTEPVLGLSQTPISQQSLPLHMIPSSQVDDLSSPAKRKRTSSPTKNTSDNWSGGHAVSHPPVQQQAHSWCLTPQKLQHLEQLRANRNNLNPAQKLMLEQLESQFVLMQQHQMRPTGVAQVRSTGIPNGPTADSSLPTNSVSGQQPQLALTRVPSVSQPGVRPACPGQPLANGPFSAGHVPCSTSRTLGSTDTILIGNNHITGSGSNGNVPYLQRNALTLPHNRTNLTSSAEEPWKNQLSNSTQGLHKGQSSHSAGPNGERPLSSTGPSQHLQAAGSGIQNQNGHPTLPSNSVTQGAALNHLSSHTATSGGQQGITLTKESKPSGNILTVPETSRHTGETPNSTASVEGLPNHVHQMTADAVCSPSHGDSKSPGLLSSDNPQLSALLMGKANNNVGTGTCDKVNNIHPAVHTKTDNSVASSPSSAISTATPSPKSTEQTTTNSVTSLNSPHSGLHTINGEGMEESQSPMKTDLLLVNHKPSPQIIPSMSVSIYPSSAEVLKACRNLGKNGLSNSSILLDKCPPPRPPSSPYPPLPKDKLNPPTPSIYLENKRDAFFPPLHQFCTNPNNPVTVIRGLAGALKLDLGLFSTKTLVEANNEHMVEVRTQLLQPADENWDPTGTKKIWHCESNRSHTTIAKYAQYQASSFQESLREENEKRSHHKDHSDSESTSSDNSGRRRKGPFKTIKFGTNIDLSDDKKWKLQLHELTKLPAFVRVVSAGNLLSHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFVVPEGYWGVLNDFCEKNNLNFLMGSWWPNLEDLYEANVPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNIAWNVGPLTACQYKLAVERYEWNKLQSVKSIVPMVHLSWNMARNIKVSDPKLFEMIKYCLLRTLKQCQTLREALIAAGKEIIWHGRTKEEPAHYCSICEVEVFDLLFVTNESNSRKTYIVHCQDCARKTSGNLENFVVLEQYKMEDLMQVYDQFTLAPPLPSASS",
"length": 1355,
"header": "tr|A0A6Q8PG32-1|KDM6A_HUMAN Computationally mapped isoform of Lysine-specific demethylase 6A OS=Homo sapiens OX=9606 GN=KDM6A PE=1 SV=1 CANONICAL=O15550-1"
},
"locus": {
"chromosome": "X",
"start_pos": 45111408,
"end_pos": 44873552,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000674867.1",
"url": "https://www.ensembl.org/id/ENST00000674867.1"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000502060.1",
"url": "https://www.ensembl.org/id/ENSP00000502060.1"
}
]
}
},
{
"isoform_ac": "A0A6Q8PG92-1",
"url": "",
"sequence": {
"sequence": "MKSCGVSLATAAAAAAAFGDEEKKMAAGKASGESEEASPSLTAEEREALGGLDSRLFGFVRFHEDGARTKALLGKAVRCYESLILKAEGKVESDFFCQLGHFNLLLEDYPKALSAYQRYYSLQSDYWKNAAFLYGLGLVYFHYNAFQWAIKAFQEVLYVDPSFCRAKEIHLRLGLMFKVNTDYESSLKHFQLALVDCNPCTLSNAEIQFHIAHLYETQRKYHSAKEAYEQLLQTENLSAQVKATVLQQLGWMHHTVDLLGDKATKESYAIQYLQKSLEADPNSGQSWYFLGRCYSSIGKVQDAFISYRQSIDKSEASADTWCSIGVLYQQQNQPMDALQAYICAVQLDHGHAAAWMDLGTLYESCNQPQDAIKCYLNATRSKSCSNTSALAARIKYLQACKPHHPNTEPVLGLSQTPISQQSLPLHMIPSSQVDDLSSPAKRKRTSSPTKNTSDNWSGGHAVSHPPVQQQAHSWCLTPQKLQMRPTGVAQVRSTGIPNGPTADSSLPTNSVSGQQPQLALTRVPSVSQPGVRPACPGQPLANGPFSAGHVPCSTSRTLGSTDTILIGNNHITGSGSNGNVPYLQRNALTLPHNRTNLTSSAEEPWKNQLSNSTQGLHKGQSSHSAGPNGERPLSSTGPSQHLQAAGSGIQNQNGHPTLPSNSVTQGAALNHLSSHTATSGGQQGITLTKESKPSGNILTVPETSRHTGETPNSTASVEGLPNHVHQMTADAVCSPSHGDSKSPGLLSSDNPQLSALLMGKANNNVGTGTCDKVNNIHPAVHTKTDNSVASSPSSAISTATPSPKSTEQTTTNSVTSLNSPHSGLHTINGEGMEESQSPMKTDLLLVNHKPSPQIIPSMSVSIYPSSAEVLKACRNLGKNGLSNSSILLDKCPPPRPPSSPYPPLPKDKLNPPTPSIYLENKRDAFFPPLHQFCTNPNNPVTVIRGLAGALKLDLGLFSTKTLVEANNEHMVEVRTQLLQPADENWDPTGTKKIWHCESNRSHTTIAKYAQYQASSFQESLREENEKRSHHKDHSDSESTSSDNSGRRRKGPFKTIKFGTNIDLSDDKKWKLQLHELTKLPAFVRVVSAGNLLSHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFVVPEGYWGVLNDFCEKNNLNFLMGSWWPNLEDLYEANVPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNIAWNVGPLTACQYKLAVERYEWNKLQSVKSIVPMVHLSWNMARNIKVLSSKNSEAMSDIEGSSHCCRKRDYMAWADKRRTSSLL",
"length": 1293,
"header": "tr|A0A6Q8PG92-1|A0A6Q8PG92_HUMAN Computationally mapped isoform of [histone H3]-trimethyl-L-lysine(27) demethylase OS=Homo sapiens OX=9606 GN=KDM6A PE=1 SV=1 CANONICAL=O15550-1"
},
"locus": {
"chromosome": "X",
"start_pos": 45107523,
"end_pos": 44873552,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000674564.1",
"url": "https://www.ensembl.org/id/ENST00000674564.1"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000502150.1",
"url": "https://www.ensembl.org/id/ENSP00000502150.1"
}
]
}
},
{
"isoform_ac": "A0A6Q8PGG6-1",
"url": "",
"sequence": {
"sequence": "MKSCGVSLATAAAAAAAFGDEEKKMAAGKASGESEEASPSLTAEEREALGGLDSRLFGFVRFHEDGARTKALLGKAVRCYESLILKAEGKVESDFFCQLGHFNLLLEDYPKALSAYQRYYSLQSDYWKNAAFLYGLGLVYFHYNAFQCIFS",
"length": 151,
"header": "tr|A0A6Q8PGG6-1|A0A6Q8PGG6_HUMAN Computationally mapped isoform of [histone H3]-trimethyl-L-lysine(27) demethylase OS=Homo sapiens OX=9606 GN=KDM6A PE=1 SV=1 CANONICAL=O15550-1"
},
"locus": {
"chromosome": "X",
"start_pos": 45034940,
"end_pos": 44873552,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000676085.1",
"url": "https://www.ensembl.org/id/ENST00000676085.1"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000501752.1",
"url": "https://www.ensembl.org/id/ENSP00000501752.1"
}
]
}
},
{
"isoform_ac": "A0A6Q8PGN0-1",
"url": "",
"sequence": {
"sequence": "MKSCGVSLATAAAAAAAFGDEEKKMAAGKASGESEEASPSLTAEEREALGGLDSRLFGFVRFHEDGARTKALLGKAVRCYESLILKAEGKVESDFFCQLGHFNLLLEDYPKALSAYQRYYSLQSDYWKNAAFLYGLGLVYFHYNAFQWAIKAFQEVLYVDPSFCRAKEIHLRLGLMFKVNTDYESSLKHFQLALVDCNPCTLSNAEIQFHIAHLYETQRKYHSAKEAYEQLLQTENLSAQVKATVLQQLGWMHHTVDLLGDKATKESYAIQYLQKSLEADPNSGQSWYFLGRCYSSIGKVQDAFISYRQSIDKSEASADTWCSIGVLYQQQNQPMDALQAYICAVQLDHGHAAAWMDLGTLYESCNQPQDAIKCYLNATRSKSCSNTSALAARIKYLQACKPHHPNTEPVLGLSQTPISQQSLPLHMIPSSQVDDLSSPAKRKRTSSPTKNTSDNWSGGHAVSHPPVQQQAHSWCLTPQKLQHLEQLRANRNNLNPAQKLMLEQLESQFVLMQQHQMRPTGVAQVRSTGIPNGPTADSSLPTNSVSGQQPQLALTRVPSVSQPGVRPACPGQPLANGPFSAGHVPCSTSRTLGSTDTILIGNNHITGSGSNGNVPYLQRNALTLPHNRTNLTSSAEEPWKNQLSNSTQGLHKGQSSHSAGPNGERPLSSTGPSQHLQAAGSGIQNQNGHPTLPSNSVTQGAALNHLSSHTATSGGQQGITLTKESKPSGNILTVPETSRHTGETPNSTASVEGLPNHVHQMTADAVCSPSHGDSKSPGLLSSDNPQLSALLMGKANNNVGTGTCDKVNNIHPAVHTKTDNSVASSPSSAISTATPSPKSTEQTTTNSVTSLNSPHSGLHTINGEGMEESQSPMKTDLLLVNHKPSPQIIPSMSVSIYPSSAEVLKACRNLGKNGLSNSSILLDKCPPPRPPSSPYPPLPKDKLNPPTPSIYLENKRDAFFPPLHQFCTNPNNPVTVIRGLAGALKLDLGLFSTKTLVEANNEHMVEVRTQLLQPADENWDPTGTKKIWHCESNRSHTTIAKYAQYQASSFQESLREENEKRSHHKDHSDSESTSSDNSGRRRKGPFKTIKFGTNIDLSDDKKWKLQLHELTKLPAFVRVVSAGNLLSHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFVVPEGYWGVLNDFCEKNNLNFLMGSWWPNLEDLYEANVPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNIAWNVGPLTACQYKLAVERYEWNKLQSVKSIVPMVHLSWNMARNIKVSDPKLFEMIKIFSLSPNFRAEKCLRDHLVQPLRSNGEPEPLRFTGE",
"length": 1336,
"header": "tr|A0A6Q8PGN0-1|KDM6A_HUMAN Computationally mapped isoform of Lysine-specific demethylase 6A OS=Homo sapiens OX=9606 GN=KDM6A PE=1 SV=1 CANONICAL=O15550-1"
},
"locus": {
"chromosome": "X",
"start_pos": 45106650,
"end_pos": 44873552,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000676062.1",
"url": "https://www.ensembl.org/id/ENST00000676062.1"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000502311.1",
"url": "https://www.ensembl.org/id/ENSP00000502311.1"
}
]
}
},
{
"isoform_ac": "A0A6Q8PH94-1",
"url": "",
"sequence": {
"sequence": "MKSCGVSLATAAAAAAAFGDEEKKMAAGKASGESEEASPSLTAEEREALGGLDSRLFGFVRFHEDGARTKALLGKAVRCYESLILKAEGKVESDFFCQLGHFNLLLEDYPKECCLFIWSWFGLLPL",
"length": 126,
"header": "tr|A0A6Q8PH94-1|KDM6A_HUMAN Computationally mapped isoform of Lysine-specific demethylase 6A OS=Homo sapiens OX=9606 GN=KDM6A PE=1 SV=1 CANONICAL=O15550-1"
},
"locus": {
"chromosome": "X",
"start_pos": 45011004,
"end_pos": 44873552,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000676133.1",
"url": "https://www.ensembl.org/id/ENST00000676133.1"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000502586.1",
"url": "https://www.ensembl.org/id/ENSP00000502586.1"
}
]
}
},
{
"isoform_ac": "A0A6Q8PHB6-1",
"url": "",
"sequence": {
"sequence": "MKSCGVSLATAAAAAAAFGDEEKKMAAGKASGESEEASPSLTAEEREALGGLDSRLFGFVRFHEDGARTKALLGKAVRCYESLILKAEGKVESDFFCQLGHFNLLLEDYPKALSAYQRYYSLQSDYWKMRNPWIQRAHCIPLDQYTTNAAFLYGLGLVYFHYNAFQWAIKAFQEVLYVDPSFCRAKEIHLRLGLMFKVNTDYESSLKHFQLALVDCNPCTLSNAEIQFHIAHLYETQRKYHSAKEAYEQLLQTENLSAQVKATVLQQLGWMHHTVDLLGDKATKESYAIQYLQKSLEADPNSGQSWYFLGRCYSSIGKVQDAFISYRQSIDKSEASADTWCSIGVLYQQQNQPMDALQAYICAVQLDHGHAAAWMDLGTLYESCNQPQDAIKCYLNATRSKSCSNTSALAARIKYLQACKPHHPNTEPVLGLSQTPISQQSLPLHMIPSSQVDDLSSPAKRKRTSSPTKNTSDNWSGGHAVSHPPVQQQAHSWCLTPQKLQHLEQLRANRNNLNPAQKLMLEQLESQFVLMQQHQMRPTGVAQVRSTGIPNGPTADSSLPTNSVSGQQPQLALTRVPSVSQPGVRPACPGQPLANGPFSAGHVPCSTSRTLGSTDTILIGNNHITGSGSNGNVPYLQRNALTLPHNRTNLTSSAEEPWKNQLSNSTQGLHKGQSSHSAGPNGERPLSSTGPSQHLQAAGSGIQNQNGHPTLPSNSVTQGAALNHLSSHTATSGGQQGITLTKESKPSGNILTVPETSRHTGETPNSTASVEGLPNHVHQMTADAVCSPSHGDSKSPGLLSSDNPQLSALLMGKANNNVGTGTCDKVNNIHPAVHTKTDNSVASSPSSAISTATPSPKSTEQTTTNSVTSLNSPHSGLHTINGEGMEESQSPMKTDLLLVNHKPSPQIIPSMSVSIYPSSAEVLKACRNLGKNGLSNSSILLDKCPPPRPPSSPYPPLPKDKLNPPTPSIYLENKRDAFFPPLHQFCTNPNNPVTVIRGLAGALKLDLGLFSTKTLVEANNEHMVEVRTQLLQPADENWDPTGTKKIWHCESNRSHTTIAKYAQYQASSFQESLREENEKRSHHKDHSDSESTSSDNSGRRRKGPFKTIKFGTNIDLSDDKKWKLQLHELTKLPAFVRVVSAGNLLSHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFVVPEGYWGVLNDFCEKNNLNFLMGSWWPNLEDLYEANVPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNIAWNVGPLTACQYKLAVERYEWNKLQSVKSIVPMVHLSWNMARNIKVSDPKLFEMIKYCLLRTLKQCQTLREALIAAGKEIIWHGRTKEEPAHYCSICEVEVFDLLFVTNESNSRKTYIVHCQDCARKTSGNLENFVVLEQYKMEDLMQVYDQFTLAPPLPSASS",
"length": 1427,
"header": "tr|A0A6Q8PHB6-1|KDM6A_HUMAN Computationally mapped isoform of Lysine-specific demethylase 6A OS=Homo sapiens OX=9606 GN=KDM6A PE=1 SV=1 CANONICAL=O15550-1"
},
"locus": {
"chromosome": "X",
"start_pos": 45111408,
"end_pos": 44873552,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000674586.1",
"url": "https://www.ensembl.org/id/ENST00000674586.1"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000502660.1",
"url": "https://www.ensembl.org/id/ENSP00000502660.1"
}
]
}
},
{
"isoform_ac": "A0A6Q8PHJ0-1",
"url": "",
"sequence": {
"sequence": "MKSCGVSLATAAAAAAAFGDEEKKMAAGKASGESEEASPSLTAEEREALGGLDSRLFGFVRFHEDGARTKALLGKAVRCYESLILKAEGKVESDFFCQLGHFNLLLEDYPKALSAYQRYYSLQSDYWKNAAFLYGLGLVYFHYNAFQWAIKAFQEVLYVDPSFCRAKEIHLRLGLMFKVNTDYESSLKHFQLALVDCNPCTLSNAEIQFHIAHLYETQRKYHSAKEAYEQLLQTENLSAQVKATVLQQLGWMHHTVDLLGDKATKESYAIQYLQKSLEADPNSGQSWYFLGRCYSSIGKVQDAFISYRQSIDKSEASADTWCSIGVLYQQQNQPMDALQAYICAVQLDHGHAAAWMDLGTLYESCNQPQDAIKCYLNATRSKSCSNTSALAARIKYLQAQLCNLPQGSLQNKTKLLPSIEEAWSLPIPAELTSRQGAMNTAQQNTSDNWSGGHAVSHPPVQQQAHSWCLTPQKLQHLEQLRANRNNLNPAQKLMLEQLESQFVLMQQHQMRPTGVAQVRSTGIPNGPTADSSLPTNSVSGQQPQLALTRVPSVSQPGVRPACPGQPLANGPFSAGHVPCSTSRTLGSTDTILIGNNHITGSGSNGNVPYLQRNALTLPHNRTNLTSSAEEPWKNQLSNSTQGLHKGQSSHSAGPNGERPLSSTGPSQHLQAAGSGIQNQNGHPTLPSNSVTQGAALNHLSSHTATSGGQQGITLTKESKPSGNILTVPETSRHTGETPNSTASVEGLPNHVHQMTADAVCSPSHGDSKSPGLLSSDNPQLSALLMGKANNNVGTGTCDKVNNIHPAVHTKTDNSVASSPSSAISTATPSPKSTEQTTTNSVTSLNSPHSGLHTINGEGMEESQSPMKTDLLLVNHKPSPQIIPSMSVSIYPSSAEVLKACRNLGKNGLSNSSILLDKCPPPRPPSSPYPPLPKDKLNPPTPSIYLENKRDAFFPPLHQFCTNPNNPVTVIRGLAGALKLDLGLFSTKTLVEANNEHMVEVRTQLLQPADENWDPTGTKKIWHCESNRSHTTIAKYAQYQASSFQESLREENEKRSHHKDHSDSESTSSDNSGRRRKGPFKTIKFGTNIDLSDDKNRKSSKPCWSYHIGHEHSSTIHESSREQNTRSSGK",
"length": 1129,
"header": "tr|A0A6Q8PHJ0-1|A0A6Q8PHJ0_HUMAN Computationally mapped isoform of [histone H3]-trimethyl-L-lysine(27) demethylase OS=Homo sapiens OX=9606 GN=KDM6A PE=1 SV=1 CANONICAL=O15550-1"
},
"locus": {
"chromosome": "X",
"start_pos": 45085877,
"end_pos": 44873552,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000675514.1",
"url": "https://www.ensembl.org/id/ENST00000675514.1"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000502759.1",
"url": "https://www.ensembl.org/id/ENSP00000502759.1"
}
]
}
},
{
"isoform_ac": "A0A804HIZ7-1",
"url": "",
"sequence": {
"sequence": "MKSCGVSLATAAAAAAAFGDEEKKMAAGKASGESEEASPSLTAEEREALGGLDSRLFGFVRFHEDGARTKALLGKHYLHTRGTTVYSLTTGRMLPFYMVLVWSTSIIMHFSGQLKHFRRCFMLIPAFVEPRKFIYDLGLCSK",
"length": 142,
"header": "tr|A0A804HIZ7-1|A0A804HIZ7_HUMAN Computationally mapped isoform of Lysine demethylase 6A OS=Homo sapiens OX=9606 GN=KDM6A PE=1 SV=1 CANONICAL=O15550-1"
},
"locus": {
"chromosome": "X",
"start_pos": 45020701,
"end_pos": 44873552,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000683425.1",
"url": "https://www.ensembl.org/id/ENST00000683425.1"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000507291.1",
"url": "https://www.ensembl.org/id/ENSP00000507291.1"
}
]
}
},
{
"isoform_ac": "A0A804HJA2-1",
"url": "",
"sequence": {
"sequence": "MKSCGVSLATAAAAAAAFGDEEKKMAAGKASGESEEASPSLTAEEREALGGLDSRLFGFVRFHEDGARTKALLGKAVRCYESLILKAEGKVESDFFCQLGHFNLLLEDYPKALSAYQRYYSLQSDYWKNAAFLYGLGLVYFHYNAFQWAIKAFQEVLYVDPSFCRAKEIHLRLGLMFKVNTDYESSLKHFQLALVDCNPCTLSNAEIQFHIAHLYETQRKYHSAKEAYEQLLQTENLSAQVKATVLQQLGWMHHTVDLLGDKATKESYAIQYLQKSLEADPNSGQSWYFLGRCYSSIGKVQDAFISYRQSIDKSEASADTWCSIGVLYQQQNQPMDALQAYICAVQLDHGHAAAWMDLGTLYESCNQPQDAIKCYLNATRSKSCSNTSALAARIKYLQACKPHHPNTEPVLGLSQTPISQQSLPLHMIPSSQVDDLSSPAKRKRTSSPTKNTSDNWSGGHAVSHPPVQQQAHSWCLTPQKLQMRPTGVAQVRSTGIPNGPTADSSLPTNSVSGQQPQLALTRVPSVSQPGVRPACPGQPLANGPFSAGHVPCSTSRTLGSTDTILIGNNHITGSGSNGNVPYLQRNALTLPHNRTNLTSSAEEPWKNQLSNSTQGLHKGQSSHSAGPNGERPLSSTGPSQHLQAAGSGIQNQNGHPTLPSNSVTQGAALNHLSSHTATSGGQQGITLTKESKPSGNILTVPETSRHTGETPNSTASVEGLPNHVHQMTADAVCSPSHGDSKSPGLLSSDNPQLSALLMGKANNNVGTGTCDKVNNIHPAVHTKTDNSVASSPSSAISTATPSPKSTEQTTTNSVTSLNSPHSGLHTINGEGMEESQSPMKTDLLLVNHKPSPQIIPSMSVSIYPSSAEVLKACRNLGKNGLSNSSILLDKCPPPRPPSSPYPPLPKDKLNPPTPSIYLENKRDAFFPPLHQFCTNPNNPVTVIRGLAGALKLDLGLFSTKTLVEANNEHMVEVRTQLLQPADENWDPTGTKKIWHCESNRSHTTIAKYAQYQASSFQESLREENEKRSHHKDHSDSESTSSDNSGRRRKGPFKTIKFGTNIDLSDDKKWKLQLHELTKLPAFVRVVSAGNLLSHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFVVPEGYWGVLNDFCEKNNLNFLMGSWWPNLEDLYEANVPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNIAWNVGPLTACQYKLAVERYEWNKLQSVKSIVPMVHLSWNMARNIKVSDPKLFEMIKYCLLRTLKQCQTLREALIAAGKEIIWHGRTKEEPAHYCSICEVEVFDLLFVTNESNSRKTYIVHCQDCARKTSGNLENFVVLEQYKMEDLMQVYDQFTLAPPLPSASS",
"length": 1374,
"header": "tr|A0A804HJA2-1|A0A804HJA2_HUMAN Computationally mapped isoform of [histone H3]-trimethyl-L-lysine(27) demethylase OS=Homo sapiens OX=9606 GN=KDM6A PE=1 SV=1 CANONICAL=O15550-1"
},
"locus": {
"chromosome": "X",
"start_pos": 45111408,
"end_pos": 44873552,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000683021.1",
"url": "https://www.ensembl.org/id/ENST00000683021.1"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000507416.1",
"url": "https://www.ensembl.org/id/ENSP00000507416.1"
}
]
}
},
{
"isoform_ac": "A0A804HLJ3-1",
"url": "",
"sequence": {
"sequence": "MKSCGVSLATAAAAAAAFGDEEKKMAAGKASGESEEASPSLTAEEREALGGLDSRLFGFVRFHEDGARTKALLGKAVRCYESLILKAEGKVESDFFCQLGHFNLLLEDYPKALSAYQRYYSLQSDYWKNAAFLYGLGLVYFHYNAFQWAIKAFQEVLYVDPSFCRAKEIHLRLGLMFKVNTDYESSLKHFQLALVDCNPCTLSNAEIQFHIAHLYETQRKYHSAKEAYEQLLQTENLSAQVKATVLQQLGWMHHTVDLLGDKATKESYAIQYLQKSLEADPNSGQSWYFLGRCYSSIGKVQDAFISYRQSIDKSEASADTWCSIGVLYQQQNQPMDALQAYICAVQLDHGHAAAWMDLGTLYESCNQPQDAIKCYLNATRSKSCSNTSALAARIKYLQACKPHHPNTEPVLGLSQTPISQQSLPLHMIPSSQVDDLSSPAKRKRTSSPTKNTSDNWSGGHAVSHPPVQQQAHSWCLTPQKLQHLEQLRANRNNLNPAQKLMLEQLESQFVLMQQHQMRPTGVAQVRSTGIPNGPTADSSLPTNSVSGQQPQLALTRVPSVSQPGVRPACPGQPLANGPFSAGHVPCSTSRTLGSTDTILIGNNHITGSGSNGNVPYLQRNALTLPHNRTNLTSSAEEPWKNQLSNSTQGLHKGQSSHSAGPNGERPLSSTGPSQHLQAAGSGIQNQNGHPTLPSNSVTQGAALNHLSSHTATSGGQQGITLTKESKPSGNILTVPETSRHTGETPNSTASVEGLPNHVHQMTADAVCSPSHGDSKSPGLLSSDNPQLSALLMGKANNNPFQQQHLLQNPLSRQPQTVLPALTALTVGYTQLMEKGWKNLRAP",
"length": 842,
"header": "tr|A0A804HLJ3-1|KDM6A_HUMAN Computationally mapped isoform of Lysine-specific demethylase 6A OS=Homo sapiens OX=9606 GN=KDM6A PE=1 SV=1 CANONICAL=O15550-1"
},
"locus": {
"chromosome": "X",
"start_pos": 45070251,
"end_pos": 44873552,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000684352.1",
"url": "https://www.ensembl.org/id/ENST00000684352.1"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000508379.1",
"url": "https://www.ensembl.org/id/ENSP00000508379.1"
}
]
}
},
{
"isoform_ac": "F5H5V6-1",
"url": "",
"sequence": {
"sequence": "MKSCGVSLATAAAAAAAFGDEEKKMAAGKASGESEEASPSLTAEEREALGGLDSRLFGFVRFHEDGARTKALLGKAVRCYESLILKAEGKVESDFFCQLGHFNLLLEDYPKALSAYQRYYSLQSDYWKNAAFLYGLGLVYFHYNAFQWAIKAFQEVLYVDPSFCRAKEIHLRLGLMFKVNTDYESSLKHFQLALVDCNPCTLSNAEIQFHIAHLYETQRKYHSAKEAYEQLLQTENLSAQVKATVLQQLGWMHHTVDLLGDKATKESYAIQYLQKSLEADPNSGQSWYFLGRCYSSIGKVQDAFISYRQSIDKSEASADTWCSIGVLYQQQNQPMDALQAYICAVQLDHGHAAAWMDLGTLYESCNQPQDAIKCYLNATRSKSCSNTSALAARIKYLQNTSDNWSGGHAVSHPPVQQQAHSWCLTPQKLQMRPTGVAQVRSTGIPNGPTADSSLPTNSVSGQQPQLALTRVPSVSQPGVRPACPGQPLANGPFSAGHVPCSTSRTLGSTDTILIGNNHITGSGSNGNVPYLQRNALTLPHNRTNLTSSAEEPWKNQLSNSTQGLHKGQSSHSAGPNGERPLSSTGPSQHLQAAGSGIQNQNGHPTLPSNSVTQGAALNHLSSHTATSGGQQGITLTKESKPSGNILTVPETSRHTGETPNSTASVEGLPNHVHQMTADAVCSPSHGDSKSPGLLSSDNPQLSALLMGKANNNVGTGTCDKVNNIHPAVHTKTDNSVASSPSSAISTATPSPKSTEQTTTNSVTSLNSPHSGLHTINGEGMEESQSPMKTDLLLVNHKPSPQIIPSMSVSIYPSSAEVLKACRNLGKNGLSNSSILLDKCPPPRPPSSPYPPLPKDKLNPPTPSIYLENKRDAFFPPLHQFCTNPNNPVTVIRGLAGALKLDLGLFSTKTLVEANNEHMVEVRTQLLQPADENWDPTGTKKIWHCESNRSHTTIAKYAQYQASSFQESLREENEKRSHHKDHSDSESTSSDNSGRRRKGPFKTIKFGTNIDLSDDKKWKLQLHELTKLPAFVRVVSAGNLLSHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFVVPEGYWGVLNDFCEKNNLNFLMGSWWPNLEDLYEANVPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNIAWNVGPLTACQYKLAVERYEWNKLQSVKSIVPMVHLSWNMARNIKVSDPKLFEMIKYCLLRTLKQCQTLREALIAAGKEIIWHGRTKEEPAHYCSICEVEVFDLLFVTNESNSRKTYIVHCQDCARKTSGNLENFVVLEQYKMEDLMQVYDQFTLAPPLPSASS",
"length": 1322,
"header": "tr|F5H5V6-1|F5H5V6_HUMAN Computationally mapped isoform of [histone H3]-trimethyl-L-lysine(27) demethylase OS=Homo sapiens OX=9606 GN=KDM6A PE=1 SV=3 CANONICAL=O15550-1"
},
"locus": {
"chromosome": "X",
"start_pos": 45111408,
"end_pos": 44873552,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000543216.6",
"url": "https://www.ensembl.org/id/ENST00000543216.6"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000443078.3",
"url": "https://www.ensembl.org/id/ENSP00000443078.3"
}
]
}
},
{
"isoform_ac": "F5H6S1-1",
"url": "",
"sequence": {
"sequence": "MKSCGVSLATAAAAAAAFGDEEKKMAAGKASGESEEASPSLTAEEREALGGLDSRLFGFVRFHEDGARTKALLGKAVRCYESLILKAEGKVESDFFCQLGHFNLLLEDYPKALSAYQRYYSLQSDYWKNAAFLYGLGLVYFHYNAFQWAIKAFQEVLYVDPSFCRAKEIHLRLGLMFKVNTDYESSLKHFQLALVDCNPCTLSNAEIQFHIAHLYETQRKYHSAKEAYEQLLQTENLSAQVKATVLQQLGWMHHTVDLLGDKATKESYAIQYLQKSLEADPNSGQSWYFLGRCYSSIGKVQDAFISYRQSIDKSEASADTWCSIGVLYQQQNQPMDALQAYICAVQLDHGHAAAWMDLGTLYESCNQPQDAIKCYLNATRSKSCSNTSALAARIKYLQNTSDNWSGGHAVSHPPVQQQAHSWCLTPQKLQHLEQLRANRNNLNPAQKLMLEQLESQFVLMQQHQMRPTGVAQVRSTGIPNGPTADSSLPTNSVSGQQPQLALTRVPSVSQPGVRPACPGQPLANGPFSAGHVPCSTSRTLGSTDTILIGNNHITGSGSNGNVPYLQRNALTLPHNRTNLTSSAEEPWKNQLSNSTQGLHKGQSSHSAGPNGERPLSSTGPSQHLQAAGSGIQNQNGHPTLPSNSVTQGAALNHLSSHTATSGGQQGITLTKESKPSGNILTVPETSRHTGETPNSTASVEGLPNHVHQMTADAVCSPSHGDSKSPGLLSSDNPQLSALLMGKANNNVGTGTCDKVNNIHPAVHTKTDNSVASSPSSAISTATPSPKSTEQTTTNSVTSLNSPHSGLHTINGEGMEESQSPMKTDLLLVNHKPSPQIIPSMSVSIYPSSAEVLKACRNLGKNGLSNSSILLDKCPPPRPPSSPYPPLPKDKLNPPTPSIYLENKRDAFFPPLHQFCTNPNNPVTVIRGLAGALKLDLGLFSTKTLVEANNEHMVEVRTQLLQPADENWDPTGTKKIWHCESNRSHTTIAKYAQYQASSFQESLREENEKRSHHKDHSDSESTSSDNSGRRRKGPFKTIKFGTNIDLSDDKKWKLQLHELTKLPAFVRVVSAGNLLSHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFVVPEGYWGVLNDFCEKNNLNFLMGSWWPNLEDLYEANVPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNIAWNVGPLTACQYKLAVERYEWNKLQSVKSIVPMVHLSWNMARNIKVSDPKLFEMIKYCLLRTLKQCQTLREALIAAGKEIIWHGRTKEEPAHYCSICEVEVFDLLFVTNESNSRKTYIVHCQDCARKTSGNLENFVVLEQYKMEDLMQVYDQFTLAPPLPSASS",
"length": 1356,
"header": "tr|F5H6S1-1|F5H6S1_HUMAN Computationally mapped isoform of [histone H3]-trimethyl-L-lysine(27) demethylase OS=Homo sapiens OX=9606 GN=KDM6A PE=1 SV=3 CANONICAL=O15550-1"
},
"locus": {
"chromosome": "X",
"start_pos": 45111408,
"end_pos": 44873552,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000536777.6",
"url": "https://www.ensembl.org/id/ENST00000536777.6"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000437405.3",
"url": "https://www.ensembl.org/id/ENSP00000437405.3"
}
]
}
},
{
"isoform_ac": "F8W8R6-1",
"url": "",
"sequence": {
"sequence": "MKSCGVSLATAAAAAAAFGDEEKKMAAGKASGESEEASPSLTAEEREALGGLDSRLFGFVRFHEDGARTKALLGKAVRCYESLILKAEGKVESDFFCQLGHFNLLLEDYPKALSAYQRYYSLQSDYWKNAAFLYGLGLVYFHYNAFQWAIKAFQEVLYVDPSFCRAKEIHLRLGLMFKVNTDYESSLKHFQLALVDCNPCTLSNAEIQFHIAHLYETQRKYHSAKEAYEQLLQTENLSAQVKATVLQQLGWMHHTVDLLGDKATKESYAIQYLQKSLEADPNSGQSWYFLGRCYSSIGKVQDAFISYRQSIDKSEASADTWCSIGVLYQQQNQPMDALQAYICAVQLDHGHAAAWMDLGTLYESCNQPQDAIKCYLNATRSKSCSNTSALAARIKYLQACKPHHPNTEPVLGLSQTPISQQSLPLHMIPSSQVDDLSSPAKRKRTSSPTKNTSDNWSGGHAVSHPPVQQQAHSWCLTPQKLQHLEQLRANRNNLNPAQKLMLEQLESQFVLMQQHQMRPTGVAQVRSTGIPNGPTADSSLPTNSVSGQQPQLALTRVPSVSQPGVRPACPGQPLANGPFSAGHVPCSTSRTLGSTDTILIGNNHITGSGSNGNVPYLQRNALTLPHNRTNLTSSAEEPWKNQLSNSTQGLHKGQSSHSAGPNGERPLSSTGPSQHLQAAGSGIQNQNGHPTLPSNSVTQGAALNHLSSHTATSGGQQGITLTKESKPSGNILTVPETSRHTGETPNSTASVEGLPNHVHQMTADAVCSPSHGDSKSPGLLSSDNPQLSALLMGKANNNVGTGTCDKVNNIHPAVHTKTDNSVASSPSSAISTATPSPKSTEQTTTNSVTSLNSPHSGLHTINGEGMEESQSPMKTDLLLVNHKPSPQIIPSMSVSIYPSSAEVLKACRNLGKNGLSNSSILLDKCPPPRPPSSPYPPLPKDKLNPPTPSIYLENKRDAFFPPLHQFCTNPNNPVTVIRGLAGALKLDLGLFSTKTLVEANNEHMVEVRTQLLQPADENWDPTGTKKIWHCESNRSHTTIAKYAQYQASSFQESLREENEKRSHHKDHSDSESTSSDNSGRRRKGPFKTIKFGTNIDLSDDKKWKLQLHELTKLPAFVRVVSAGNLLSHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFVVPEGYWGVLNDFCEKNNLNFLMGSWWPNLEDLYEANVPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNIAWNVGPLTACQYKLAVERYEWNKLQSVKSIVPMVHLSWNMARNIKVSDPKLFEMIKYCLLRTLKQCQTLREALIAAGKEIIWHGRTKEEPAHYCSICEVEVFDLLFVTNESNSRKTYIVHCQDCARKTSGNLENFVVLEQYKMEDLMQVYDQFTLAPPLPSASS",
"length": 1408,
"header": "tr|F8W8R6-1|F8W8R6_HUMAN Computationally mapped isoform of [histone H3]-trimethyl-L-lysine(27) demethylase OS=Homo sapiens OX=9606 GN=KDM6A PE=1 SV=3 CANONICAL=O15550-1"
},
"locus": {
"chromosome": "X",
"start_pos": 45111408,
"end_pos": 44873552,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000382899.9",
"url": "https://www.ensembl.org/id/ENST00000382899.9"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000372355.6",
"url": "https://www.ensembl.org/id/ENSP00000372355.6"
}
]
}
},
{
"isoform_ac": "H0Y6V5-1",
"url": "",
"sequence": {
"sequence": "XARNIKVSDPKLFEMIKIFSLSPNFRAEKCLRDHLVQPLRSNGEPEPLRFTGEYCLLRTLKQCQTLREALIAAGKEIIWHGRTKEEPAHYCSICEVEVFDLLFVTNESNSRKTYIVHCQDCARKTSGNLENFVVLEQYKMEDLMQVYDQFTLAPPLPSASS",
"length": 161,
"header": "tr|H0Y6V5-1|H0Y6V5_HUMAN Computationally mapped isoform of [histone H3]-trimethyl-L-lysine(27) demethylase OS=Homo sapiens OX=9606 GN=KDM6A PE=1 SV=1 CANONICAL=O15550-1"
},
"locus": {
"chromosome": "X",
"start_pos": 45111410,
"end_pos": 45090817,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000431196.3",
"url": "https://www.ensembl.org/id/ENST00000431196.3"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000408230.1",
"url": "https://www.ensembl.org/id/ENSP00000408230.1"
}
]
}
},
{
"isoform_ac": "O15550-1",
"url": "",
"sequence": {
"sequence": "MKSCGVSLATAAAAAAAFGDEEKKMAAGKASGESEEASPSLTAEEREALGGLDSRLFGFVRFHEDGARTKALLGKAVRCYESLILKAEGKVESDFFCQLGHFNLLLEDYPKALSAYQRYYSLQSDYWKNAAFLYGLGLVYFHYNAFQWAIKAFQEVLYVDPSFCRAKEIHLRLGLMFKVNTDYESSLKHFQLALVDCNPCTLSNAEIQFHIAHLYETQRKYHSAKEAYEQLLQTENLSAQVKATVLQQLGWMHHTVDLLGDKATKESYAIQYLQKSLEADPNSGQSWYFLGRCYSSIGKVQDAFISYRQSIDKSEASADTWCSIGVLYQQQNQPMDALQAYICAVQLDHGHAAAWMDLGTLYESCNQPQDAIKCYLNATRSKSCSNTSALAARIKYLQAQLCNLPQGSLQNKTKLLPSIEEAWSLPIPAELTSRQGAMNTAQQNTSDNWSGGHAVSHPPVQQQAHSWCLTPQKLQHLEQLRANRNNLNPAQKLMLEQLESQFVLMQQHQMRPTGVAQVRSTGIPNGPTADSSLPTNSVSGQQPQLALTRVPSVSQPGVRPACPGQPLANGPFSAGHVPCSTSRTLGSTDTILIGNNHITGSGSNGNVPYLQRNALTLPHNRTNLTSSAEEPWKNQLSNSTQGLHKGQSSHSAGPNGERPLSSTGPSQHLQAAGSGIQNQNGHPTLPSNSVTQGAALNHLSSHTATSGGQQGITLTKESKPSGNILTVPETSRHTGETPNSTASVEGLPNHVHQMTADAVCSPSHGDSKSPGLLSSDNPQLSALLMGKANNNVGTGTCDKVNNIHPAVHTKTDNSVASSPSSAISTATPSPKSTEQTTTNSVTSLNSPHSGLHTINGEGMEESQSPMKTDLLLVNHKPSPQIIPSMSVSIYPSSAEVLKACRNLGKNGLSNSSILLDKCPPPRPPSSPYPPLPKDKLNPPTPSIYLENKRDAFFPPLHQFCTNPNNPVTVIRGLAGALKLDLGLFSTKTLVEANNEHMVEVRTQLLQPADENWDPTGTKKIWHCESNRSHTTIAKYAQYQASSFQESLREENEKRSHHKDHSDSESTSSDNSGRRRKGPFKTIKFGTNIDLSDDKKWKLQLHELTKLPAFVRVVSAGNLLSHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFVVPEGYWGVLNDFCEKNNLNFLMGSWWPNLEDLYEANVPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNIAWNVGPLTACQYKLAVERYEWNKLQSVKSIVPMVHLSWNMARNIKVSDPKLFEMIKYCLLRTLKQCQTLREALIAAGKEIIWHGRTKEEPAHYCSICEVEVFDLLFVTNESNSRKTYIVHCQDCARKTSGNLENFVVLEQYKMEDLMQVYDQFTLAPPLPSASS",
"length": 1401,
"header": "sp|O15550-1|KDM6A_HUMAN Isoform 1 of Lysine-specific demethylase 6A OS=Homo sapiens OX=9606 GN=KDM6A PE=1 SV=2 CANONICAL=O15550-1"
},
"locus": {
"chromosome": "X",
"start_pos": 45111408,
"end_pos": 44873552,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000377967.9",
"url": "https://www.ensembl.org/id/ENST00000377967.9"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000367203.4",
"url": "https://www.ensembl.org/id/ENSP00000367203.4"
}
]
}
}
],
"glycosylation": [
{
"glytoucan_ac": "G49108TO",
"type": "O-linked",
"subtype": "O-GlcNAcylation",
"site_category": "reported_with_glycan",
"site_seq": "T",
"relation": "attached",
"comment": "O-GlcNAcylation",
"start_pos": 181,
"start_aa": "Thr",
"end_pos": 181,
"end_aa": "Thr",
"residue": "Thr",
"site_lbl": "Thr181",
"evidence": [
{
"id": "O15550",
"database": "O-GlcNAc Atlas",
"url": "https://oglcnac.org/atlas/detail/O15550"
},
{
"id": "30620550",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/30620550"
}
]
},
{
"glytoucan_ac": "G49108TO",
"type": "O-linked",
"subtype": "O-GlcNAcylation",
"site_category": "reported_with_glycan",
"site_seq": "T",
"relation": "attached",
"comment": "O-GlcNAcylation",
"start_pos": 622,
"start_aa": "Thr",
"end_pos": 622,
"end_aa": "Thr",
"residue": "Thr",
"site_lbl": "Thr622",
"evidence": [
{
"id": "O15550",
"database": "O-GlcNAc Atlas",
"url": "https://oglcnac.org/atlas/detail/O15550"
},
{
"id": "34846842",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/34846842"
}
]
},
{
"glytoucan_ac": "G49108TO",
"type": "O-linked",
"subtype": "O-GlcNAcylation",
"site_category": "reported_with_glycan",
"site_seq": "T",
"relation": "attached",
"comment": "O-GlcNAcylation",
"start_pos": 625,
"start_aa": "Thr",
"end_pos": 625,
"end_aa": "Thr",
"residue": "Thr",
"site_lbl": "Thr625",
"evidence": [
{
"id": "O15550",
"database": "O-GlcNAc Database",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=O15550"
},
{
"id": "23301498",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/23301498"
},
{
"id": "35132862",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/35132862"
},
{
"id": "30059200",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/30059200"
},
{
"id": "37217939",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/37217939"
},
{
"id": "34019948",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/34019948"
},
{
"id": "35254053",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/35254053"
},
{
"id": "29237092",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/29237092"
}
]
},
{
"glytoucan_ac": "G49108TO",
"type": "O-linked",
"subtype": "O-GlcNAcylation",
"site_category": "reported_with_glycan",
"site_seq": "S",
"relation": "attached",
"comment": "O-GlcNAcylation",
"start_pos": 626,
"start_aa": "Ser",
"end_pos": 626,
"end_aa": "Ser",
"residue": "Ser",
"site_lbl": "Ser626",
"evidence": [
{
"id": "O15550",
"database": "O-GlcNAc Database",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=O15550"
},
{
"id": "23301498",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/23301498"
},
{
"id": "35132862",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/35132862"
},
{
"id": "30059200",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/30059200"
},
{
"id": "37217939",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/37217939"
},
{
"id": "34019948",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/34019948"
},
{
"id": "35254053",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/35254053"
},
{
"id": "29237092",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/29237092"
},
{
"id": "O15550",
"database": "O-GlcNAc Atlas",
"url": "https://oglcnac.org/atlas/detail/O15550"
},
{
"id": "30620550",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/30620550"
}
]
},
{
"glytoucan_ac": "G49108TO",
"type": "O-linked",
"subtype": "O-GlcNAcylation",
"site_category": "reported_with_glycan",
"site_seq": "S",
"relation": "attached",
"comment": "O-GlcNAcylation",
"start_pos": 731,
"start_aa": "Ser",
"end_pos": 731,
"end_aa": "Ser",
"residue": "Ser",
"site_lbl": "Ser731",
"evidence": [
{
"id": "O15550",
"database": "O-GlcNAc Database",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=O15550"
},
{
"id": "23301498",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/23301498"
},
{
"id": "35132862",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/35132862"
},
{
"id": "30059200",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/30059200"
},
{
"id": "37217939",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/37217939"
},
{
"id": "34019948",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/34019948"
},
{
"id": "35254053",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/35254053"
},
{
"id": "29237092",
"database": "PubMed",
"url": "https://glygen.org/publication/PubMed/29237092"
},
{
"id": "O15550",
"database": "O-GlcNAc Atlas",
"url": "https://oglcnac.org/atlas/detail/O15550"
}
]
}
],
"phosphorylation": [
{
"start_pos": 1091,
"end_pos": 1091,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "O15550",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15550"
},
{
"database": "PubMed",
"id": "20068231",
"url": "https://glygen.org/publication/PubMed/20068231"
}
],
"site_lbl": "Ser1091"
},
{
"start_pos": 769,
"end_pos": 769,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "Phosphoserine",
"evidence": [
{
"database": "UniProtKB",
"id": "O15550",
"url": "https://www.uniprot.org/uniprot/O15550"
},
{
"database": "PubMed",
"id": "19690332",
"url": "https://glygen.org/publication/PubMed/19690332"
},
{
"database": "iPTMnet",
"id": "O15550",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15550"
},
{
"database": "PubMed",
"id": "18452278",
"url": "https://glygen.org/publication/PubMed/18452278"
}
],
"site_lbl": "Ser769"
},
{
"start_pos": 818,
"end_pos": 818,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "O15550",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15550"
},
{
"database": "PubMed",
"id": "15302935",
"url": "https://glygen.org/publication/PubMed/15302935"
},
{
"database": "PubMed",
"id": "15345747",
"url": "https://glygen.org/publication/PubMed/15345747"
},
{
"database": "PubMed",
"id": "19413330",
"url": "https://glygen.org/publication/PubMed/19413330"
},
{
"database": "phospho.ELM",
"id": "O15550",
"url": "http://phospho.elm.eu.org/byAccession/O15550.html"
}
],
"site_lbl": "Ser818"
},
{
"start_pos": 827,
"end_pos": 827,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Thr",
"comment": "Phosphothreonine",
"evidence": [
{
"database": "UniProtKB",
"id": "O15550",
"url": "https://www.uniprot.org/uniprot/O15550"
},
{
"database": "iPTMnet",
"id": "O15550",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15550"
},
{
"database": "PubMed",
"id": "19413330",
"url": "https://glygen.org/publication/PubMed/19413330"
}
],
"site_lbl": "Thr827"
},
{
"start_pos": 829,
"end_pos": 829,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "Phosphoserine",
"evidence": [
{
"database": "UniProtKB",
"id": "O15550",
"url": "https://www.uniprot.org/uniprot/O15550"
},
{
"database": "PubMed",
"id": "23186163",
"url": "https://glygen.org/publication/PubMed/23186163"
},
{
"database": "PubMed",
"id": "19690332",
"url": "https://glygen.org/publication/PubMed/19690332"
},
{
"database": "iPTMnet",
"id": "O15550",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15550"
},
{
"database": "PubMed",
"id": "15345747",
"url": "https://glygen.org/publication/PubMed/15345747"
},
{
"database": "PubMed",
"id": "18452278",
"url": "https://glygen.org/publication/PubMed/18452278"
},
{
"database": "PubMed",
"id": "19413330",
"url": "https://glygen.org/publication/PubMed/19413330"
}
],
"site_lbl": "Ser829"
}
],
"glycation": [],
"keywords": [
"enzyme",
"glycoprotein",
"glycoprotein_reported_with_glycan"
],
"publication": [
{
"title": "Recruitment of nuclear receptor corepressor and coactivator to the retinoic acid receptor by retinoid ligands. Influence of DNA-heterodimer interactions.",
"journal": "The Journal of biological chemistry",
"date": "2000",
"authors": "Klein ES, Wang JW, Khalifa B, Gavigan SA, Chandraratna RA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5617472",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472"
}
],
"reference": [
{
"type": "PubMed",
"id": "10777502",
"url": "https://glygen.org/publication/PubMed/10777502"
}
]
},
{
"title": "Leukemia proto-oncoprotein MLL is proteolytically processed into 2 fragments with opposite transcriptional properties.",
"journal": "Blood",
"date": "2002-11-15",
"authors": "Yokoyama Akihiko, Kitabayashi Issay, Ayton Paul M, Cleary Michael L, Ohki Misao",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "12393701",
"url": "https://glygen.org/publication/PubMed/12393701"
}
]
},
{
"title": "Proteolytic cleavage of MLL generates a complex of N- and C-terminal fragments that confers protein stability and subnuclear localization.",
"journal": "Molecular and cellular biology",
"date": "2003",
"authors": "Hsieh JJ, Ernst P, Erdjument-Bromage H, Tempst P, Korsmeyer SJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "12482972",
"url": "https://glygen.org/publication/PubMed/12482972"
}
]
},
{
"title": "Human Sin3 deacetylase and trithorax-related Set1/Ash2 histone H3-K4 methyltransferase are tethered together selectively by the cell-proliferation factor HCF-1.",
"journal": "Genes & development",
"date": "2003",
"authors": "Wysocka J, Myers MP, Laherty CD, Eisenman RN, Herr W",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "12670868",
"url": "https://glygen.org/publication/PubMed/12670868"
}
]
},
{
"title": "Taspase1: a threonine aspartase required for cleavage of MLL and proper HOX gene expression.",
"journal": "Cell",
"date": "2003",
"authors": "Hsieh JJ, Cheng EH, Korsmeyer SJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "14636557",
"url": "https://glygen.org/publication/PubMed/14636557"
}
]
},
{
"title": "Menin associates with a trithorax family histone methyltransferase complex and with the hoxc8 locus.",
"journal": "Molecular cell",
"date": "2004",
"authors": "Hughes CM, Rozenblatt-Rosen O, Milne TA, Copeland TD, Levine SS, Lee JC, Hayes DN, Shanmugam KS, Bhattacharjee A, Biondi CA, Kay GF, Hayward NK, Hess JL, Meyerson M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "14992727",
"url": "https://glygen.org/publication/PubMed/14992727"
}
]
},
{
"title": "Leukemia proto-oncoprotein MLL forms a SET1-like histone methyltransferase complex with menin to regulate Hox gene expression.",
"journal": "Molecular and cellular biology",
"date": "2004",
"authors": "Yokoyama A, Wang Z, Wysocka J, Sanyal M, Aufiero DJ, Kitabayashi I, Herr W, Cleary ML",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "15199122",
"url": "https://glygen.org/publication/PubMed/15199122"
}
]
},
{
"title": "Large-scale characterization of HeLa cell nuclear phosphoproteins.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2004",
"authors": "Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP",
"evidence": [
{
"database": "iPTMnet",
"id": "O15550",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15550"
}
],
"reference": [
{
"type": "PubMed",
"id": "15302935",
"url": "https://glygen.org/publication/PubMed/15302935"
}
]
},
{
"title": "Phosphoproteomic analysis of the developing mouse brain.",
"journal": "Molecular & cellular proteomics : MCP",
"date": "2004",
"authors": "Ballif BA, Villen J, Beausoleil SA, Schwartz D, Gygi SP",
"evidence": [
{
"database": "iPTMnet",
"id": "O15550",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15550"
}
],
"reference": [
{
"type": "PubMed",
"id": "15345747",
"url": "https://glygen.org/publication/PubMed/15345747"
}
]
},
{
"title": "Histone demethylation mediated by the nuclear amine oxidase homolog LSD1.",
"journal": "Cell",
"date": "2004",
"authors": "Shi Y, Lan F, Matson C, Mulligan P, Whetstine JR, Cole PA, Casero RA, Shi Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-3214842",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214842"
}
],
"reference": [
{
"type": "PubMed",
"id": "15620353",
"url": "https://glygen.org/publication/PubMed/15620353"
}
]
},
{
"title": "Expression of HOXB2, a retinoic acid signaling target in pancreatic cancer and pancreatic intraepithelial neoplasia.",
"journal": "Clinical cancer research : an official journal of the American Association for Cancer Research",
"date": "2005",
"authors": "Segara D, Biankin AV, Kench JG, Langusch CC, Dawson AC, Skalicky DA, Gotley DC, Coleman MJ, Sutherland RL, Henshall SM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5617472",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472"
}
],
"reference": [
{
"type": "PubMed",
"id": "15867264",
"url": "https://glygen.org/publication/PubMed/15867264"
}
]
},
{
"title": "HoxB2 binds mutant SOD1 and is altered in transgenic model of ALS.",
"journal": "Human molecular genetics",
"date": "2005",
"authors": "Zhai J, Lin H, Canete-Soler R, Schlaepfer WW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5617472",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472"
}
],
"reference": [
{
"type": "PubMed",
"id": "16079151",
"url": "https://glygen.org/publication/PubMed/16079151"
}
]
},
{
"title": "A human protein complex homologous to the Drosophila MSL complex is responsible for the majority of histone H4 acetylation at lysine 16.",
"journal": "Molecular and cellular biology",
"date": "2005",
"authors": "Smith ER, Cayrou C, Huang R, Lane WS, Cote J, Lucchesi JC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "16227571",
"url": "https://glygen.org/publication/PubMed/16227571"
}
]
},
{
"title": "The menin tumor suppressor protein is an essential oncogenic cofactor for MLL-associated leukemogenesis.",
"journal": "Cell",
"date": "2005-10-21",
"authors": "Yokoyama Akihiko, Somervaille Tim C P, Smith Kevin S, Rozenblatt-Rosen Orit, Meyerson Matthew, Cleary Michael L",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "16239140",
"url": "https://glygen.org/publication/PubMed/16239140"
}
]
},
{
"title": "Histone demethylation by a family of JmjC domain-containing proteins.",
"journal": "Nature",
"date": "2006",
"authors": "Tsukada Y, Fang J, Erdjument-Bromage H, Warren ME, Borchers CH, Tempst P, Zhang Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-3214842",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214842"
}
],
"reference": [
{
"type": "PubMed",
"id": "16362057",
"url": "https://glygen.org/publication/PubMed/16362057"
}
]
},
{
"title": "MicroRNA fingerprints during human megakaryocytopoiesis.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2006",
"authors": "Garzon R, Pichiorri F, Palumbo T, Iuliano R, Cimmino A, Aqeilan R, Volinia S, Bhatt D, Alder H, Marcucci G, Calin GA, Liu CG, Bloomfield CD, Andreeff M, Croce CM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5617472",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472"
}
],
"reference": [
{
"type": "PubMed",
"id": "16549775",
"url": "https://glygen.org/publication/PubMed/16549775"
}
]
},
{
"title": "JHDM2A, a JmjC-containing H3K9 demethylase, facilitates transcription activation by androgen receptor.",
"journal": "Cell",
"date": "2006",
"authors": "Yamane K, Toumazou C, Tsukada Y, Erdjument-Bromage H, Tempst P, Wong J, Zhang Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-3214842",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214842"
}
],
"reference": [
{
"type": "PubMed",
"id": "16603237",
"url": "https://glygen.org/publication/PubMed/16603237"
}
]
},
{
"title": "Reversal of histone lysine trimethylation by the JMJD2 family of histone demethylases.",
"journal": "Cell",
"date": "2006",
"authors": "Whetstine JR, Nottke A, Lan F, Huarte M, Smolikov S, Chen Z, Spooner E, Li E, Zhang G, Colaiacovo M, Shi Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-3214842",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214842"
}
],
"reference": [
{
"type": "PubMed",
"id": "16603238",
"url": "https://glygen.org/publication/PubMed/16603238"
}
]
},
{
"title": "The transcriptional repressor JHDM3A demethylates trimethyl histone H3 lysine 9 and lysine 36.",
"journal": "Nature",
"date": "2006",
"authors": "Klose RJ, Yamane K, Bae Y, Zhang D, Erdjument-Bromage H, Tempst P, Wong J, Zhang Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-3214842",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214842"
}
],
"reference": [
{
"type": "PubMed",
"id": "16732292",
"url": "https://glygen.org/publication/PubMed/16732292"
}
]
},
{
"title": "The putative oncogene GASC1 demethylates tri- and dimethylated lysine 9 on histone H3.",
"journal": "Nature",
"date": "2006",
"authors": "Cloos PA, Christensen J, Agger K, Maiolica A, Rappsilber J, Antal T, Hansen KH, Helin K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-3214842",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214842"
}
],
"reference": [
{
"type": "PubMed",
"id": "16732293",
"url": "https://glygen.org/publication/PubMed/16732293"
}
]
},
{
"title": "Jmjd2b antagonizes H3K9 trimethylation at pericentric heterochromatin in mammalian cells.",
"journal": "Genes & development",
"date": "2006",
"authors": "Fodor BD, Kubicek S, Yonezawa M, O'Sullivan RJ, Sengupta R, Perez-Burgos L, Opravil S, Mechtler K, Schotta G, Jenuwein T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-3214842",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214842"
}
],
"reference": [
{
"type": "PubMed",
"id": "16738407",
"url": "https://glygen.org/publication/PubMed/16738407"
}
]
},
{
"title": "Histone H3 recognition and presentation by the WDR5 module of the MLL1 complex.",
"journal": "Nature structural & molecular biology",
"date": "2006-08",
"authors": "Ruthenburg Alexander J, Wang Wooikoon, Graybosch Daina M, Li Haitao, Allis C David, Patel Dinshaw J, Verdine Gregory L",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "16829959",
"url": "https://glygen.org/publication/PubMed/16829959"
}
]
},
{
"title": "Regulation of MLL1 H3K4 methyltransferase activity by its core components.",
"journal": "Nature structural & molecular biology",
"date": "2006-08",
"authors": "Dou Yali, Milne Thomas A, Ruthenburg Alexander J, Lee Seunghee, Lee Jae Woon, Verdine Gregory L, Allis C David, Roeder Robert G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "16878130",
"url": "https://glygen.org/publication/PubMed/16878130"
}
]
},
{
"title": "Molecular regulation of H3K4 trimethylation by ASH2L, a shared subunit of MLL complexes.",
"journal": "Nature structural & molecular biology",
"date": "2006-09",
"authors": "Steward Melissa M, Lee Jung-Shin, O'Donovan Aisling, Wyatt Matt, Bernstein Bradley E, Shilatifard Ali",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "16892064",
"url": "https://glygen.org/publication/PubMed/16892064"
}
]
},
{
"title": "The consensus coding sequences of human breast and colorectal cancers.",
"journal": "Science (New York, N.Y.)",
"date": "2006",
"authors": "Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE",
"evidence": [
{
"database": "UniProtKB",
"id": "O15550",
"url": "https://www.uniprot.org/uniprot/O15550"
}
],
"reference": [
{
"type": "PubMed",
"id": "16959974",
"url": "https://glygen.org/publication/PubMed/16959974"
}
]
},
{
"title": "Noncoding RNA synthesis and loss of Polycomb group repression accompanies the colinear activation of the human HOXA cluster.",
"journal": "RNA (New York, N.Y.)",
"date": "2007",
"authors": "Sessa L, Breiling A, Lavorgna G, Silvestri L, Casari G, Orlando V",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5617472",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472"
}
],
"reference": [
{
"type": "PubMed",
"id": "17185360",
"url": "https://glygen.org/publication/PubMed/17185360"
}
]
},
{
"title": "Demethylation of trimethylated histone H3 Lys4 in vivo by JARID1 JmjC proteins.",
"journal": "Nature structural & molecular biology",
"date": "2007",
"authors": "Seward DJ, Cubberley G, Kim S, Schonewald M, Zhang L, Tripet B, Bentley DL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-3214842",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214842"
}
],
"reference": [
{
"type": "PubMed",
"id": "17310255",
"url": "https://glygen.org/publication/PubMed/17310255"
}
]
},
{
"title": "The X-linked mental retardation gene SMCX/JARID1C defines a family of histone H3 lysine 4 demethylases.",
"journal": "Cell",
"date": "2007",
"authors": "Iwase S, Lan F, Bayliss P, de la Torre-Ubieta L, Huarte M, Qi HH, Whetstine JR, Bonni A, Roberts TM, Shi Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9821002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9821002"
}
],
"reference": [
{
"type": "PubMed",
"id": "17320160",
"url": "https://glygen.org/publication/PubMed/17320160"
}
]
},
{
"title": "RBP2 belongs to a family of demethylases, specific for tri-and dimethylated lysine 4 on histone 3.",
"journal": "Cell",
"date": "2007-03-23",
"authors": "Christensen Jesper, Agger Karl, Cloos Paul A C, Pasini Diego, Rose Simon, Sennels Lau, Rappsilber Juri, Hansen Klaus H, Salcini Anna Elisabetta, Helin Kristian",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9821002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9821002"
}
],
"reference": [
{
"type": "PubMed",
"id": "17320161",
"url": "https://glygen.org/publication/PubMed/17320161"
}
]
},
{
"title": "The retinoblastoma binding protein RBP2 is an H3K4 demethylase.",
"journal": "Cell",
"date": "2007",
"authors": "Klose RJ, Yan Q, Tothova Z, Yamane K, Erdjument-Bromage H, Tempst P, Gilliland DG, Zhang Y, Kaelin WG Jr",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-3214842",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214842"
}
],
"reference": [
{
"type": "PubMed",
"id": "17320163",
"url": "https://glygen.org/publication/PubMed/17320163"
}
]
},
{
"title": "The trithorax-group protein Lid is a histone H3 trimethyl-Lys4 demethylase.",
"journal": "Nature structural & molecular biology",
"date": "2007",
"authors": "Lee N, Zhang J, Klose RJ, Erdjument-Bromage H, Tempst P, Jones RS, Zhang Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-3214842",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214842"
}
],
"reference": [
{
"type": "PubMed",
"id": "17351631",
"url": "https://glygen.org/publication/PubMed/17351631"
}
]
},
{
"title": "Identification and characterization of the human Set1B histone H3-Lys4 methyltransferase complex.",
"journal": "The Journal of biological chemistry",
"date": "2007-05-04",
"authors": "Lee Jeong-Heon, Tate Courtney M, You Jin-Sam, Skalnik David G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "17355966",
"url": "https://glygen.org/publication/PubMed/17355966"
}
]
},
{
"title": "PLU-1 is an H3K4 demethylase involved in transcriptional repression and breast cancer cell proliferation.",
"journal": "Molecular cell",
"date": "2007",
"authors": "Yamane K, Tateishi K, Klose RJ, Fang J, Fabrizio LA, Erdjument-Bromage H, Taylor-Papadimitriou J, Tempst P, Zhang Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9821002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9821002"
}
],
"reference": [
{
"type": "PubMed",
"id": "17363312",
"url": "https://glygen.org/publication/PubMed/17363312"
}
]
},
{
"title": "Overlapping roles of the methylated DNA-binding protein MBD1 and polycomb group proteins in transcriptional repression of HOXA genes and heterochromatin foci formation.",
"journal": "The Journal of biological chemistry",
"date": "2007",
"authors": "Sakamoto Y, Watanabe S, Ichimura T, Kawasuji M, Koseki H, Baba H, Nakao M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5617472",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472"
}
],
"reference": [
{
"type": "PubMed",
"id": "17428788",
"url": "https://glygen.org/publication/PubMed/17428788"
}
]
},
{
"title": "PTIP associates with MLL3- and MLL4-containing histone H3 lysine 4 methyltransferase complex.",
"journal": "J. Biol. Chem.",
"date": "2007",
"authors": "Cho YW, Hong T, Hong S, Guo H, Yu H, Kim D, Guszczynski T, Dressler GR, Copeland TD, Kalkum M, Ge K",
"evidence": [
{
"database": "UniProtKB",
"id": "O15550",
"url": "https://www.uniprot.org/uniprot/O15550"
},
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "17500065",
"url": "https://glygen.org/publication/PubMed/17500065"
}
]
},
{
"title": "HOX4 genes encode transcription factors with potential auto- and cross-regulatory capacities.",
"journal": "The EMBO journal",
"date": "1991",
"authors": "Zappavigna V, Renucci A, Izpisua-Belmonte JC, Urier G, Peschle C, Duboule D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5617472",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472"
}
],
"reference": [
{
"type": "PubMed",
"id": "1756725",
"url": "https://glygen.org/publication/PubMed/1756725"
}
]
},
{
"title": "E2F activation of S phase promoters via association with HCF-1 and the MLL family of histone H3K4 methyltransferases.",
"journal": "Molecular cell",
"date": "2007-07-06",
"authors": "Tyagi Shweta, Chabes Anna Lena, Wysocka Joanna, Herr Winship",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "17612494",
"url": "https://glygen.org/publication/PubMed/17612494"
}
]
},
{
"title": "DNA methylation regulates MicroRNA expression.",
"journal": "Cancer biology & therapy",
"date": "2007",
"authors": "Han L, Witmer PD, Casey E, Valle D, Sukumar S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5617472",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472"
}
],
"reference": [
{
"type": "PubMed",
"id": "17660710",
"url": "https://glygen.org/publication/PubMed/17660710"
}
]
},
{
"title": "Interaction of MLL amino terminal sequences with menin is required for transformation.",
"journal": "Cancer research",
"date": "2007-08-01",
"authors": "Caslini Corrado, Yang Zhaohai, El-Osta Mohamad, Milne Thomas A, Slany Robert K, Hess Jay L",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "17671196",
"url": "https://glygen.org/publication/PubMed/17671196"
}
]
},
{
"title": "UTX and JMJD3 are histone H3K27 demethylases involved in HOX gene regulation and development.",
"journal": "Nature",
"date": "2007",
"authors": "Agger K, Cloos PA, Christensen J, Pasini D, Rose S, Rappsilber J, Issaeva I, Canaani E, Salcini AE, Helin K",
"evidence": [
{
"database": "UniProtKB",
"id": "O15550",
"url": "https://www.uniprot.org/uniprot/O15550"
},
{
"database": "Reactome",
"id": "R-HSA-3214842",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214842"
}
],
"reference": [
{
"type": "PubMed",
"id": "17713478",
"url": "https://glygen.org/publication/PubMed/17713478"
}
]
},
{
"title": "Demethylation of H3K27 regulates polycomb recruitment and H2A ubiquitination.",
"journal": "Science (New York, N.Y.)",
"date": "2007",
"authors": "Lee MG, Villa R, Trojer P, Norman J, Yan KP, Reinberg D, Di Croce L, Shiekhattar R",
"evidence": [
{
"database": "UniProtKB",
"id": "O15550",
"url": "https://www.uniprot.org/uniprot/O15550"
},
{
"database": "Reactome",
"id": "R-HSA-5617472",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472"
},
{
"database": "RefSeq",
"id": "NP_066963",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_066963"
}
],
"reference": [
{
"type": "PubMed",
"id": "17761849",
"url": "https://glygen.org/publication/PubMed/17761849"
}
]
},
{
"title": "A histone H3 lysine 27 demethylase regulates animal posterior development.",
"journal": "Nature",
"date": "2007",
"authors": "Lan F, Bayliss PE, Rinn JL, Whetstine JR, Wang JK, Chen S, Iwase S, Alpatov R, Issaeva I, Canaani E, Roberts TM, Chang HY, Shi Y",
"evidence": [
{
"database": "UniProtKB",
"id": "O15550",
"url": "https://www.uniprot.org/uniprot/O15550"
},
{
"database": "Reactome",
"id": "R-HSA-5617472",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472"
}
],
"reference": [
{
"type": "PubMed",
"id": "17851529",
"url": "https://glygen.org/publication/PubMed/17851529"
}
]
},
{
"title": "The BRCT-domain containing protein PTIP links PAX2 to a histone H3, lysine 4 methyltransferase complex.",
"journal": "Developmental cell",
"date": "2007-10",
"authors": "Patel Sanjeevkumar R, Kim Doyeob, Levitan Inna, Dressler Gregory R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "17925232",
"url": "https://glygen.org/publication/PubMed/17925232"
}
]
},
{
"title": "JMJD6 is a histone arginine demethylase.",
"journal": "Science (New York, N.Y.)",
"date": "2007",
"authors": "Chang B, Chen Y, Zhao Y, Bruick RK",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-3214842",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214842"
}
],
"reference": [
{
"type": "PubMed",
"id": "17947579",
"url": "https://glygen.org/publication/PubMed/17947579"
}
]
},
{
"title": "Wdr82 is a C-terminal domain-binding protein that recruits the Setd1A Histone H3-Lys4 methyltransferase complex to transcription start sites of transcribed human genes.",
"journal": "Molecular and cellular biology",
"date": "2008",
"authors": "Lee JH, Skalnik DG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "17998332",
"url": "https://glygen.org/publication/PubMed/17998332"
}
]
},
{
"title": "Identification of JmjC domain-containing UTX and JMJD3 as histone H3 lysine 27 demethylases.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2007",
"authors": "Hong S, Cho YW, Yu LR, Yu H, Veenstra TD, Ge K",
"evidence": [
{
"database": "UniProtKB",
"id": "O15550",
"url": "https://www.uniprot.org/uniprot/O15550"
},
{
"database": "Reactome",
"id": "R-HSA-9821002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9821002"
}
],
"reference": [
{
"type": "PubMed",
"id": "18003914",
"url": "https://glygen.org/publication/PubMed/18003914"
}
]
},
{
"title": "Motif-specific sampling of phosphoproteomes.",
"journal": "Journal of proteome research",
"date": "2008",
"authors": "Ruse CI, McClatchy DB, Lu B, Cociorva D, Motoyama A, Park SK, Yates JR 3rd",
"evidence": [
{
"database": "iPTMnet",
"id": "O15550",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15550"
}
],
"reference": [
{
"type": "PubMed",
"id": "18452278",
"url": "https://glygen.org/publication/PubMed/18452278"
}
]
},
{
"title": "Menin critically links MLL proteins with LEDGF on cancer-associated target genes.",
"journal": "Cancer cell",
"date": "2008-07-08",
"authors": "Yokoyama Akihiko, Cleary Michael L",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "18598942",
"url": "https://glygen.org/publication/PubMed/18598942"
}
]
},
{
"title": "MicroRNAs in the Hox network: an apparent link to posterior prevalence.",
"journal": "Nature reviews. Genetics",
"date": "2008",
"authors": "Yekta S, Tabin CJ, Bartel DP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5617472",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472"
}
],
"reference": [
{
"type": "PubMed",
"id": "18781158",
"url": "https://glygen.org/publication/PubMed/18781158"
}
]
},
{
"title": "A conserved arginine-containing motif crucial for the assembly and enzymatic activity of the mixed lineage leukemia protein-1 core complex.",
"journal": "The Journal of biological chemistry",
"date": "2008-11-21",
"authors": "Patel Anamika, Vought Valarie E, Dharmarajan Venkatasubramanian, Cosgrove Michael S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "18829457",
"url": "https://glygen.org/publication/PubMed/18829457"
}
]
},
{
"title": "Structure of WDR5 bound to mixed lineage leukemia protein-1 peptide.",
"journal": "The Journal of biological chemistry",
"date": "2008-11-21",
"authors": "Patel Anamika, Dharmarajan Venkatasubramanian, Cosgrove Michael S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "18829459",
"url": "https://glygen.org/publication/PubMed/18829459"
}
]
},
{
"title": "Human ATAC Is a GCN5/PCAF-containing acetylase complex with a novel NC2-like histone fold module that interacts with the TATA-binding protein.",
"journal": "The Journal of biological chemistry",
"date": "2008",
"authors": "Wang YL, Faiola F, Xu M, Pan S, Martinez E",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "18838386",
"url": "https://glygen.org/publication/PubMed/18838386"
}
]
},
{
"title": "Molecular regulation of H3K4 trimethylation by Wdr82, a component of human Set1/COMPASS.",
"journal": "Molecular and cellular biology",
"date": "2008-12",
"authors": "Wu Min, Wang Peng Fei, Lee Jung Shin, Martin-Brown Skylar, Florens Laurence, Washburn Michael, Shilatifard Ali",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "18838538",
"url": "https://glygen.org/publication/PubMed/18838538"
}
]
},
{
"title": "The double-histone-acetyltransferase complex ATAC is essential for mammalian development.",
"journal": "Molecular and cellular biology",
"date": "2009",
"authors": "Guelman S, Kozuka K, Mao Y, Pham V, Solloway MJ, Wang J, Wu J, Lill JR, Zha J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "19103755",
"url": "https://glygen.org/publication/PubMed/19103755"
}
]
},
{
"title": "The truncated Hoxa1 protein interacts with Hoxa1 and Pbx1 in stem cells.",
"journal": "Journal of cellular biochemistry",
"date": "2009",
"authors": "Fernandez CC, Gudas LJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5617472",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472"
}
],
"reference": [
{
"type": "PubMed",
"id": "19115252",
"url": "https://glygen.org/publication/PubMed/19115252"
}
]
},
{
"title": "Accumulation of Pax2 transactivation domain interaction protein (PTIP) at sites of DNA breaks via RNF8-dependent pathway is required for cell survival after DNA damage.",
"journal": "The Journal of biological chemistry",
"date": "2009",
"authors": "Gong Z, Cho YW, Kim JE, Ge K, Chen J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "19124460",
"url": "https://glygen.org/publication/PubMed/19124460"
}
]
},
{
"title": "Structural basis for the requirement of additional factors for MLL1 SET domain activity and recognition of epigenetic marks.",
"journal": "Molecular cell",
"date": "2009",
"authors": "Southall SM, Wong PS, Odho Z, Roe SM, Wilson JR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "19187761",
"url": "https://glygen.org/publication/PubMed/19187761"
}
]
},
{
"title": "Transcriptional inhibiton of Hoxd4 expression by miRNA-10a in human breast cancer cells.",
"journal": "BMC molecular biology",
"date": "2009",
"authors": "Tan Y, Zhang B, Wu T, Skogerbo G, Zhu X, Guo X, He S, Chen R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5617472",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472"
}
],
"reference": [
{
"type": "PubMed",
"id": "19232136",
"url": "https://glygen.org/publication/PubMed/19232136"
}
]
},
{
"title": "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.",
"journal": "Analytical chemistry",
"date": "2009",
"authors": "Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S",
"evidence": [
{
"database": "iPTMnet",
"id": "O15550",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15550"
}
],
"reference": [
{
"type": "PubMed",
"id": "19413330",
"url": "https://glygen.org/publication/PubMed/19413330"
}
]
},
{
"title": "Lung cancer-associated JmjC domain protein mdig suppresses formation of tri-methyl lysine 9 of histone H3.",
"journal": "Cell cycle (Georgetown, Tex.)",
"date": "2009",
"authors": "Lu Y, Chang Q, Zhang Y, Beezhold K, Rojanasakul Y, Zhao H, Castranova V, Shi X, Chen F",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-3214842",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214842"
}
],
"reference": [
{
"type": "PubMed",
"id": "19502796",
"url": "https://glygen.org/publication/PubMed/19502796"
}
]
},
{
"title": "On the mechanism of multiple lysine methylation by the human mixed lineage leukemia protein-1 (MLL1) core complex.",
"journal": "The Journal of biological chemistry",
"date": "2009",
"authors": "Patel A, Dharmarajan V, Vought VE, Cosgrove MS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "19556245",
"url": "https://glygen.org/publication/PubMed/19556245"
}
]
},
{
"title": "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.",
"journal": "Science signaling",
"date": "2009",
"authors": "Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK",
"evidence": [
{
"database": "UniProtKB",
"id": "O15550",
"url": "https://www.uniprot.org/uniprot/O15550"
},
{
"database": "iPTMnet",
"id": "O15550",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15550"
}
],
"reference": [
{
"type": "PubMed",
"id": "19690332",
"url": "https://glygen.org/publication/PubMed/19690332"
}
]
},
{
"title": "KDM1B is a histone H3K4 demethylase required to establish maternal genomic imprints.",
"journal": "Nature",
"date": "2009",
"authors": "Ciccone DN, Su H, Hevi S, Gay F, Lei H, Bajko J, Xu G, Li E, Chen T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-3214842",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214842"
}
],
"reference": [
{
"type": "PubMed",
"id": "19727073",
"url": "https://glygen.org/publication/PubMed/19727073"
}
]
},
{
"title": "Retinoic acid receptor antagonists inhibit miR-10a expression and block metastatic behavior of pancreatic cancer.",
"journal": "Gastroenterology",
"date": "2009",
"authors": "Weiss FU, Marques IJ, Woltering JM, Vlecken DH, Aghdassi A, Partecke LI, Heidecke CD, Lerch MM, Bagowski CP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5617472",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472"
}
],
"reference": [
{
"type": "PubMed",
"id": "19747919",
"url": "https://glygen.org/publication/PubMed/19747919"
}
]
},
{
"title": "Sequential activation of HOX2 homeobox genes by retinoic acid in human embryonal carcinoma cells.",
"journal": "Nature",
"date": "1990",
"authors": "Simeone A, Acampora D, Arcioni L, Andrews PW, Boncinelli E, Mavilio F",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5617472",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472"
}
],
"reference": [
{
"type": "PubMed",
"id": "1975088",
"url": "https://glygen.org/publication/PubMed/1975088"
}
]
},
{
"title": "Hypoxia-inducible mir-210 regulates normoxic gene expression involved in tumor initiation.",
"journal": "Molecular cell",
"date": "2009",
"authors": "Huang X, Ding L, Bennewith KL, Tong RT, Welford SM, Ang KK, Story M, Le QT, Giaccia AJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5617472",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472"
}
],
"reference": [
{
"type": "PubMed",
"id": "19782034",
"url": "https://glygen.org/publication/PubMed/19782034"
}
]
},
{
"title": "PHF8, a gene associated with cleft lip/palate and mental retardation, encodes for an Nepsilon-dimethyl lysine demethylase.",
"journal": "Human molecular genetics",
"date": "2010",
"authors": "Loenarz C, Ge W, Coleman ML, Rose NR, Cooper CD, Klose RJ, Ratcliffe PJ, Schofield CJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-3214842",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214842"
}
],
"reference": [
{
"type": "PubMed",
"id": "19843542",
"url": "https://glygen.org/publication/PubMed/19843542"
}
]
},
{
"title": "Epigenetic silencing of the RASSF1A tumor suppressor gene through HOXB3-mediated induction of DNMT3B expression.",
"journal": "Molecular cell",
"date": "2009",
"authors": "Palakurthy RK, Wajapeyee N, Santra MK, Gazin C, Lin L, Gobeil S, Green MR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5617472",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472"
}
],
"reference": [
{
"type": "PubMed",
"id": "19854132",
"url": "https://glygen.org/publication/PubMed/19854132"
}
]
},
{
"title": "Subunit composition and substrate specificity of a MOF-containing histone acetyltransferase distinct from the male-specific lethal (MSL) complex.",
"journal": "The Journal of biological chemistry",
"date": "2010",
"authors": "Cai Y, Jin J, Swanson SK, Cole MD, Choi SH, Florens L, Washburn MP, Conaway JW, Conaway RC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "20018852",
"url": "https://glygen.org/publication/PubMed/20018852"
}
]
},
{
"title": "Enzymatic and structural insights for substrate specificity of a family of jumonji histone lysine demethylases.",
"journal": "Nature structural & molecular biology",
"date": "2010",
"authors": "Horton JR, Upadhyay AK, Qi HH, Zhang X, Shi Y, Cheng X",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-3214842",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214842"
}
],
"reference": [
{
"type": "PubMed",
"id": "20023638",
"url": "https://glygen.org/publication/PubMed/20023638"
}
]
},
{
"title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.",
"journal": "Science signaling",
"date": "2010",
"authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M",
"evidence": [
{
"database": "iPTMnet",
"id": "O15550",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15550"
}
],
"reference": [
{
"type": "PubMed",
"id": "20068231",
"url": "https://glygen.org/publication/PubMed/20068231"
}
]
},
{
"title": "Dual-specificity histone demethylase KIAA1718 (KDM7A) regulates neural differentiation through FGF4.",
"journal": "Cell research",
"date": "2010",
"authors": "Huang C, Xiang Y, Wang Y, Li X, Xu L, Zhu Z, Zhang T, Zhu Q, Zhang K, Jing N, Chen CD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-3214842",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214842"
}
],
"reference": [
{
"type": "PubMed",
"id": "20084082",
"url": "https://glygen.org/publication/PubMed/20084082"
}
]
},
{
"title": "Regulation of HOXA2 gene expression by the ATP-dependent chromatin remodeling enzyme CHD8.",
"journal": "FEBS letters",
"date": "2010",
"authors": "Yates JA, Menon T, Thompson BA, Bochar DA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5617472",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472"
}
],
"reference": [
{
"type": "PubMed",
"id": "20085832",
"url": "https://glygen.org/publication/PubMed/20085832"
}
]
},
{
"title": "Recognition of histone H3K4 trimethylation by the plant homeodomain of PHF2 modulates histone demethylation.",
"journal": "The Journal of biological chemistry",
"date": "2010",
"authors": "Wen H, Li J, Song T, Lu M, Kan PY, Lee MG, Sha B, Shi X",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-3214842",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214842"
}
],
"reference": [
{
"type": "PubMed",
"id": "20129925",
"url": "https://glygen.org/publication/PubMed/20129925"
}
]
},
{
"title": "PHF8 activates transcription of rRNA genes through H3K4me3 binding and H3K9me1/2 demethylation.",
"journal": "Nature structural & molecular biology",
"date": "2010",
"authors": "Feng W, Yonezawa M, Ye J, Jenuwein T, Grummt I",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-3214842",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214842"
}
],
"reference": [
{
"type": "PubMed",
"id": "20208542",
"url": "https://glygen.org/publication/PubMed/20208542"
}
]
},
{
"title": "KDM8, a H3K36me2 histone demethylase that acts in the cyclin A1 coding region to regulate cancer cell proliferation.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2010",
"authors": "Hsia DA, Tepper CG, Pochampalli MR, Hsia EY, Izumiya C, Huerta SB, Wright ME, Chen HW, Kung HJ, Izumiya Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-3214842",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214842"
}
],
"reference": [
{
"type": "PubMed",
"id": "20457893",
"url": "https://glygen.org/publication/PubMed/20457893"
}
]
},
{
"title": "Analysis of the binding of mixed lineage leukemia 1 (MLL1) and histone 3 peptides to WD repeat domain 5 (WDR5) for the design of inhibitors of the MLL1-WDR5 interaction.",
"journal": "Journal of medicinal chemistry",
"date": "2010-07-22",
"authors": "Karatas Hacer, Townsend Elizabeth C, Bernard Denzil, Dou Yali, Wang Shaomeng",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "20575550",
"url": "https://glygen.org/publication/PubMed/20575550"
}
]
},
{
"title": "Histone H4K20/H3K9 demethylase PHF8 regulates zebrafish brain and craniofacial development.",
"journal": "Nature",
"date": "2010",
"authors": "Qi HH, Sarkissian M, Hu GQ, Wang Z, Bhattacharjee A, Gordon DB, Gonzales M, Lan F, Ongusaha PP, Huarte M, Yaghi NK, Lim H, Garcia BA, Brizuela L, Zhao K, Roberts TM, Shi Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-3214842",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214842"
}
],
"reference": [
{
"type": "PubMed",
"id": "20622853",
"url": "https://glygen.org/publication/PubMed/20622853"
}
]
},
{
"title": "PHF8 mediates histone H4 lysine 20 demethylation events involved in cell cycle progression.",
"journal": "Nature",
"date": "2010",
"authors": "Liu W, Tanasa B, Tyurina OV, Zhou TY, Gassmann R, Liu WT, Ohgi KA, Benner C, Garcia-Bassets I, Aggarwal AK, Desai A, Dorrestein PC, Glass CK, Rosenfeld MG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-3214842",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214842"
}
],
"reference": [
{
"type": "PubMed",
"id": "20622854",
"url": "https://glygen.org/publication/PubMed/20622854"
}
]
},
{
"title": "Characterization of a novel WDR5-binding site that recruits RbBP5 through a conserved motif to enhance methylation of histone H3 lysine 4 by mixed lineage leukemia protein-1.",
"journal": "The Journal of biological chemistry",
"date": "2010",
"authors": "Odho Z, Southall SM, Wilson JR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "20716525",
"url": "https://glygen.org/publication/PubMed/20716525"
}
]
},
{
"title": "Molecular basis of the mixed lineage leukemia-menin interaction: implications for targeting mixed lineage leukemias.",
"journal": "The Journal of biological chemistry",
"date": "2010-12-24",
"authors": "Grembecka Jolanta, Belcher Amalia M, Hartley Thomas, Cierpicki Tomasz",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "20961854",
"url": "https://glygen.org/publication/PubMed/20961854"
}
]
},
{
"title": "A novel non-SET domain multi-subunit methyltransferase required for sequential nucleosomal histone H3 methylation by the mixed lineage leukemia protein-1 (MLL1) core complex.",
"journal": "The Journal of biological chemistry",
"date": "2011-02-04",
"authors": "Patel Anamika, Vought Valarie E, Dharmarajan Venkatasubramanian, Cosgrove Michael S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "21106533",
"url": "https://glygen.org/publication/PubMed/21106533"
}
]
},
{
"title": "An Ash2L/RbBP5 heterodimer stimulates the MLL1 methyltransferase activity through coordinated substrate interactions with the MLL1 SET domain.",
"journal": "PloS one",
"date": "2010-11-23",
"authors": "Cao Fang, Chen Yong, Cierpicki Tomasz, Liu Yifan, Basrur Venkatesha, Lei Ming, Dou Yali",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "21124902",
"url": "https://glygen.org/publication/PubMed/21124902"
}
]
},
{
"title": "Distinct roles of GCN5/PCAF-mediated H3K9ac and CBP/p300-mediated H3K18/27ac in nuclear receptor transactivation.",
"journal": "The EMBO journal",
"date": "2011-01-19",
"authors": "Jin Qihuang, Yu Li-Rong, Wang Lifeng, Zhang Zhijing, Kasper Lawryn H, Lee Ji-Eun, Wang Chaochen, Brindle Paul K, Dent Sharon Y R, Ge Kai",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "21131905",
"url": "https://glygen.org/publication/PubMed/21131905"
}
]
},
{
"title": "Fine-tuning the stimulation of MLL1 methyltransferase activity by a histone H3-based peptide mimetic.",
"journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology",
"date": "2011-03",
"authors": "Avdic Vanja, Zhang Pamela, Lanouette Sylvain, Voronova Anastassia, Skerjanc Ilona, Couture Jean-Francois",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "21135039",
"url": "https://glygen.org/publication/PubMed/21135039"
}
]
},
{
"title": "Structural and biochemical insights into MLL1 core complex assembly.",
"journal": "Structure (London, England : 1993)",
"date": "2011",
"authors": "Avdic V, Zhang P, Lanouette S, Groulx A, Tremblay V, Brunzelle J, Couture JF",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "21220120",
"url": "https://glygen.org/publication/PubMed/21220120"
}
]
},
{
"title": "PKA-dependent regulation of the histone lysine demethylase complex PHF2-ARID5B.",
"journal": "Nature cell biology",
"date": "2011",
"authors": "Baba A, Ohtake F, Okuno Y, Yokota K, Okada M, Imai Y, Ni M, Meyer CA, Igarashi K, Kanno J, Brown M, Kato S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-3214842",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214842"
}
],
"reference": [
{
"type": "PubMed",
"id": "21532585",
"url": "https://glygen.org/publication/PubMed/21532585"
}
]
},
{
"title": "Mutational spectrum analysis of chronic myelomonocytic leukemia includes genes associated with epigenetic regulation: UTX, EZH2, and DNMT3A.",
"journal": "Blood",
"date": "2011",
"authors": "Jankowska AM, Makishima H, Tiu RV, Szpurka H, Huang Y, Traina F, Visconte V, Sugimoto Y, Prince C, O'Keefe C, Hsi ED, List A, Sekeres MA, Rao A, McDevitt MA, Maciejewski JP",
"evidence": [
{
"database": "UniProtKB",
"id": "O15550",
"url": "https://www.uniprot.org/uniprot/O15550"
}
],
"reference": [
{
"type": "PubMed",
"id": "21828135",
"url": "https://glygen.org/publication/PubMed/21828135"
}
]
},
{
"title": "Structural basis for histone H3 Lys 27 demethylation by UTX/KDM6A.",
"journal": "Genes Dev.",
"date": "2011",
"authors": "Sengoku T, Yokoyama S",
"evidence": [
{
"database": "UniProtKB",
"id": "O15550",
"url": "https://www.uniprot.org/uniprot/O15550"
}
],
"reference": [
{
"type": "PubMed",
"id": "22002947",
"url": "https://glygen.org/publication/PubMed/22002947"
}
]
},
{
"title": "Deletion of KDM6A, a histone demethylase interacting with MLL2, in three patients with Kabuki syndrome.",
"journal": "Am. J. Hum. Genet.",
"date": "2012",
"authors": "Lederer Damien, Grisart Bernard, Digilio Maria Cristina, Benoit Val\u00e9rie, Crespin Marianne, Ghariani Sophie Claire, Maystadt Isabelle, Dallapiccola Bruno, Verellen-Dumoulin Christine",
"evidence": [
{
"database": "UniProtKB",
"id": "O15550",
"url": "https://www.uniprot.org/uniprot/O15550"
}
],
"reference": [
{
"type": "PubMed",
"id": "22197486",
"url": "https://glygen.org/publication/PubMed/22197486"
}
]
},
{
"title": "The plasticity of WDR5 peptide-binding cleft enables the binding of the SET1 family of histone methyltransferases.",
"journal": "Nucleic acids research",
"date": "2012-05",
"authors": "Zhang Pamela, Lee Hwabin, Brunzelle Joseph S, Couture Jean-Francois",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "22266653",
"url": "https://glygen.org/publication/PubMed/22266653"
}
]
},
{
"title": "The same pocket in menin binds both MLL and JUND but has opposite effects on transcription.",
"journal": "Nature",
"date": "2012",
"authors": "Huang J, Gurung B, Wan B, Matkar S, Veniaminova NA, Wan K, Merchant JL, Hua X, Lei M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "22327296",
"url": "https://glygen.org/publication/PubMed/22327296"
}
]
},
{
"title": "Studies of H3K4me3 demethylation by KDM5B/Jarid1B/PLU1 reveals strong substrate recognition in vitro and identifies 2,4-pyridine-dicarboxylic acid as an in vitro and in cell inhibitor.",
"journal": "The FEBS journal",
"date": "2012-06",
"authors": "Kristensen Line H, Nielsen Anders L, Helgstrand Charlotte, Lees Michael, Cloos Paul, Kastrup Jette S, Helin Kristian, Olsen Lars, Gajhede Michael",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9821002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9821002"
}
],
"reference": [
{
"type": "PubMed",
"id": "22420752",
"url": "https://glygen.org/publication/PubMed/22420752"
}
]
},
{
"title": "Hydroxylation of 5-methylcytosine by TET2 maintains the active state of the mammalian HOXA cluster.",
"journal": "Nature communications",
"date": "2012",
"authors": "Bocker MT, Tuorto F, Raddatz G, Musch T, Yang FC, Xu M, Lyko F, Breiling A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5617472",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472"
}
],
"reference": [
{
"type": "PubMed",
"id": "22569366",
"url": "https://glygen.org/publication/PubMed/22569366"
}
]
},
{
"title": "KDM3B is the H3K9 demethylase involved in transcriptional activation of lmo2 in leukemia.",
"journal": "Molecular and cellular biology",
"date": "2012",
"authors": "Kim JY, Kim KB, Eom GH, Choe N, Kee HJ, Son HJ, Oh ST, Kim DW, Pak JH, Baek HJ, Kook H, Hahn Y, Kook H, Chakravarti D, Seo SB",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-3214842",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214842"
}
],
"reference": [
{
"type": "PubMed",
"id": "22615488",
"url": "https://glygen.org/publication/PubMed/22615488"
}
]
},
{
"title": "WRAD: enabler of the SET1-family of H3K4 methyltransferases.",
"journal": "Briefings in functional genomics",
"date": "2012-05",
"authors": "Ernst Patricia, Vakoc Christopher R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "22652693",
"url": "https://glygen.org/publication/PubMed/22652693"
}
]
},
{
"title": "Structural basis for WDR5 interaction (Win) motif recognition in human SET1 family histone methyltransferases.",
"journal": "The Journal of biological chemistry",
"date": "2012",
"authors": "Dharmarajan V, Lee JH, Patel A, Skalnik DG, Cosgrove MS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "22665483",
"url": "https://glygen.org/publication/PubMed/22665483"
}
]
},
{
"title": "miR-7 and miR-218 epigenetically control tumor suppressor genes RASSF1A and Claudin-6 by targeting HoxB3 in breast cancer.",
"journal": "Biochemical and biophysical research communications",
"date": "2012",
"authors": "Li Q, Zhu F, Chen P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5617472",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472"
}
],
"reference": [
{
"type": "PubMed",
"id": "22705304",
"url": "https://glygen.org/publication/PubMed/22705304"
}
]
},
{
"title": "Functional dissection of HOXD cluster genes in regulation of neuroblastoma cell proliferation and differentiation.",
"journal": "PloS one",
"date": "2012",
"authors": "Zha Y, Ding E, Yang L, Mao L, Wang X, McCarthy BA, Huang S, Ding HF",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5617472",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472"
}
],
"reference": [
{
"type": "PubMed",
"id": "22879880",
"url": "https://glygen.org/publication/PubMed/22879880"
}
]
},
{
"title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.",
"journal": "Journal of proteome research",
"date": "2013",
"authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S",
"evidence": [
{
"database": "UniProtKB",
"id": "O15550",
"url": "https://www.uniprot.org/uniprot/O15550"
},
{
"database": "iPTMnet",
"id": "O15550",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15550"
}
],
"reference": [
{
"type": "PubMed",
"id": "23186163",
"url": "https://glygen.org/publication/PubMed/23186163"
}
]
},
{
"title": "HoxB3 promotes prostate cancer cell progression by transactivating CDCA3.",
"journal": "Cancer letters",
"date": "2013",
"authors": "Chen J, Zhu S, Jiang N, Shang Z, Quan C, Niu Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5617472",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472"
}
],
"reference": [
{
"type": "PubMed",
"id": "23219899",
"url": "https://glygen.org/publication/PubMed/23219899"
}
]
},
{
"title": "Proteome wide purification and identification of O-GlcNAc-modified proteins using click chemistry and mass spectrometry.",
"journal": "Journal of proteome research",
"date": "2013",
"authors": "Hahne H, Sobotzki N, Nyberg T, Helm D, Borodkin VS, van Aalten DM, Agnew B, Kuster B",
"evidence": [
{
"database": "O-GlcNAc Database",
"id": "O15550",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=O15550"
}
],
"reference": [
{
"type": "PubMed",
"id": "23301498",
"url": "https://glygen.org/publication/PubMed/23301498"
}
]
},
{
"title": "Quantitative dissection and stoichiometry determination of the human SET1/MLL histone methyltransferase complexes.",
"journal": "Molecular and cellular biology",
"date": "2013-05",
"authors": "van Nuland Rick, Smits Arne H, Pallaki Paschalina, Jansen Pascal W T C, Vermeulen Michiel, Timmers H T Marc",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "23508102",
"url": "https://glygen.org/publication/PubMed/23508102"
}
]
},
{
"title": "Let-7c inhibits NSCLC cell proliferation by targeting HOXA1.",
"journal": "Asian Pacific journal of cancer prevention : APJCP",
"date": "2013",
"authors": "Zhan M, Qu Q, Wang G, Liu YZ, Tan SL, Lou XY, Yu J, Zhou HH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5617472",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472"
}
],
"reference": [
{
"type": "PubMed",
"id": "23534758",
"url": "https://glygen.org/publication/PubMed/23534758"
}
]
},
{
"title": "Identification of the transcription factor HOXB4 as a novel target of miR-23a.",
"journal": "Genes, chromosomes & cancer",
"date": "2013",
"authors": "Koller K, Das S, Leuschner I, Korbelius M, Hoefler G, Guertl B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5617472",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472"
}
],
"reference": [
{
"type": "PubMed",
"id": "23630040",
"url": "https://glygen.org/publication/PubMed/23630040"
}
]
},
{
"title": "Regulation of transcription by the MLL2 complex and MLL complex-associated AKAP95.",
"journal": "Nature structural & molecular biology",
"date": "2013",
"authors": "Jiang H, Lu X, Shimada M, Dou Y, Tang Z, Roeder RG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "23995757",
"url": "https://glygen.org/publication/PubMed/23995757"
}
]
},
{
"title": "Hox in motion: tracking HoxA cluster conformation during differentiation.",
"journal": "Nucleic acids research",
"date": "2014",
"authors": "Rousseau M, Crutchley JL, Miura H, Suderman M, Blanchette M, Dostie J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5617472",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472"
}
],
"reference": [
{
"type": "PubMed",
"id": "24174538",
"url": "https://glygen.org/publication/PubMed/24174538"
}
]
},
{
"title": "Crosstalk between NSL histone acetyltransferase and MLL/SET complexes: NSL complex functions in promoting histone H3K4 di-methylation activity by MLL/SET complexes.",
"journal": "PLoS genetics",
"date": "2013-11",
"authors": "Zhao Xiaoming, Su Jiaming, Wang Fei, Liu Da, Ding Jian, Yang Yang, Conaway Joan W, Conaway Ronald C, Cao Lingling, Wu Donglu, Wu Min, Cai Yong, Jin Jingji",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "24244196",
"url": "https://glygen.org/publication/PubMed/24244196"
}
]
},
{
"title": "MicroRNA-99 family members suppress Homeobox A1 expression in epithelial cells.",
"journal": "PloS one",
"date": "2013",
"authors": "Chen D, Chen Z, Jin Y, Dragas D, Zhang L, Adjei BS, Wang A, Dai Y, Zhou X",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5617472",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472"
}
],
"reference": [
{
"type": "PubMed",
"id": "24312487",
"url": "https://glygen.org/publication/PubMed/24312487"
}
]
},
{
"title": "H3K4 mono- and di-methyltransferase MLL4 is required for enhancer activation during cell differentiation.",
"journal": "eLife",
"date": "2013",
"authors": "Lee JE, Wang C, Xu S, Cho YW, Wang L, Feng X, Baldridge A, Sartorelli V, Zhuang L, Peng W, Ge K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "24368734",
"url": "https://glygen.org/publication/PubMed/24368734"
}
]
},
{
"title": "miR-100 induces epithelial-mesenchymal transition but suppresses tumorigenesis, migration and invasion.",
"journal": "PLoS genetics",
"date": "2014",
"authors": "Chen D, Sun Y, Yuan Y, Han Z, Zhang P, Zhang J, You MJ, Teruya-Feldstein J, Wang M, Gupta S, Hung MC, Liang H, Ma L",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5617472",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472"
}
],
"reference": [
{
"type": "PubMed",
"id": "24586203",
"url": "https://glygen.org/publication/PubMed/24586203"
}
]
},
{
"title": "A non-active-site SET domain surface crucial for the interaction of MLL1 and the RbBP5/Ash2L heterodimer within MLL family core complexes.",
"journal": "Journal of molecular biology",
"date": "2014-06-12",
"authors": "Shinsky Stephen A, Hu Michael, Vought Valarie E, Ng Sarah B, Bamshad Michael J, Shendure Jay, Cosgrove Michael S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "24680668",
"url": "https://glygen.org/publication/PubMed/24680668"
}
]
},
{
"title": "KDM6 demethylase independent loss of histone H3 lysine 27 trimethylation during early embryonic development.",
"journal": "PLoS genetics",
"date": "2014",
"authors": "Shpargel KB, Starmer J, Yee D, Pohlers M, Magnuson T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5617472",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472"
}
],
"reference": [
{
"type": "PubMed",
"id": "25101834",
"url": "https://glygen.org/publication/PubMed/25101834"
}
]
},
{
"title": "CTCF controls HOXA cluster silencing and mediates PRC2-repressive higher-order chromatin structure in NT2/D1 cells.",
"journal": "Molecular and cellular biology",
"date": "2014",
"authors": "Xu M, Zhao GN, Lv X, Liu G, Wang LY, Hao DL, Wang J, Liu DP, Liang CC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5617472",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472"
}
],
"reference": [
{
"type": "PubMed",
"id": "25135475",
"url": "https://glygen.org/publication/PubMed/25135475"
}
]
},
{
"title": "Biochemical reconstitution and phylogenetic comparison of human SET1 family core complexes involved in histone methylation.",
"journal": "The Journal of biological chemistry",
"date": "2015",
"authors": "Shinsky SA, Monteith KE, Viggiano S, Cosgrove MS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "25561738",
"url": "https://glygen.org/publication/PubMed/25561738"
}
]
},
{
"title": "A phosphorylation switch on RbBP5 regulates histone H3 Lys4 methylation.",
"journal": "Genes & development",
"date": "2015",
"authors": "Zhang P, Chaturvedi CP, Tremblay V, Cramet M, Brunzelle JS, Skiniotis G, Brand M, Shilatifard A, Couture JF",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "25593305",
"url": "https://glygen.org/publication/PubMed/25593305"
}
]
},
{
"title": "Differential expression of human HOX-2 genes along the anterior-posterior axis in embryonic central nervous system.",
"journal": "Differentiation; research in biological diversity",
"date": "1989",
"authors": "Giampaolo A, Acampora D, Zappavigna V, Pannese M, D'Esposito M, Care A, Faiella A, Stornaiuolo A, Russo G, Simeone A, et al.",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5617472",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472"
}
],
"reference": [
{
"type": "PubMed",
"id": "2570724",
"url": "https://glygen.org/publication/PubMed/2570724"
}
]
},
{
"title": "Structure, function and evolution of topologically associating domains (TADs) at HOX loci.",
"journal": "FEBS letters",
"date": "2015",
"authors": "Lonfat N, Duboule D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5617472",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472"
}
],
"reference": [
{
"type": "PubMed",
"id": "25913784",
"url": "https://glygen.org/publication/PubMed/25913784"
}
]
},
{
"title": "Unique Role of the WD-40 Repeat Protein 5 (WDR5) Subunit within the Mixed Lineage Leukemia 3 (MLL3) Histone Methyltransferase Complex.",
"journal": "The Journal of biological chemistry",
"date": "2015",
"authors": "Shinsky SA, Cosgrove MS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "26324722",
"url": "https://glygen.org/publication/PubMed/26324722"
}
]
},
{
"title": "Structural basis for activity regulation of MLL family methyltransferases.",
"journal": "Nature",
"date": "2016",
"authors": "Li Y, Han J, Zhang Y, Cao F, Liu Z, Li S, Wu J, Hu C, Wang Y, Shuai J, Chen J, Cao L, Li D, Shi P, Tian C, Zhang J, Dou Y, Li G, Chen Y, Lei M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "26886794",
"url": "https://glygen.org/publication/PubMed/26886794"
}
]
},
{
"title": "Targeted Disruption of the Interaction between WD-40 Repeat Protein 5 (WDR5) and Mixed Lineage Leukemia (MLL)/SET1 Family Proteins Specifically Inhibits MLL1 and SETd1A Methyltransferase Complexes.",
"journal": "The Journal of biological chemistry",
"date": "2016-10-21",
"authors": "Alicea-Vel\u00e1zquez Nilda L, Shinsky Stephen A, Loh Daniel M, Lee Jeong-Heon, Skalnik David G, Cosgrove Michael S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "27563068",
"url": "https://glygen.org/publication/PubMed/27563068"
}
]
},
{
"title": "Enhancer priming by H3K4 methyltransferase MLL4 controls cell fate transition.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2016-10-18",
"authors": "Wang Chaochen, Lee Ji-Eun, Lai Binbin, Macfarlan Todd S, Xu Shiliyang, Zhuang Lenan, Liu Chengyu, Peng Weiqun, Ge Kai",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "27698142",
"url": "https://glygen.org/publication/PubMed/27698142"
}
]
},
{
"title": "PHF20 Readers Link Methylation of Histone H3K4 and p53 with H4K16 Acetylation.",
"journal": "Cell reports",
"date": "2016",
"authors": "Klein BJ, Wang X, Cui G, Yuan C, Botuyan MV, Lin K, Lu Y, Wang X, Zhao Y, Bruns CJ, Mer G, Shi X, Kutateladze TG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "27760318",
"url": "https://glygen.org/publication/PubMed/27760318"
}
]
},
{
"title": "Somatic cancer mutations in the MLL1 histone methyltransferase modulate its enzymatic activity and dependence on the WDR5/RBBP5/ASH2L complex.",
"journal": "Molecular oncology",
"date": "2017",
"authors": "Weirich S, Kudithipudi S, Jeltsch A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "28182322",
"url": "https://glygen.org/publication/PubMed/28182322"
}
]
},
{
"title": "MLL3/MLL4 are required for CBP/p300 binding on enhancers and super-enhancer formation in brown adipogenesis.",
"journal": "Nucleic acids research",
"date": "2017-06-20",
"authors": "Lai Binbin, Lee Ji-Eun, Jang Younghoon, Wang Lifeng, Peng Weiqun, Ge Kai",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "28398509",
"url": "https://glygen.org/publication/PubMed/28398509"
}
]
},
{
"title": "A cytoplasmic COMPASS is necessary for cell survival and triple-negative breast cancer pathogenesis by regulating metabolism.",
"journal": "Genes & development",
"date": "2017-10-15",
"authors": "Wang Lu, Collings Clayton K, Zhao Zibo, Cozzolino Kira Alia, Ma Quanhong, Liang Kaiwei, Marshall Stacy A, Sze Christie C, Hashizume Rintaro, Savas Jeffrey Nicholas, Shilatifard Ali",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "29138278",
"url": "https://glygen.org/publication/PubMed/29138278"
}
]
},
{
"title": "Artificial Cysteine S-Glycosylation Induced by Per-O-Acetylated Unnatural Monosaccharides during Metabolic Glycan Labeling.",
"journal": "Angewandte Chemie (International ed. in English)",
"date": "2018",
"authors": "Qin W, Qin K, Fan X, Peng L, Hong W, Zhu Y, Lv P, Du Y, Huang R, Han M, Cheng B, Liu Y, Zhou W, Wang C, Chen X",
"evidence": [
{
"database": "O-GlcNAc Database",
"id": "O15550",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=O15550"
}
],
"reference": [
{
"type": "PubMed",
"id": "29237092",
"url": "https://glygen.org/publication/PubMed/29237092"
}
]
},
{
"title": "JMJD5 is a human arginyl C-3 hydroxylase.",
"journal": "Nature communications",
"date": "2018",
"authors": "Wilkins SE, Islam MS, Gannon JM, Markolovic S, Hopkinson RJ, Ge W, Schofield CJ, Chowdhury R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-3214842",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214842"
}
],
"reference": [
{
"type": "PubMed",
"id": "29563586",
"url": "https://glygen.org/publication/PubMed/29563586"
}
]
},
{
"title": "The structure of the RbBP5 beta-propeller domain reveals a surface with potential nucleic acid binding sites.",
"journal": "Nucleic acids research",
"date": "2018",
"authors": "Mittal A, Hobor F, Zhang Y, Martin SR, Gamblin SJ, Ramos A, Wilson JR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "29897600",
"url": "https://glygen.org/publication/PubMed/29897600"
}
]
},
{
"title": "Histone Methylation by SETD1A Protects Nascent DNA through the Nucleosome Chaperone Activity of FANCD2.",
"journal": "Molecular cell",
"date": "2018",
"authors": "Higgs MR, Sato K, Reynolds JJ, Begum S, Bayley R, Goula A, Vernet A, Paquin KL, Skalnik DG, Kobayashi W, Takata M, Howlett NG, Kurumizaka H, Kimura H, Stewart GS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "29937342",
"url": "https://glygen.org/publication/PubMed/29937342"
}
]
},
{
"title": "Quantitative Profiling of Protein O-GlcNAcylation Sites by an Isotope-Tagged Cleavable Linker.",
"journal": "ACS chemical biology",
"date": "2018",
"authors": "Qin K, Zhu Y, Qin W, Gao J, Shao X, Wang YL, Zhou W, Wang C, Chen X",
"evidence": [
{
"database": "O-GlcNAc Database",
"id": "O15550",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=O15550"
},
{
"database": "O-GlcNAc Atlas",
"id": "O15550",
"url": "https://oglcnac.org/atlas/detail/O15550"
}
],
"reference": [
{
"type": "PubMed",
"id": "30059200",
"url": "https://glygen.org/publication/PubMed/30059200"
}
]
},
{
"title": "An Isotope-Coded Photocleavable Probe for Quantitative Profiling of Protein O-GlcNAcylation.",
"journal": "ACS chemical biology",
"date": "2019",
"authors": "Li J, Li Z, Duan X, Qin K, Dang L, Sun S, Cai L, Hsieh-Wilson LC, Wu L, Yi W",
"evidence": [
{
"database": "O-GlcNAc Atlas",
"id": "O15550",
"url": "https://oglcnac.org/atlas/detail/O15550"
}
],
"reference": [
{
"type": "PubMed",
"id": "30620550",
"url": "https://glygen.org/publication/PubMed/30620550"
}
]
},
{
"title": "The MLL1 trimeric catalytic complex is a dynamic conformational ensemble stabilized by multiple weak interactions.",
"journal": "Nucleic acids research",
"date": "2019",
"authors": "Kaustov L, Lemak A, Wu H, Faini M, Fan L, Fang X, Zeng H, Duan S, Allali-Hassani A, Li F, Wei Y, Vedadi M, Aebersold R, Wang Y, Houliston S, Arrowsmith CH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "31400120",
"url": "https://glygen.org/publication/PubMed/31400120"
}
]
},
{
"title": "Structural basis of nucleosome recognition and modification by MLL methyltransferases.",
"journal": "Nature",
"date": "2019-09",
"authors": "Xue Han, Yao Tonghui, Cao Mi, Zhu Guanjun, Li Yan, Yuan Guiyong, Chen Yong, Lei Ming, Huang Jing",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "31485071",
"url": "https://glygen.org/publication/PubMed/31485071"
}
]
},
{
"title": "The internal interaction in RBBP5 regulates assembly and activity of MLL1 methyltransferase complex.",
"journal": "Nucleic acids research",
"date": "2019",
"authors": "Han J, Li T, Li Y, Li M, Wang X, Peng C, Su C, Li N, Li Y, Xu Y, Chen Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "31544921",
"url": "https://glygen.org/publication/PubMed/31544921"
}
]
},
{
"title": "Complex-dependent histone acetyltransferase activity of KAT8 determines its role in transcription and cellular homeostasis.",
"journal": "Molecular cell",
"date": "2021",
"authors": "Radzisheuskaya A, Shliaha PV, Grinev VV, Shlyueva D, Damhofer H, Koche R, Gorshkov V, Kovalchuk S, Zhan Y, Rodriguez KL, Johnstone AL, Keogh MC, Hendrickson RC, Jensen ON, Helin K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "33657400",
"url": "https://glygen.org/publication/PubMed/33657400"
}
]
},
{
"title": "Mechanism for DPY30 and ASH2L intrinsically disordered regions to modulate the MLL/SET1 activity on chromatin.",
"journal": "Nature communications",
"date": "2021",
"authors": "Lee YT, Ayoub A, Park SH, Sha L, Xu J, Mao F, Zheng W, Zhang Y, Cho US, Dou Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "34012049",
"url": "https://glygen.org/publication/PubMed/34012049"
}
]
},
{
"title": "O-GlcNAc modification regulates MTA1 transcriptional activity during breast cancer cell genotoxic adaptation.",
"journal": "Biochimica et biophysica acta. General subjects",
"date": "2021",
"authors": "Xie X, Wu Q, Zhang K, Liu Y, Zhang N, Chen Q, Wang L, Li W, Zhang J, Liu Y",
"evidence": [
{
"database": "O-GlcNAc Database",
"id": "O15550",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=O15550"
}
],
"reference": [
{
"type": "PubMed",
"id": "34019948",
"url": "https://glygen.org/publication/PubMed/34019948"
}
]
},
{
"title": "Highly Efficient Enrichment of O-GlcNAc Glycopeptides Based on Chemical Oxidation and Reversible Hydrazide Chemistry.",
"journal": "Analytical chemistry",
"date": "2021",
"authors": "Chen Y, Qin H, Yue X, Zhou J, Liu L, Nie Y, Ye M",
"evidence": [
{
"database": "O-GlcNAc Atlas",
"id": "O15550",
"url": "https://oglcnac.org/atlas/detail/O15550"
}
],
"reference": [
{
"type": "PubMed",
"id": "34846842",
"url": "https://glygen.org/publication/PubMed/34846842"
}
]
},
{
"title": "GRWD1-WDR5-MLL2 Epigenetic Complex Mediates H3K4me3 Mark and Is Essential for Kaposi's Sarcoma-Associated Herpesvirus-Induced Cellular Transformation.",
"journal": "mBio",
"date": "2021",
"authors": "Wei S, Lu S, Liang L, Wang X, Li W, Li T, Chen L, Ju E, Zhang X, Lai Z, Huang Y, Lu X, Gao SJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "34933446",
"url": "https://glygen.org/publication/PubMed/34933446"
}
]
},
{
"title": "Methyl-lysine readers PHF20 and PHF20L1 define two distinct\u00a0gene expression-regulating NSL complexes.",
"journal": "The Journal of biological chemistry",
"date": "2022-03",
"authors": "Van Hieu T, Harkins Peter R, Patel Avni, Jain Abhinav K, Lu Yue, Bedford Mark T, Santos Margarida A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "35033534",
"url": "https://glygen.org/publication/PubMed/35033534"
}
]
},
{
"title": "Simultaneously Identifying and Distinguishing Glycoproteins with O-GlcNAc and O-GalNAc (the Tn Antigen) in Human Cancer Cells.",
"journal": "Analytical chemistry",
"date": "2022",
"authors": "Xu S, Zheng J, Xiao H, Wu R",
"evidence": [
{
"database": "O-GlcNAc Database",
"id": "O15550",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=O15550"
}
],
"reference": [
{
"type": "PubMed",
"id": "35132862",
"url": "https://glygen.org/publication/PubMed/35132862"
}
]
},
{
"title": "Disentangling the recognition complexity of a protein hub using a nanopore.",
"journal": "Nature communications",
"date": "2022-02-21",
"authors": "Mayse Lauren Ashley, Imran Ali, Larimi Motahareh Ghahari, Cosgrove Michael S, Wolfe Aaron James, Movileanu Liviu",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "35190547",
"url": "https://glygen.org/publication/PubMed/35190547"
}
]
},
{
"title": "An Optimized Isotopic Photocleavable Tagging Strategy for Site-Specific and Quantitative Profiling of Protein O-GlcNAcylation in Colorectal Cancer Metastasis.",
"journal": "ACS chemical biology",
"date": "2022",
"authors": "Liu J, Hao Y, Wang C, Jin Y, Yang Y, Gu J, Chen X",
"evidence": [
{
"database": "O-GlcNAc Database",
"id": "O15550",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=O15550"
}
],
"reference": [
{
"type": "PubMed",
"id": "35254053",
"url": "https://glygen.org/publication/PubMed/35254053"
}
]
},
{
"title": "Rolling back human pluripotent stem cells to an eight-cell embryo-like stage.",
"journal": "Nature",
"date": "2022-05",
"authors": "Mazid Md Abdul, Ward Carl, Luo Zhiwei, Liu Chuanyu, Li Yunpan, Lai Yiwei, Wu Liang, Li Jinxiu, Jia Wenqi, Jiang Yu, Liu Hao, Fu Lixin, Yang Yueli, Iba\u00f1ez David P, Lai Junjian, Wei Xiaoyu, An Juan, Guo Pengcheng, Yuan Yue, Deng Qiuting, Wang Yang, Liu Ying, Gao Fei, Wang Junwen, Zaman Shahriar, Qin Baoming, Wu Guangming, Maxwell Patrick H, Xu Xun, Liu Longqi, Li Wenjuan, Esteban Miguel A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9821002",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9821002"
}
],
"reference": [
{
"type": "PubMed",
"id": "35314832",
"url": "https://glygen.org/publication/PubMed/35314832"
}
]
},
{
"title": "H3K4 methylation by SETD1A/BOD1L facilitates RIF1-dependent NHEJ.",
"journal": "Molecular cell",
"date": "2022-05-19",
"authors": "Bayley Rachel, Borel Valerie, Moss Rhiannon J, Sweatman Ellie, Ruis Philip, Ormrod Alice, Goula Amalia, Mottram Rachel M A, Stanage Tyler, Hewitt Graeme, Saponaro Marco, Stewart Grant S, Boulton Simon J, Higgs Martin R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9772755",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755"
}
],
"reference": [
{
"type": "PubMed",
"id": "35439434",
"url": "https://glygen.org/publication/PubMed/35439434"
}
]
},
{
"title": "Extracellular arginine availability modulates eIF2\u03b1 O-GlcNAcylation and heme oxygenase 1 translation for cellular homeostasis.",
"journal": "Journal of biomedical science",
"date": "2023-05-22",
"authors": "Hung Yu-Wen, Ouyang Ching, Ping Xiaoli, Qi Yue, Wang Yi-Chang, Kung Hsing-Jien, Ann David K",
"evidence": [
{
"database": "O-GlcNAc Database",
"id": "O15550",
"url": "https://www.oglcnac.mcw.edu/search/?query_protein=O15550"
}
],
"reference": [
{
"type": "PubMed",
"id": "37217939",
"url": "https://glygen.org/publication/PubMed/37217939"
}
]
},
{
"title": "The X-linked histone demethylases KDM5C and KDM6A as regulators of T cell-driven autoimmunity in the central nervous system.",
"journal": "Brain research bulletin",
"date": "2023-10-01",
"authors": "Fazazi Mohamed Reda, Ruda Gian Filippo, Brennan Paul E, Rangachari Manu",
"evidence": [
{
"database": "RefSeq",
"id": "NP_066963",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_066963"
}
],
"reference": [
{
"type": "PubMed",
"id": "37657612",
"url": "https://glygen.org/publication/PubMed/37657612"
}
]
},
{
"title": "SETting up the genome: KMT2D and KDM6A genomic function in the Kabuki syndrome craniofacial developmental disorder.",
"journal": "Birth defects research",
"date": "2023-12-01",
"authors": "Shpargel Karl B, Quickstad Gabrielle",
"evidence": [
{
"database": "RefSeq",
"id": "NP_066963",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_066963"
}
],
"reference": [
{
"type": "PubMed",
"id": "37800171",
"url": "https://glygen.org/publication/PubMed/37800171"
}
]
},
{
"title": "[Clinical characteristics and genetic counseling for a three-generation Chinese pedigree with recurrent fetal Kabuki syndrome due to variant of KDM6A gene].",
"journal": "Zhonghua yi xue yi chuan xue za zhi = Zhonghua yixue yichuanxue zazhi = Chinese journal of medical genetics",
"date": "2024-01-10",
"authors": "Liang Yeqiong, An Yu",
"evidence": [
{
"database": "RefSeq",
"id": "NP_066963",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_066963"
}
],
"reference": [
{
"type": "PubMed",
"id": "38171564",
"url": "https://glygen.org/publication/PubMed/38171564"
}
]
},
{
"title": "Retinoic acid induces three newly cloned HOXA1 transcripts in MCF7 breast cancer cells.",
"journal": "Biochemical and biophysical research communications",
"date": "1995",
"authors": "Chariot A, Moreau L, Senterre G, Sobel ME, Castronovo V",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5617472",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472"
}
],
"reference": [
{
"type": "PubMed",
"id": "7488013",
"url": "https://glygen.org/publication/PubMed/7488013"
}
]
},
{
"title": "Up-regulation of HOXC6, HOXD1, and HOXD8 homeobox gene expression in human neuroblastoma cells following chemical induction of differentiation.",
"journal": "Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine",
"date": "1996",
"authors": "Manohar CF, Salwen HR, Furtado MR, Cohn SL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5617472",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472"
}
],
"reference": [
{
"type": "PubMed",
"id": "7501971",
"url": "https://glygen.org/publication/PubMed/7501971"
}
]
},
{
"title": "A retinoic acid-triggered cascade of HOXB1 gene activation.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1995",
"authors": "Ogura T, Evans RM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5617472",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472"
}
],
"reference": [
{
"type": "PubMed",
"id": "7831296",
"url": "https://glygen.org/publication/PubMed/7831296"
}
]
},
{
"title": "The 87-kD A gamma-globin enhancer-binding protein is a product of the HOXB2(HOX2H) locus.",
"journal": "Blood",
"date": "1994",
"authors": "Sengupta PK, Lavelle DE, DeSimone J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5617472",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472"
}
],
"reference": [
{
"type": "PubMed",
"id": "7906964",
"url": "https://glygen.org/publication/PubMed/7906964"
}
]
},
{
"title": "Regulation of the human HOXD4 gene by retinoids.",
"journal": "Mechanisms of development",
"date": "1993",
"authors": "Moroni MC, Vigano MA, Mavilio F",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5617472",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472"
}
],
"reference": [
{
"type": "PubMed",
"id": "7908827",
"url": "https://glygen.org/publication/PubMed/7908827"
}
]
},
{
"title": "In vitro and transgenic analysis of a human HOXD4 retinoid-responsive enhancer.",
"journal": "Development (Cambridge, England)",
"date": "1996",
"authors": "Morrison A, Moroni MC, Ariza-McNaughton L, Krumlauf R, Mavilio F",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5617472",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472"
}
],
"reference": [
{
"type": "PubMed",
"id": "8674428",
"url": "https://glygen.org/publication/PubMed/8674428"
}
]
},
{
"title": "Functional interaction between a RARE and an AP-2 binding site in the regulation of the human HOX A4 gene promoter.",
"journal": "Nucleic acids research",
"date": "1996",
"authors": "Doerksen LF, Bhattacharya A, Kannan P, Pratt D, Tainsky MA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5617472",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472"
}
],
"reference": [
{
"type": "PubMed",
"id": "8759021",
"url": "https://glygen.org/publication/PubMed/8759021"
}
]
},
{
"title": "Functional dissection of a transcriptionally active, target-specific Hox-Pbx complex.",
"journal": "The EMBO journal",
"date": "1997",
"authors": "Di Rocco G, Mavilio F, Zappavigna V",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5617472",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472"
}
],
"reference": [
{
"type": "PubMed",
"id": "9218805",
"url": "https://glygen.org/publication/PubMed/9218805"
}
]
},
{
"title": "HOXD4 and regulation of the group 4 paralog genes.",
"journal": "Development (Cambridge, England)",
"date": "1997",
"authors": "Morrison A, Ariza-McNaughton L, Gould A, Featherstone M, Krumlauf R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5617472",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472"
}
],
"reference": [
{
"type": "PubMed",
"id": "9272954",
"url": "https://glygen.org/publication/PubMed/9272954"
}
]
},
{
"title": "Functional coherence of the human Y chromosome.",
"journal": "Science",
"date": "1997",
"authors": "Lahn B T, Page D C",
"evidence": [
{
"database": "UniProtKB",
"id": "O15550",
"url": "https://www.uniprot.org/uniprot/O15550"
}
],
"reference": [
{
"type": "PubMed",
"id": "9381176",
"url": "https://glygen.org/publication/PubMed/9381176"
}
]
},
{
"title": "The novel homeoprotein Prep1 modulates Pbx-Hox protein cooperativity.",
"journal": "The EMBO journal",
"date": "1998",
"authors": "Berthelsen J, Zappavigna V, Ferretti E, Mavilio F, Blasi F",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-5617472",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472"
}
],
"reference": [
{
"type": "PubMed",
"id": "9482740",
"url": "https://glygen.org/publication/PubMed/9482740"
}
]
}
],
"pathway": [
{
"id": "hsa:7403",
"name": "",
"url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:7403",
"resource": "KEGG Pathway"
},
{
"id": "R-HSA-3214842",
"name": "HDMs demethylate histones",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3214842",
"resource": "Reactome",
"description": "HDMs demethylate histones"
},
{
"id": "R-HSA-5617472",
"name": "Activation of anterior HOX genes in hindbrain development during early embryogenesis",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472",
"resource": "Reactome",
"description": "Activation of anterior HOX genes in hindbrain development during early embryogenesis"
},
{
"id": "R-HSA-9772755",
"name": "Formation of WDR5-containing histone-modifying complexes",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9772755",
"resource": "Reactome",
"description": "Formation of WDR5-containing histone-modifying complexes"
},
{
"id": "R-HSA-9821002",
"name": "Chromatin modifications during the maternal to zygotic transition (MZT)",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9821002",
"resource": "Reactome",
"description": "Chromatin modifications during the maternal to zygotic transition (MZT)"
}
],
"orthologs": [
{
"uniprot_canonical_ac": "O70546-1",
"protein_name": "Lysine-specific demethylase 6A",
"gene_name": "Kdm6a",
"tax_id": 10090,
"organism": "Mus musculus",
"sequence": {
"sequence": "MKSCGVSLATAAAAAAAAAFGDEEKKMAAGKASGESEEASPSLTAEEREALGGLDSRLFGFVRFHEDGARMKALLGKAVRCYESLILKAEGKVESDFFCQLGHFNLLLEDYPKALSAYQRYYSLQSDYWKNAAFLYGLGLVYFHYNAFQWAIKAFQEVLYVDPSFCRAKEIHLRLGLMFKVNTDYESSLKHFQLALVDCNPCTLSNAEIQFHIAHLYETQRKYHSAKEAYEQLLQTENLSAQVKATILQQLGWMHHTVDLLGDKATKESYAIQYLQKSLEADPNSGQSWYFLGRCYSSIGKVQDAFISYRQSIDKSEASADTWCSIGVLYQQQNQPMDALQAYICAVQLDHGHAAAWMDLGTLYESCNQPQDAIKCYLNATRSKNCSNTSGLAARIKYLQAQLCNLPQGSLQNKTKLLPSIEEAWSLPIPAELTSRQGAMNTAQQNTSDNWSGGNAPPPVEQQTHSWCLTPQKLQHLEQLRANRNNLNPAQKLMLEQLESQFVLMQQHQMRQTGVAQVRPTGILNGPTVDSSLPTNSVSGQQPQLPLTRMPSVSQPGVHTACPRQTLANGPFSAGHVPCSTSRTLGSTDTVLIGNNHVTGSGSNGNVPYLQRNAPTLPHNRTNLTSSTEEPWKNQLSNSTQGLHKGPSSHLAGPNGERPLSSTGPSQHLQAAGSGIQNQNGHPTLPSNSVTQGAALNHLSSHTATSGGQQGITLTKESKPSGNTLTVPETSRQTGETPNSTASVEGLPNHVHQVMADAVCSPSHGDSKSPGLLSSDNPQLSALLMGKANNNVGPGTCDKVNNIHPTVHTKTDNSVASSPSSAISTATPSPKSTEQTTTNSVTSLNSPHSGLHTINGEGMEESQSPIKTDLLLVSHRPSPQIIPSMSVSIYPSSAEVLKACRNLGKNGLSNSSILLDKCPPPRPPSSPYPPLPKDKLNPPTPSIYLENKRDAFFPPLHQFCTNPNNPVTVIRGLAGALKLDLGLFSTKTLVEANNEHMVEVRTQLLQPADENWDPTGTKKIWHCESNRSHTTIAKYAQYQASSFQESLREENEKRSHHKDHSDSESTSSDNSGKRRKGPFKTIKFGTNIDLSDDKKWKLQLHELTKLPAFVRVVSAGNLLSHVGHTILGMNTVQLYMKVPGSRTPGHQENNNFCSVNINIGPGDCEWFVVPEGYWGVLNDFCEKNNLNFLMGSWWPNLEDLYEANVPVYRFIQRPGDLVWINAGTVHWVQAIGWCNNIAWNVGPLTACQYKLAVERYEWNKLQNVKSIVPMVHLSWNMARNIKVSDPKLFEMIKYCLLRTLKQCQTLREALIAAGKEIIWHGRTKEEPAHYCSICEVEVFDLLFVTNESNSRKTYIVHCQDCARKTSGNLENFVVLEQYKMEDLMQVYDQFTLAPPLPSASS",
"length": 1401
},
"evidence": [
{
"id": "45926866",
"url": "http://www.informatics.jax.org/homology/45926866",
"database": "MGI"
}
],
"common_name": "Mouse"
}
],
"go_annotation": {
"categories": [
{
"name": "Biological Process",
"total": 20,
"go_terms": [
{
"name": "protein modification process",
"id": "GO:0036211",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0036211",
"evidence": [
{
"database": "UniProtKB",
"id": "O15550",
"url": "https://www.uniprot.org/uniprot/O15550"
}
],
"pmid": ""
},
{
"name": "cellular response to angiotensin",
"id": "GO:1904385",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904385",
"evidence": [
{
"database": "UniProtKB",
"id": "O15550",
"url": "https://www.uniprot.org/uniprot/O15550"
}
],
"pmid": ""
},
{
"name": "notochord morphogenesis",
"id": "GO:0048570",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048570",
"evidence": [
{
"database": "UniProtKB",
"id": "O15550",
"url": "https://www.uniprot.org/uniprot/O15550"
}
],
"pmid": ""
},
{
"name": "cellular response to endothelin",
"id": "GO:1990859",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990859",
"evidence": [
{
"database": "UniProtKB",
"id": "O15550",
"url": "https://www.uniprot.org/uniprot/O15550"
}
],
"pmid": ""
},
{
"name": "in utero embryonic development",
"id": "GO:0001701",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001701",
"evidence": [
{
"database": "UniProtKB",
"id": "O15550",
"url": "https://www.uniprot.org/uniprot/O15550"
}
],
"pmid": ""
},
{
"name": "respiratory system process",
"id": "GO:0003016",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003016",
"evidence": [
{
"database": "UniProtKB",
"id": "O15550",
"url": "https://www.uniprot.org/uniprot/O15550"
}
],
"pmid": ""
},
{
"name": "positive regulation of gene expression",
"id": "GO:0010628",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010628",
"evidence": [
{
"database": "UniProtKB",
"id": "O15550",
"url": "https://www.uniprot.org/uniprot/O15550"
}
],
"pmid": ""
},
{
"name": "positive regulation of transcription by RNA polymerase II",
"id": "GO:0045944",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944",
"evidence": [
{
"database": "UniProtKB",
"id": "O15550",
"url": "https://www.uniprot.org/uniprot/O15550"
}
],
"pmid": ""
},
{
"name": "multicellular organism growth",
"id": "GO:0035264",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035264",
"evidence": [
{
"database": "UniProtKB",
"id": "O15550",
"url": "https://www.uniprot.org/uniprot/O15550"
}
],
"pmid": ""
},
{
"name": "cellular response to hypoxia",
"id": "GO:0071456",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071456",
"evidence": [
{
"database": "UniProtKB",
"id": "O15550",
"url": "https://www.uniprot.org/uniprot/O15550"
}
],
"pmid": ""
},
{
"name": "neural tube closure",
"id": "GO:0001843",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001843",
"evidence": [
{
"database": "UniProtKB",
"id": "O15550",
"url": "https://www.uniprot.org/uniprot/O15550"
}
],
"pmid": ""
},
{
"name": "heart morphogenesis",
"id": "GO:0003007",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003007",
"evidence": [
{
"database": "UniProtKB",
"id": "O15550",
"url": "https://www.uniprot.org/uniprot/O15550"
}
],
"pmid": ""
},
{
"name": "cellular response to transforming growth factor beta stimulus",
"id": "GO:0071560",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071560",
"evidence": [
{
"database": "UniProtKB",
"id": "O15550",
"url": "https://www.uniprot.org/uniprot/O15550"
}
],
"pmid": ""
},
{
"name": "positive regulation of cell size",
"id": "GO:0045793",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045793",
"evidence": [
{
"database": "UniProtKB",
"id": "O15550",
"url": "https://www.uniprot.org/uniprot/O15550"
}
],
"pmid": ""
},
{
"name": "cellular response to vitamin D",
"id": "GO:0071305",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071305",
"evidence": [
{
"database": "UniProtKB",
"id": "O15550",
"url": "https://www.uniprot.org/uniprot/O15550"
}
],
"pmid": ""
},
{
"name": "negative regulation of hypoxia-induced intrinsic apoptotic signaling pathway",
"id": "GO:1903298",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903298",
"evidence": [
{
"database": "UniProtKB",
"id": "O15550",
"url": "https://www.uniprot.org/uniprot/O15550"
}
],
"pmid": ""
},
{
"name": "somite rostral/caudal axis specification",
"id": "GO:0032525",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032525",
"evidence": [
{
"database": "UniProtKB",
"id": "O15550",
"url": "https://www.uniprot.org/uniprot/O15550"
}
],
"pmid": ""
},
{
"name": "mesodermal cell differentiation",
"id": "GO:0048333",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048333",
"evidence": [
{
"database": "UniProtKB",
"id": "O15550",
"url": "https://www.uniprot.org/uniprot/O15550"
}
],
"pmid": ""
},
{
"name": "chromatin remodeling",
"id": "GO:0006338",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006338",
"evidence": [
{
"database": "UniProtKB",
"id": "O15550",
"url": "https://www.uniprot.org/uniprot/O15550"
}
],
"pmid": ""
},
{
"name": "regulation of gene expression",
"id": "GO:0010468",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010468",
"evidence": [
{
"database": "UniProtKB",
"id": "O15550",
"url": "https://www.uniprot.org/uniprot/O15550"
}
],
"pmid": ""
}
]
},
{
"name": "Molecular Function",
"total": 7,
"go_terms": [
{
"name": "identical protein binding",
"id": "GO:0042802",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802",
"evidence": [
{
"database": "UniProtKB",
"id": "O15550",
"url": "https://www.uniprot.org/uniprot/O15550"
}
],
"pmid": ""
},
{
"name": "metal ion binding",
"id": "GO:0046872",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872",
"evidence": [
{
"database": "UniProtKB",
"id": "O15550",
"url": "https://www.uniprot.org/uniprot/O15550"
}
],
"pmid": ""
},
{
"name": "RNA polymerase II cis-regulatory region sequence-specific DNA binding",
"id": "GO:0000978",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000978",
"evidence": [
{
"database": "UniProtKB",
"id": "O15550",
"url": "https://www.uniprot.org/uniprot/O15550"
}
],
"pmid": ""
},
{
"name": "chromatin DNA binding",
"id": "GO:0031490",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031490",
"evidence": [
{
"database": "UniProtKB",
"id": "O15550",
"url": "https://www.uniprot.org/uniprot/O15550"
}
],
"pmid": ""
},
{
"name": "histone H3K27me2/H3K27me3 demethylase activity",
"id": "GO:0071558",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071558",
"evidence": [
{
"database": "UniProtKB",
"id": "O15550",
"url": "https://www.uniprot.org/uniprot/O15550"
}
],
"pmid": ""
},
{
"name": "oxidoreductase activity",
"id": "GO:0016491",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016491",
"evidence": [
{
"database": "UniProtKB",
"id": "O15550",
"url": "https://www.uniprot.org/uniprot/O15550"
}
],
"pmid": ""
},
{
"name": "histone demethylase activity",
"id": "GO:0032452",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032452",
"evidence": [
{
"database": "UniProtKB",
"id": "O15550",
"url": "https://www.uniprot.org/uniprot/O15550"
}
],
"pmid": ""
}
]
},
{
"name": "Cellular Component",
"total": 4,
"go_terms": [
{
"name": "histone methyltransferase complex",
"id": "GO:0035097",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035097",
"evidence": [
{
"database": "UniProtKB",
"id": "O15550",
"url": "https://www.uniprot.org/uniprot/O15550"
}
],
"pmid": ""
},
{
"name": "nucleus",
"id": "GO:0005634",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634",
"evidence": [
{
"database": "UniProtKB",
"id": "O15550",
"url": "https://www.uniprot.org/uniprot/O15550"
}
],
"pmid": ""
},
{
"name": "nucleoplasm",
"id": "GO:0005654",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654",
"evidence": [
{
"database": "UniProtKB",
"id": "O15550",
"url": "https://www.uniprot.org/uniprot/O15550"
}
],
"pmid": ""
},
{
"name": "MLL3/4 complex",
"id": "GO:0044666",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044666",
"evidence": [
{
"database": "UniProtKB",
"id": "O15550",
"url": "https://www.uniprot.org/uniprot/O15550"
}
],
"pmid": ""
}
]
}
]
},
"pro_annotation": [],
"site_annotation": [
{
"start_pos": 1026,
"end_pos": 1028,
"annotation": "n_glycosylation_sequon"
},
{
"start_pos": 1346,
"end_pos": 1348,
"annotation": "n_glycosylation_sequon"
},
{
"start_pos": 236,
"end_pos": 238,
"annotation": "n_glycosylation_sequon"
},
{
"start_pos": 377,
"end_pos": 379,
"annotation": "n_glycosylation_sequon"
},
{
"start_pos": 386,
"end_pos": 388,
"annotation": "n_glycosylation_sequon"
},
{
"start_pos": 411,
"end_pos": 413,
"annotation": "n_glycosylation_sequon"
},
{
"start_pos": 444,
"end_pos": 446,
"annotation": "n_glycosylation_sequon"
},
{
"start_pos": 448,
"end_pos": 450,
"annotation": "n_glycosylation_sequon"
},
{
"start_pos": 620,
"end_pos": 622,
"annotation": "n_glycosylation_sequon"
},
{
"start_pos": 623,
"end_pos": 625,
"annotation": "n_glycosylation_sequon"
},
{
"start_pos": 638,
"end_pos": 640,
"annotation": "n_glycosylation_sequon"
},
{
"start_pos": 739,
"end_pos": 741,
"annotation": "n_glycosylation_sequon"
},
{
"start_pos": 910,
"end_pos": 912,
"annotation": "n_glycosylation_sequon"
}
],
"ptm_annotation": [],
"interactions": [],
"reactions": [
{
"id": "60224",
"name": "",
"equation": "2 2-oxoglutarate + N(6),N(6),N(6)-trimethyl-L-lysyl(27)-[histone H3] + 2 O2 = 2 CO2 + 2 formaldehyde + N(6)-methyl-L-lysyl(27)-[histone H3] + 2 succinate",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"A0A8I6AFH2-1",
"A0A8I5ZM74-1",
"A0A8I6GMK8-1",
"O14607-1",
"O15550-1",
"O15054-2",
"O70546-1",
"Q5NCY0-1",
"P79457-1"
],
"evidence": [
{
"id": "60224",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/60224"
}
]
},
{
"id": "R-HSA-4754187",
"name": "KDM6A, KDM6B, KDM7A demethylate Me2K28-histone H3",
"equation": "",
"summary": "All characterized lysine demethylases other than KDM1A belong to the jumonjiC domain (JmjC) containing family.The JmjC KDMs are members of the Cupin superfamily of mononuclear Fe (II) dependent oxygenases, which are characterized by the presence of a double-stranded beta-helix core fold. The JmjC KDMs require 2 oxoglutarate (2 OG) and molecular oxygen as co substrates, producing, along with formaldehyde, succinate and carbon dioxide. This hydroxylation based mechanism does not require a protonatable lysine e amine group and consequently JmjC containing demethylases are able to demethylate tri , di and monomethylated lysines.
KDM6A (UTX), KDM6B (JMJD3), KDM6C (UTY) and KDM7A (JHDM1D) catalyse the demethylation of di or tri-methylated lysine-28 of histone H3 (H3K27Me2/3) (Agger et al. 2007, Cho et al. 2007, De Santra et al. 2007, Hong et al. 2007, Lan et al. 2007, Lee et al. 2007, Horton et al. 2010, Huang et al. 2010, Walport et al. 2014).",
"cellular_location": "nucleoplasm",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"O15054-2",
"O14607-1",
"Q6ZMT4-1",
"O15550-1"
],
"evidence": [
{
"id": "R-HSA-4754187",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4754187"
}
]
},
{
"id": "R-HSA-5617431",
"name": "Retinoic acid activates HOXA1 chromatin",
"equation": "",
"summary": "As inferred from mouse embryos and cell lines, retinoic acid binds the RARA or RARG receptor in a RAR:RXR dimer bound to the 3' region of HOXA1. Ligand binding by retinoic acid receptors causes dismissal of corepressors such as NCOR1 (Klein et al. 2000), recruitment of coactivators such as NCOA3, and alteration of chromatin at the HOXA1 gene to an active conformation. Similar activation of HOXA1 is also observed in vitro in human breast cancer cells (Chariot et al. 1995). In mouse and Xenopus Hoxa1 acts in a feedback loop to maintain retinoic acid synthesis by directly binding and activating the promoter of the Raldh2 gene.
In addition to recruiting transcription coactivators, retinoic acid also appears to affect histone modifications and DNA methylation. In human embryonal carcinoma cells, KDM6A (UTX) binds the HOXA1 gene upon retinoic acid treatment and demethylates trimethylated lysine-27 of histone H3 (H3K27me3) (Lee et al. 2007). Reduced H3K27me3 is also observed at HOXA1 in lung fibroblasts (Lan et al. 2007). Experiments with mouse embryos lacking Kdm6a and Kdm6b indicate other factors also participate in demethylation of H3K27me3 (Shpargel et al. 2014). Polycomb repressive complex 2 (PRC2), which binds H3K27me3, is also lost during activation by retinoic acid (inferred from mouse cells and also observed in human embryonal carcinoma cells, Lee et al. 2007, Sessa et al. 2007). KDM6A forms complexes with the histone methyltransferases KMT2C,D (MLL2,3) (Lee et al. 2007) which may participate in methylating histone H3 at lysine-4 (H3K4me3), an activating chromatin modification. At the 3' end of the HOXA cluster 5-methylcytosine in CG-rich regions is converted to 5-hydroxymethylcytosine by TET2 during retinoic acid induced differentiation of embryonal carcinoma cells (Bocker et al. 2012). During retinoic acid activation of HOXA genes in human monocytic leukemia cells the HOXA cluster is unfolded and its chromosomal domain is repositioned within the nucleus (Rousseau et al. 2014). Similar large-scale rearrangements may occur during embryogenesis.
In mouse embryos, expression of Hoxa1 occurs in the neural tube, adjacent mesenchyme, paraxial mesoderm, somites, and gut epithelium from rhombomere 4 to the caudal-most region of the embryo. (Rhombomeres are transiently formed segments in the neural tube that will eventually form the hindbrain.)",
"cellular_location": "nucleoplasm",
"input_participant_list": [
"R-ALL-5334804"
],
"output_participant_list": [
"R-HSA-5687935"
],
"enzyme_list": [
"O15550-1",
"O15379-1",
"Q09472-1",
"O14686-1",
"P24928-1",
"Q8NEZ4-1",
"Q9Y6Q9-1",
"Q15910-1",
"P30876-1"
],
"evidence": [
{
"id": "R-HSA-5617431",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617431"
}
]
},
{
"id": "R-HSA-5617452",
"name": "Retinoic acid activates HOXB1 chromatin",
"equation": "",
"summary": "As inferred from mouse embryos and cell lines, retinoic acid binds receptors (RARA or RARG) at retinoic acid response elements (RAREs) located 3' to the HOXB1 gene, causing recruitment of coactivators such as NCOA3 and alteration of chromatin at the HOXB1 gene to an active conformation. Similar activation of the HOXB cluster by retinoic acid is observed in human embryonal carcinoma cells (Simeone et al. 1990). In human carcinoma cells and primary fibroblasts, KDM6A (UTX) binds the HOXB1 gene upon retinoic acid treatment (Agger et al. 2007, Lee et al. 2007) and may demethylate trimethylated lysine-27 of histone H3 (H3K27me3). Reduced H3K27me3 is also observed at HOXB1 in lung fibroblasts (Lan et al. 2007). Other demethylases may be redundant with KDM6A. Polycomb repressive complex 2 (PRC2), which binds H3K27me3, is also lost during activation (Lee et al. 2007). KDM6A forms complexes with the histone methyltransferase KMT2C,D (MLL2,3) which may participate in methylating histone H3 at lysine-4 (H3K4me3), an activating chromatin modification (Lee et al. 2007). After activation by retinoic acid HOXB1 maintains its own expression by binding elements in its own promoter and activating expression (Di Rocco et al. 1997).
In mouse embryos, Hoxb1 is expressed in mesoderm and neurectoderm of primitive streak stage embryos and then becomes restricted to rhombomeres of the hindbrain. Before rhombomere formation Hoxb1 is initially expressed in the region that becomes r3-7. After rhombomere formation Hoxb1 becomes restricted to r4 and is also observed in caudal mesoderm. Hoxb1 activates expression of Egr2 (Krox20), a transcription factor that subsequently activates Hoxa2, Hoxb2, and Hoxb3 and represses Hoxb1.",
"cellular_location": "nucleoplasm",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"O15550-1",
"Q09472-1",
"O14686-1",
"P24928-1",
"Q8NEZ4-1",
"Q9Y6Q9-1",
"Q15910-1",
"P30876-1"
],
"evidence": [
{
"id": "R-HSA-5617452",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617452"
}
]
},
{
"id": "R-HSA-5617454",
"name": "HOXB1 gene is transcribed",
"equation": "",
"summary": "After activation by retinoic acid, the HOXB1 gene is transcribed to yield mRNA (in embryos in Giampaolo et al. 1989, in human embryonal carcinoma cells in Simeone et al. 1990, Ogura and Evans 1995).
In mouse embryos, Hoxb1 is expressed in mesoderm and neurectoderm of primitive streak stage embryos and then becomes restricted to rhombomeres of the hindbrain. Before rhombomere formation Hoxb1 is initially expressed in the region that becomes r3-7. After rhombomere formation Hoxb1 becomes restricted to r4 and is also observed in caudal mesoderm.",
"cellular_location": "cytosol, nucleoplasm",
"input_participant_list": [
"R-HSA-5617450"
],
"output_participant_list": [],
"enzyme_list": [
"O15550-1",
"O75928-1",
"Q09472-1",
"O14686-1",
"P24928-1",
"Q8NEZ4-1",
"Q9Y6Q9-1",
"P30876-1",
"P11161-1"
],
"evidence": [
{
"id": "R-HSA-5617454",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617454"
}
]
},
{
"id": "R-HSA-5617471",
"name": "HOXA1 gene is transcribed",
"equation": "",
"summary": "After activation by retinoic acid, the HOXA1 gene is transcribed to yield mRNA (inferred from mouse embryos, also demonstrated in human cancer cells, Chariot et al. 1995, Xu et al. 2014). The mRNA is a target of the microRNAs miR-10a in megakaryocytes (Garzon et al. 2006), miR210 in tumors (Huang et al. 2009), let-7c in non-small cell lung cancer cells (Zhan et al. 2013), miR-99 in epithelial cells (Chen et al. 2013), and miR-100 in tumor cells (Chen et al. 2014), however it is unknown if these play a role in embryogenesis. Opposite strand intergenic transcripts are also observed in adult tissues and placenta (Sessa et al. 2007).
In mouse embryos, expression of Hoxa1 occurs in the neural tube, adjacent mesenchyme, paraxial mesoderm, somites, and gut epithelium from rhombomere 4 to the caudal-most region of the embryo. (Rhombomeres are transiently formed segments in the neural tube that will eventually form the hindbrain.)",
"cellular_location": "cytosol, nucleoplasm",
"input_participant_list": [
"R-HSA-5617426"
],
"output_participant_list": [
"R-HSA-5617439"
],
"enzyme_list": [
"O15550-1",
"Q09472-1",
"O14686-1",
"P24928-1",
"Q8NEZ4-1",
"Q9Y6Q9-1",
"Q9ULM6-1",
"P30876-1"
],
"evidence": [
{
"id": "R-HSA-5617471",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617471"
}
]
},
{
"id": "R-HSA-5617483",
"name": "HOXA2 gene is transcribed",
"equation": "",
"summary": "The HOXA2 is transcribed to yield mRNA (in carcinoma cells, Yates et al. 2010). In mouse embryos Hoxa2 mRNA is observed in rhombomere 2 and caudally through posterior hindbrain, spinal cord, larynx, lungs, vertebrae, sternum, and intestine. Hoxa2 mRNA is a target of microRNA miR-3960 in differentiating mouse osteoblasts.",
"cellular_location": "cytosol, nucleoplasm",
"input_participant_list": [
"R-HSA-5617497"
],
"output_participant_list": [
"R-HSA-5617481"
],
"enzyme_list": [
"O15550-1",
"O14686-1",
"P24928-1",
"Q8NEZ4-1",
"P30876-1",
"P11161-1"
],
"evidence": [
{
"id": "R-HSA-5617483",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617483"
}
]
},
{
"id": "R-HSA-5617484",
"name": "EGR2 (KROX20) activates HOXA2 expression",
"equation": "",
"summary": "As inferred from mouse embryos, HOXA2 expression is directly driven by EGR2 (KROX20) in rhombomeres 3 and 5 (r3, r5) of the hindbrain and by HOXB1 in r4. EGR2 binds sites in the 5' region of the HOXA2 gene. HOXB1 sets up the correct EGR2 expression domain in r3 and thereby indirectly regulates HOXA2 in this region. (HOXA2 is the only HOX gene active in r2. An unknown activator, possibly a transcription factor of the SOX family, may be involved in expression in r2.)",
"cellular_location": "nucleoplasm",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"O15550-1",
"O14686-1",
"P24928-1",
"Q8NEZ4-1",
"P30876-1",
"P11161-1"
],
"evidence": [
{
"id": "R-HSA-5617484",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617484"
}
]
},
{
"id": "R-HSA-5617486",
"name": "HOXB2 gene is transcribed",
"equation": "",
"summary": "The HOXB2 gene is transcribed to yield mRNA (in embryos in Giampaolo et al. 1989, in carcinoma cells in Simeone et al. 1990). In mouse embryos Hoxb2 mRNA is observed in rhombomere 3 and caudally in the neural tube and mesoderm derivatives such as lung.",
"cellular_location": "cytosol, nucleoplasm",
"input_participant_list": [
"R-HSA-5617499"
],
"output_participant_list": [
"R-HSA-5617488"
],
"enzyme_list": [
"O15550-1",
"O14686-1",
"P24928-1",
"Q8NEZ4-1",
"P30876-1",
"P11161-1"
],
"evidence": [
{
"id": "R-HSA-5617486",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617486"
}
]
},
{
"id": "R-HSA-5617492",
"name": "EGR2 (KROX20) activates HOXB2 expression",
"equation": "",
"summary": "As inferrred from mouse embryos, EGR2 (KROX20) binds three sites in the 5' region of the HOXB2 gene and activates expression in rhombomere 3 (r3) and r5. HOXB1 activates HOXB2 in r4 and expression is also observed in r6 and r7.",
"cellular_location": "nucleoplasm",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"O15550-1",
"O14686-1",
"P24928-1",
"Q8NEZ4-1",
"P30876-1",
"P11161-1"
],
"evidence": [
{
"id": "R-HSA-5617492",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617492"
}
]
},
{
"id": "R-HSA-5617641",
"name": "MAFB (KREISLER) and HOXB1:PBX1:PKNOX1 (HOXB1:PBX1:PREP1) activate HOXA3 expression",
"equation": "",
"summary": "As inferred from mouse embryos, the transcription factor MAFB (KREISLER, KMRL) initially activates the HOXA3 gene in rhombomere 5 (r5) and r6. Weaker expression is also observed in r7. HOXA3 autoregulates by binding and activating its own promoter.",
"cellular_location": "nucleoplasm",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"O15550-1",
"O14686-1",
"P24928-1",
"Q8NEZ4-1",
"P30876-1"
],
"evidence": [
{
"id": "R-HSA-5617641",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617641"
}
]
},
{
"id": "R-HSA-5617661",
"name": "MAFB:JUN and EGR2 activate HOXB3 expression",
"equation": "",
"summary": "As inferred from mouse embryos, the MAFB:JUN (KREISLER:JUN) heterodimer binds the rhombomere 5 (r5) enhancer located 5' to the P1 promoter of the HOXB3 gene and activates expression in r5. EGR2 (KROX20) also binds the r5 enhancer is required to activate the HOXB3 gene in r5. After initial activation HOXB3 is hypothesized to maintain its own expression. HOXB3 is expressed most strongly in r5 and more weakly in caudal rhombomeres r6 and r7.",
"cellular_location": "nucleoplasm",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"O15550-1",
"O14686-1",
"P24928-1",
"Q8NEZ4-1",
"P30876-1",
"P11161-1"
],
"evidence": [
{
"id": "R-HSA-5617661",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617661"
}
]
},
{
"id": "R-HSA-5617672",
"name": "HOXB3 gene is transcribed",
"equation": "",
"summary": "The HOXB3 gene is transcribed to yield mRNA (in embryos in Giampaolo et al. 1989, in carcinoma cells in Simeone et al. 1990). The HOXB3 mRNA is a target of the microRNAs miR-7 and miR-218 in breast cancer cells (Li et al. 2012) and miR-10A (Weiss et al. 2009). In mouse embryos Hoxb3 mRNA is observed strongly in rhombomere 5 and more weakly in rhombomeres 6 and 7 of the hindbrain. Hoxb3 mRNA is also observed in mesodermal derivatives including lung, stomach, pancreas, and metanephros, and in neural crest derivatives.",
"cellular_location": "cytosol, nucleoplasm",
"input_participant_list": [
"R-HSA-5617658"
],
"output_participant_list": [
"R-HSA-5617656"
],
"enzyme_list": [
"O15550-1",
"O14686-1",
"P24928-1",
"Q8NEZ4-1",
"P30876-1",
"P11161-1"
],
"evidence": [
{
"id": "R-HSA-5617672",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617672"
}
]
},
{
"id": "R-HSA-5617676",
"name": "HOXA3 gene is transcribed",
"equation": "",
"summary": "The HOXA3 gene is transcribed to yield mRNA (Han et al. 2007). In mouse embryos Hoxa3 mRNA is observed in rhombomere 5 and caudally through the central nervous system, ectoderm, and somitic mesoderm. HOXA3 mRNA is a target of the microRNA miR-10a (Han et al. 2007).",
"cellular_location": "cytosol, nucleoplasm",
"input_participant_list": [
"R-HSA-5617647"
],
"output_participant_list": [
"R-HSA-5617670"
],
"enzyme_list": [
"O15550-1",
"O14686-1",
"P24928-1",
"Q8NEZ4-1",
"P30876-1"
],
"evidence": [
{
"id": "R-HSA-5617676",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617676"
}
]
},
{
"id": "R-HSA-5617859",
"name": "Retinoic acid activates HOXB4 chromatin",
"equation": "",
"summary": "As inferred from mouse embryos, retinoic acid activates the HOXB4 gene in rhombomere 7 (r7) by binding retinoic acid receptor RARB (Folberg et al. 1999) and perhaps RARA in RAR:RXR dimers bound to retinoic acid response elements (RAREs) located in the 3' flanking region of the HOXB4 gene, causing dissociation of corepressors and recruitment of coactivators. HOXB4 maintains its own expression by binding and activating its own promoter.
In human fibroblasts activation of chromatin at the HOXB4 gene accompanied by loss of methylation of lysine-27 at histone H3 (H3K27me3, Lan et al. 2007). Based on observations from mouse embryonic stem cells, Polycomb repressive complex 2 (PRC2), which binds H3K27me3, is anticipated to be lost while methylation of H3K4 is gained, possibly through the action of the histone demethylase KDM6A (UTX) which, in human fibroblasts, binds HOXB4 (Lan et al. 2007). Other factors may be involved in demethylating H3K27me3. KDM6A can form complexes containing the histone methyltransferases KMT2C,D (MLL2,3) which may participate in methylating H3K4 (Lee et al. 2007).",
"cellular_location": "nucleoplasm",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"O15550-1",
"Q09472-1",
"O14686-1",
"P24928-1",
"Q8NEZ4-1",
"Q9Y6Q9-1",
"Q15910-1",
"P30876-1"
],
"evidence": [
{
"id": "R-HSA-5617859",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617859"
}
]
},
{
"id": "R-HSA-5617866",
"name": "HOXC4 gene is transcribed",
"equation": "",
"summary": "The HOXC4 gene is transcribed to yield mRNA. In mouse embryos Hoxc4 mRNA is observed caudal to rhombomere 7 in spinal column, prevertebrae, esophagus, metanephric kidney, lung, and trachea.",
"cellular_location": "cytosol, nucleoplasm",
"input_participant_list": [
"R-HSA-5617863"
],
"output_participant_list": [
"R-HSA-5617868"
],
"enzyme_list": [
"O15550-1",
"O14686-1",
"P24928-1",
"Q8NEZ4-1",
"P30876-1"
],
"evidence": [
{
"id": "R-HSA-5617866",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617866"
}
]
},
{
"id": "R-HSA-5617867",
"name": "HOXB4 gene is transcribed",
"equation": "",
"summary": "The HOXB4 gene is transcribed to yield mRNA (in embryos in Giampaolo et al. 1989, in carcinoma cells in Simeone et al. 1990). The microRNA miR-23a binds the 3' untranslated region of HOXB4 mRNA (Koller et al 2013). In mouse embryos Hoxb4 mRNA is observed in rhombomere 7, paraxial mesoderm of somite 7, and caudally.",
"cellular_location": "cytosol, nucleoplasm",
"input_participant_list": [
"R-HSA-5617892"
],
"output_participant_list": [
"R-HSA-5617893"
],
"enzyme_list": [
"O15550-1",
"Q09472-1",
"O14686-1",
"P24928-1",
"Q8NEZ4-1",
"Q9Y6Q9-1",
"P30876-1"
],
"evidence": [
{
"id": "R-HSA-5617867",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617867"
}
]
},
{
"id": "R-HSA-5617874",
"name": "HOXD4 gene is transcribed",
"equation": "",
"summary": "The HOXD4 gene is transcribed to yield mRNA (Moroni et al. 1993, Morrison et al. 1996, Morrison et al. 1997). In mouse embryos Hoxd4 mRNA is observed in rhombomere 7 and caudally in spinal cord and prevertebrae. The HOXD4 promoter region is a target of the microRNA miR-10a, which causes repression of transcription (Tan et al. 2009).",
"cellular_location": "cytosol, nucleoplasm",
"input_participant_list": [
"R-HSA-5617853"
],
"output_participant_list": [
"R-HSA-5617878"
],
"enzyme_list": [
"O15550-1",
"Q09472-1",
"O14686-1",
"Q92793-1",
"P24928-1",
"Q8NEZ4-1",
"Q9Y6Q9-1",
"P30876-1"
],
"evidence": [
{
"id": "R-HSA-5617874",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617874"
}
]
},
{
"id": "R-HSA-5617887",
"name": "HOXC4 chromatin is activated",
"equation": "",
"summary": "As inferred from mouse embryos, HOXC4 is expressed at E12.5 caudal to rhombomere 7 (r7) and at the level of prevertebrae 4-5 and caudally. In carcinoma cells treated with retinoic acid (Lee et al. 2007) and primary fibroblasts (Lan et al. 2007) chromatin at HOXC4 loses methylation at lysine-27 of histone H3 (H3K27me3), loses polycomb repressive complex 2 (PRC2), and gains methylation at lysine-4 of histone H3 (H3K4me3). In embryonal carcinoma cells KDM6A (UTX) binds HOXC4 and participates in demethylating H3K27 at HOXC4 (Lee et al. 2007)",
"cellular_location": "nucleoplasm",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"O15550-1",
"O14686-1",
"P24928-1",
"Q8NEZ4-1",
"Q15910-1",
"P30876-1"
],
"evidence": [
{
"id": "R-HSA-5617887",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617887"
}
]
},
{
"id": "R-HSA-5617896",
"name": "Retinoic acid activates HOXD4 chromatin",
"equation": "",
"summary": "As inferred from mouse embryos, retinoic acid activates the HOXD4 gene in rhombomere 7 (r7) by binding RARB or RARA in RAR:RXR receptor dimers bound to a retinoic acid response element (RAREs) in the 5' flanking region of the gene. Ligand binding by retinoic acid receptors causes dismissal of corepressors such as NCOR1 and recruitment of coactivators such as NCOA3 (Klein et al. 2000). The response of HOXD4 to retinoic acid is also observed in human embryonal carcinoma cells (Moroni et al. 1993, Morrison et al. 1996, Morrison et al. 1997). PAX6 binds near the RARE and is required for maximal activation.
In human fibroblasts chromatin at HOXA genes is activated by loss of methylation at lysine-27 (H3K27me3), loss of Polycomb repressive complex 2 (PRC2), and gain of H3K4me3 (Lan et al. 2007). Similar changes occur at Hoxd4 in mouse embryos. The histone demethylase KDM6A (UTX) binds the HOXD4 gene in human lung fibroblasts and may participate in demethylating H3K27me3 (Lan et al. 2007). Other factors may also be involved in demethylation. KDM6A associates with the histone methyltransferases KMT2C,D (MLL2,3) which may participate in methylating H3K4 (Lee et al. 2007). As inferred from mouse homologs, PCGF2 (MEL18) dissociates from Hoxd4 during activation. After activation by retinoic acid, HOXD4 maintains its own expression by binding and activating its own promoter.",
"cellular_location": "nucleoplasm",
"input_participant_list": [
"R-HSA-193545",
"R-HSA-209680",
"R-HSA-381325",
"R-HSA-442488"
],
"output_participant_list": [
"R-HSA-389115"
],
"enzyme_list": [
"O15550-1",
"Q09472-1",
"O14686-1",
"Q92793-1",
"P24928-1",
"Q8NEZ4-1",
"Q9Y6Q9-1",
"Q15910-1",
"P30876-1"
],
"evidence": [
{
"id": "R-HSA-5617896",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617896"
}
]
},
{
"id": "R-HSA-5621002",
"name": "HOXB1 activates HOXB2 expression",
"equation": "",
"summary": "As inferred from mouse embryos, HOXB1 in a trimeric complex with PBX1 and MEIS1 or PKNOX1 (PREP1) binds an enhancer located 5' to the HOXB2 gene and activates expression of HOXB2 in rhombomere 4 (r4). EGR2 (KROX20) activates HOXB2 in r3 and r5 and expression is also observed in r6 and r7.",
"cellular_location": "nucleoplasm",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"O15550-1",
"O14686-1",
"P24928-1",
"Q8NEZ4-1",
"P30876-1"
],
"evidence": [
{
"id": "R-HSA-5621002",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5621002"
}
]
},
{
"id": "R-HSA-5621010",
"name": "HOXB1 activates HOXA2 expression",
"equation": "",
"summary": "As inferred from mouse homologs, HOXA2 expression is driven by HOXB1 in rhombomere 4 (r4) and EGR2 (KROX20) in r3 and r5. HOXB1 together with PBX and PREP/MEIS cofactors bind an element in the intron of HOXA2. (HOXA2 is the only HOX gene active in r2. An unknown activator, possibly a transcription factor of the SOX family, may be involved in expression in r2.)",
"cellular_location": "nucleoplasm",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"O15550-1",
"O14686-1",
"P24928-1",
"Q8NEZ4-1",
"P30876-1"
],
"evidence": [
{
"id": "R-HSA-5621010",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5621010"
}
]
},
{
"id": "R-HSA-5661121",
"name": "KDM6A, KDM6B, KDM7A demethylate Me3K28-histone H3",
"equation": "",
"summary": "All characterized lysine demethylases other than KDM1A belong to the jumonjiC domain (JmjC) containing family.The JmjC KDMs are members of the Cupin superfamily of mononuclear Fe (II) dependent oxygenases, which are characterized by the presence of a double-stranded beta-helix core fold. The JmjC KDMs require 2 oxoglutarate (2 OG) and molecular oxygen as co substrates, producing, along with formaldehyde, succinate and carbon dioxide. This hydroxylation based mechanism does not require a protonatable lysine e amine group and consequently JmjC containing demethylases are able to demethylate tri , di and monomethylated lysines.
KDM6A (UTX), KDM6B (JMJD3), KDM6C (UTY) and KDM7A (JHDM1D) catalyse the demethylation of di or tri-methylated lysine-28 of histone H3 (H3K27Me2/3) (Agger et al. 2007, Cho et al. 2007, De Santra et al. 2007, Hong et al. 2007, Lan et al. 2007, Lee et al. 2007, Horton et al. 2010, Huang et al. 2010, Walport et al. 2014).",
"cellular_location": "nucleoplasm",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"O15054-2",
"O14607-1",
"Q6ZMT4-1",
"O15550-1"
],
"evidence": [
{
"id": "R-HSA-5661121",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5661121"
}
]
},
{
"id": "R-HSA-5693644",
"name": "HOXB1 maintains activation of HOXB1 chromatin",
"equation": "",
"summary": "As inferred from mouse embryos and embryonal carcinoma cells, HOXB1 binds with the PBX1:PKNOX1 (PBX1:PREP1) heterodimer (Berthelsen et al. 1998) and MEIS1at the promoter of the HOXB1 gene to maintain expression after initial activation of HOXB1 by retinoic acid signaling. Binding of SOX:OCT heterodimers to the mouse HOXB1 promoter also appear to positively regulate HOXB1 transcription.",
"cellular_location": "nucleoplasm",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"O15550-1",
"Q09472-1",
"O14686-1",
"P24928-1",
"Q8NEZ4-1",
"Q9Y6Q9-1",
"P30876-1"
],
"evidence": [
{
"id": "R-HSA-5693644",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5693644"
}
]
},
{
"id": "R-HSA-6810139",
"name": "HOXA2 chromatin is activated",
"equation": "",
"summary": "In human cell lines and tissues activation of HOXA2 chromatin by retinoic acid occurs through loss of methylation at lysine-27 of histone H3 (H3K27), dissociation of polycomb repressive complexes, and gain of methylation at H3K4 (Lee et al. 2007 Supplementary, Sakamoto et al. 2007, Sessa et al. 2007). The change in chromatin may be produced by euchromatin spreading from distant 3' retinoic acid response elements. DNA methylation and MBD1 also appear to play a role in maintaining repression at HOXA2 in HeLa cells (Sakamoto et al. 2007). The histone demethylase KDM6A binds HOXA2 (Lee et al. 2007 Supplementary) and may participate in removing H3K27 methylation. KDM6A associates with histone methyltransferases KMT2C,D (MLL2,3) which may participate in methylating H3K4 in embryonal carcinoma cells (Lee et al. 2007, also observed at other HOXA genes in Lan et al. 2007). The conformation of the entire HOXA cluster in the nucleus changes during differentiation of a myeloid leukemia cell line and the conformation changes correlate with gene activity, H3K27me2,3 occurence, and proximity to CTCF binding sites (Rousseau et al. 2014, see also Lonfat and Duboule 2015).",
"cellular_location": "nucleoplasm",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"O15550-1",
"O14686-1",
"Q8NEZ4-1",
"Q15910-1"
],
"evidence": [
{
"id": "R-HSA-6810139",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6810139"
}
]
},
{
"id": "R-HSA-6810158",
"name": "HOXB3 chromatin is activated",
"equation": "",
"summary": "During activation of HOXB3 by retimoic acid in fibroblasts (Lan et al. 2007) and embryonal carcinoma cells (Lee et al. 2007) chromatin at HOXB3 loses methylation at lysine-27 of histone H3 (H3K27me3), loses PRC2, and gains methylation at H3K4. The demethylase KDM6A (UTX) binds HOXB3 chromatin during activation (Lan et al. 2007, Lee et al. 2007) and may participate in demethylating H3K27me3. KDM6A forms complexes with the histone methyltransferases KMT2C,D (MLL2,3) which may participate in methylating H3K4 (Lee et al. 2007)",
"cellular_location": "nucleoplasm",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"O15550-1",
"O14686-1",
"Q8NEZ4-1",
"Q15910-1"
],
"evidence": [
{
"id": "R-HSA-6810158",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6810158"
}
]
},
{
"id": "R-HSA-6810159",
"name": "HOXB2 chromatin is activated",
"equation": "",
"summary": "During activation of HOXB1 by retinoic acid in human embryonal carcinoma cells, methylation at lysine-27 of histone H3 (H3K27me3) is lost and methylation at lysine-4 (H3K4me3) is gained (Lan et al. 2007, Lee et al. 2007). The histone demethylase KDM6A (UTX) binds HOXB2 chromatin and may demethylate H3K27me3 (Lee et al. 2007). Other factors may also participate in demethylation. Loss of H3K27me3 is associated with loss of polycomb repressive complex 2 (PRC2) (Lan et al. 2007, Lee et al. 2007). KDM6A forms complexes with the histone methyltransferases KMT2C,D (MLL2,3) which may participate in methylating H3K4 (Lee et al. 2007). The activation of HOXB1 chromatin may be produced by euchromatin spreading from distant 3' retinoic acid response elements.",
"cellular_location": "nucleoplasm",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"O15550-1",
"O14686-1",
"Q8NEZ4-1",
"Q15910-1"
],
"evidence": [
{
"id": "R-HSA-6810159",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6810159"
}
]
},
{
"id": "R-HSA-6810161",
"name": "HOXA3 chromatin is activated",
"equation": "",
"summary": "In human fibroblasts (Lan et al. 2007) and human embryonic carcinoma cells (Lee et al. 2007, Sessa et al. 2007) treated with retinoic acid HOXA3 chromatin is activated by loss of methylation at lysine-27 of histone H3 (H3K27me3) and gain of H3K4me3. KDM6A (UTX) binds near HOXA3 (Lan et al. 2007, Lee et al. 2007) but does not appear to participate in the loss of H3K27me3. KDM6A forms complexes with the histone methyltransferases KMT2C,D (MLL2,3) which may participate in methylating H3K4 (Lee et al. 2007). Polycomb repressive complex 2 (PRC2), which binds H3K27me3, is also lost during activation of HOXA3 (Lan et al. 2007, Lee et al. 2007, Sessa et al. 2007). The change in chromatin at HOXA3 may result from euchromatin spreading from distant 3' retinoic acid response elements. The chromosomal conformation of the entire HOXA cluster changes during activation (Rousseau et al. 2014).",
"cellular_location": "nucleoplasm",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"O15550-1",
"O14686-1",
"Q8NEZ4-1",
"Q15910-1"
],
"evidence": [
{
"id": "R-HSA-6810161",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6810161"
}
]
},
{
"id": "R-HSA-9821410",
"name": "PAXIP1:PAGR1 complex, NCOA6 and KDM6A bind MLL4 complex",
"equation": "",
"summary": "The MLL4 complex associates with several accessory proteins that act as transcriptional cofactors: the complex of PAXIP1 (also known as PTIP) and PAGR1 (also known as PA1), NCOA6 (also known as ASC-2), and KDM6A (also known as UTX) proteins. The existence of the complex of MLL4, PAXIP1, PAGR1, NCOA6 and KDM6A was established by co-immunoprecipitation of endogenous proteins from mouse and human cells and by functional studies (Cho et al. 2007; Patel et al. 2007; van Nuland et al. 2013; reviewed in Liu and Li 2022). The complex of PAXIP1 and PAGR1 enables the recruitment of the MLL4 complex to PAX2 target genes (Patel et al. 2007). While the complex of PAXIP1 and PAGR1 seems to be an obligatory constituent of the MLL4 complex, not every complex of PAXIP1, PAGR1 and MLL4 contains NCOA6 and KDM6A (van Nuland et al. 2013).",
"cellular_location": "nucleoplasm",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"O15550-1",
"O14686-1"
],
"evidence": [
{
"id": "R-HSA-9821410",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9821410"
}
]
},
{
"id": "R-HSA-9821412",
"name": "PAXIP1:PAGR1 complex, NCOA6 and KDM6A bind MLL3 complex",
"equation": "",
"summary": "The MLL3 complex associates with several accessory proteins that act as transcriptional cofactors: the complex of PAXIP1 (also known as PTIP) and PAGR1 (also known as PA1), NCOA6 (also known as ASC-2), and KDM6A (also known as UTX) proteins. The existence of the complex of MLL3, PAXIP1, PAGR1, NCOA6 and KDM6A was established by co-immunoprecipitation of endogenous proteins from mouse and human cells and by functional studies (Cho et al. 2007; Patel et al. 2007; van Nuland et al. 2013; reviewed in Liu and Li 2022). While the complex of PAXIP1 and PAGR1 seems to be an obligatory constituent of the MLL3 complex, not every complex of PAXIP1, PAGR1 and MLL3 contains NCOA6 and KDM6A (van Nuland et al. 2013).",
"cellular_location": "nucleoplasm",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"O15550-1",
"Q8NEZ4-1"
],
"evidence": [
{
"id": "R-HSA-9821412",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9821412"
}
]
},
{
"id": "R-HSA-9822985",
"name": "KDM6A (UTX) demethylates histone H3 trimethyllysine-27 (H3K27me3)",
"equation": "",
"summary": "KDM6A (UTX) demethylates histone H3 trimethyllysine-27 (H3K27me3, lysine-28 of the preprotein) to yield histone H3 monomethyllysine-27 (H3K27me1) in embryonic cells (Agger et al. 2007, Hong et al. 2007, Lan et al. 2007) and is inferred to catalyze the same reaction in zygotes. KDM6A participates in demethylating genome-wide H3K27me3 in cleavage stage embryos (inferred from mouse homologs).",
"cellular_location": "nucleoplasm",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"O15550-1"
],
"evidence": [
{
"id": "R-HSA-9822985",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9822985"
}
]
}
],
"reaction_participants": [
{
"participant_id": "R-ALL-5334804",
"participant_name": "atRA [nucleoplasm]",
"crossref": [
{
"id": "15367",
"database": "ChEBI",
"url": ""
},
{
"id": "000012358651",
"database": "ZINC",
"url": ""
},
{
"id": "HMDB0001852",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "2644",
"database": "Guide to Pharmacology - Ligands",
"url": ""
},
{
"id": "C00777",
"database": "COMPOUND",
"url": ""
},
{
"id": "C00777",
"database": "COMPOUND",
"url": ""
},
{
"id": "15367",
"database": "ChEBI",
"url": ""
},
{
"id": "000012358651",
"database": "ZINC",
"url": ""
},
{
"id": "HMDB0001852",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "2644",
"database": "Guide to Pharmacology - Ligands",
"url": ""
}
]
},
{
"participant_id": "R-HSA-193545",
"participant_name": "CREBBP [nucleoplasm]",
"crossref": [
{
"id": "Q92793",
"database": "UniProt",
"url": ""
},
{
"id": "1WO6",
"database": "PDB",
"url": ""
},
{
"id": "7XM7",
"database": "PDB",
"url": ""
},
{
"id": "1WO5",
"database": "PDB",
"url": ""
},
{
"id": "6DMK",
"database": "PDB",
"url": ""
},
{
"id": "5H85",
"database": "PDB",
"url": ""
},
{
"id": "7XIJ",
"database": "PDB",
"url": ""
},
{
"id": "5GH9",
"database": "PDB",
"url": ""
},
{
"id": "1WO4",
"database": "PDB",
"url": ""
},
{
"id": "6AY5",
"database": "PDB",
"url": ""
},
{
"id": "6ES6",
"database": "PDB",
"url": ""
},
{
"id": "5I86",
"database": "PDB",
"url": ""
},
{
"id": "1ZOQ",
"database": "PDB",
"url": ""
},
{
"id": "7XNG",
"database": "PDB",
"url": ""
},
{
"id": "5I89",
"database": "PDB",
"url": ""
},
{
"id": "6ES5",
"database": "PDB",
"url": ""
},
{
"id": "1WO7",
"database": "PDB",
"url": ""
},
{
"id": "Q92793",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "5I83",
"database": "PDB",
"url": ""
},
{
"id": "7XNE",
"database": "PDB",
"url": ""
},
{
"id": "6FQT",
"database": "PDB",
"url": ""
},
{
"id": "2KWF",
"database": "PDB",
"url": ""
},
{
"id": "CBP_HUMAN",
"database": "ZINC - Substances",
"url": ""
},
{
"id": "8HAN",
"database": "PDB",
"url": ""
},
{
"id": "6FQO",
"database": "PDB",
"url": ""
},
{
"id": "5I8G",
"database": "PDB",
"url": ""
},
{
"id": "2KJE",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000005339",
"database": "OpenTargets",
"url": ""
},
{
"id": "8HAM",
"database": "PDB",
"url": ""
},
{
"id": "6ES7",
"database": "PDB",
"url": ""
},
{
"id": "2D82",
"database": "PDB",
"url": ""
},
{
"id": "15801",
"database": "Orphanet",
"url": ""
},
{
"id": "8HAL",
"database": "PDB",
"url": ""
},
{
"id": "5I8B",
"database": "PDB",
"url": ""
},
{
"id": "2LXS",
"database": "PDB",
"url": ""
},
{
"id": "5JEM",
"database": "PDB",
"url": ""
},
{
"id": "2L85",
"database": "PDB",
"url": ""
},
{
"id": "5J0D",
"database": "PDB",
"url": ""
},
{
"id": "6FR0",
"database": "PDB",
"url": ""
},
{
"id": "6FQU",
"database": "PDB",
"url": ""
},
{
"id": "2L84",
"database": "PDB",
"url": ""
},
{
"id": "4TS8",
"database": "PDB",
"url": ""
},
{
"id": "5W0E",
"database": "PDB",
"url": ""
},
{
"id": "7KPY",
"database": "PDB",
"url": ""
},
{
"id": "5W0F",
"database": "PDB",
"url": ""
},
{
"id": "4TQN",
"database": "PDB",
"url": ""
},
{
"id": "2734",
"database": "Guide to Pharmacology - Targets",
"url": ""
},
{
"id": "5TB6",
"database": "PDB",
"url": ""
},
{
"id": "7JUO",
"database": "PDB",
"url": ""
},
{
"id": "7TBH",
"database": "PDB",
"url": ""
},
{
"id": "5XXH",
"database": "PDB",
"url": ""
},
{
"id": "5W0Q",
"database": "PDB",
"url": ""
},
{
"id": "4YK0",
"database": "PDB",
"url": ""
},
{
"id": "7TB3",
"database": "PDB",
"url": ""
},
{
"id": "7RLE",
"database": "PDB",
"url": ""
},
{
"id": "5W0L",
"database": "PDB",
"url": ""
},
{
"id": "4WHU",
"database": "PDB",
"url": ""
},
{
"id": "1JSP",
"database": "PDB",
"url": ""
},
{
"id": "5EIC",
"database": "PDB",
"url": ""
},
{
"id": "7WX2",
"database": "PDB",
"url": ""
},
{
"id": "5DBM",
"database": "PDB",
"url": ""
},
{
"id": "6ALC",
"database": "PDB",
"url": ""
},
{
"id": "5CGP",
"database": "PDB",
"url": ""
},
{
"id": "6ALB",
"database": "PDB",
"url": ""
},
{
"id": "1RDT",
"database": "PDB",
"url": ""
},
{
"id": "5EP7",
"database": "PDB",
"url": ""
},
{
"id": "7XI0",
"database": "PDB",
"url": ""
},
{
"id": "1WO3",
"database": "PDB",
"url": ""
},
{
"id": "6AY3",
"database": "PDB",
"url": ""
},
{
"id": "Q92793",
"database": "ZINC target",
"url": ""
},
{
"id": "1LIQ",
"database": "PDB",
"url": ""
},
{
"id": "7XHE",
"database": "PDB",
"url": ""
},
{
"id": "5ENG",
"database": "PDB",
"url": ""
},
{
"id": "7XH6",
"database": "PDB",
"url": ""
},
{
"id": "6AXQ",
"database": "PDB",
"url": ""
},
{
"id": "6YIK",
"database": "PDB",
"url": ""
},
{
"id": "5MQE",
"database": "PDB",
"url": ""
},
{
"id": "4NR4",
"database": "PDB",
"url": ""
},
{
"id": "5MPZ",
"database": "PDB",
"url": ""
},
{
"id": "4N4F",
"database": "PDB",
"url": ""
},
{
"id": "6YIJ",
"database": "PDB",
"url": ""
},
{
"id": "Q92793",
"database": "PRO",
"url": ""
},
{
"id": "ENSG00000005339-CREBBP",
"database": "HPA",
"url": ""
},
{
"id": "5MQK",
"database": "PDB",
"url": ""
},
{
"id": "6YIM",
"database": "PDB",
"url": ""
},
{
"id": "6YIL",
"database": "PDB",
"url": ""
},
{
"id": "5MQG",
"database": "PDB",
"url": ""
},
{
"id": "4NR6",
"database": "PDB",
"url": ""
},
{
"id": "4NR5",
"database": "PDB",
"url": ""
},
{
"id": "5NU3",
"database": "PDB",
"url": ""
},
{
"id": "7EVJ",
"database": "PDB",
"url": ""
},
{
"id": "5NRW",
"database": "PDB",
"url": ""
},
{
"id": "7CO1",
"database": "PDB",
"url": ""
},
{
"id": "5NLK",
"database": "PDB",
"url": ""
},
{
"id": "4NYV",
"database": "PDB",
"url": ""
},
{
"id": "4NR7",
"database": "PDB",
"url": ""
},
{
"id": "4OUF",
"database": "PDB",
"url": ""
},
{
"id": "7JFM",
"database": "PDB",
"url": ""
},
{
"id": "5SVH",
"database": "PDB",
"url": ""
},
{
"id": "NP_004371.2",
"database": "RefSeq",
"url": ""
},
{
"id": "NP_001073315.1",
"database": "RefSeq",
"url": ""
},
{
"id": "4NYX",
"database": "PDB",
"url": ""
},
{
"id": "4NYW",
"database": "PDB",
"url": ""
},
{
"id": "7JFL",
"database": "PDB",
"url": ""
},
{
"id": "5OWK",
"database": "PDB",
"url": ""
},
{
"id": "5KTX",
"database": "PDB",
"url": ""
},
{
"id": "3SVH",
"database": "PDB",
"url": ""
},
{
"id": "5MPK",
"database": "PDB",
"url": ""
},
{
"id": "6SQM",
"database": "PDB",
"url": ""
},
{
"id": "4A9K",
"database": "PDB",
"url": ""
},
{
"id": "4N3W",
"database": "PDB",
"url": ""
},
{
"id": "5MPN",
"database": "PDB",
"url": ""
},
{
"id": "6SXX",
"database": "PDB",
"url": ""
},
{
"id": "6SQE",
"database": "PDB",
"url": ""
},
{
"id": "3P1D",
"database": "PDB",
"url": ""
},
{
"id": "3P1E",
"database": "PDB",
"url": ""
},
{
"id": "5MME",
"database": "PDB",
"url": ""
},
{
"id": "Q92793",
"database": "GeneCards",
"url": ""
},
{
"id": "5MMG",
"database": "PDB",
"url": ""
},
{
"id": "CBP_HUMAN",
"database": "ZINC - Predictions - Purchasable",
"url": ""
},
{
"id": "6SQF",
"database": "PDB",
"url": ""
},
{
"id": "3P1F",
"database": "PDB",
"url": ""
},
{
"id": "2RNY",
"database": "PDB",
"url": ""
},
{
"id": "5LPJ",
"database": "PDB",
"url": ""
},
{
"id": "6M64",
"database": "PDB",
"url": ""
},
{
"id": "3DWY",
"database": "PDB",
"url": ""
},
{
"id": "6QST",
"database": "PDB",
"url": ""
},
{
"id": "ENSP00000371502",
"database": "Ensembl",
"url": ""
},
{
"id": "HMDBP00014",
"database": "HMDB Protein",
"url": ""
},
{
"id": "ENST00000382070",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSG00000005339",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSP00000262367",
"database": "Ensembl",
"url": ""
},
{
"id": "ENST00000262367",
"database": "Ensembl",
"url": ""
},
{
"id": "3P1C",
"database": "PDB",
"url": ""
},
{
"id": "5LPL",
"database": "PDB",
"url": ""
},
{
"id": "5KTU",
"database": "PDB",
"url": ""
},
{
"id": "6FRF",
"database": "PDB",
"url": ""
},
{
"id": "2LXT",
"database": "PDB",
"url": ""
},
{
"id": "6LQX",
"database": "PDB",
"url": ""
},
{
"id": "2N1A",
"database": "PDB",
"url": ""
},
{
"id": "5KTW",
"database": "PDB",
"url": ""
}
]
},
{
"participant_id": "R-HSA-209680",
"participant_name": "RNA Polymerase II holoenzyme complex (generic) [nucleoplasm]",
"crossref": [
{
"id": "CPX-7481",
"database": "ComplexPortal",
"url": ""
}
]
},
{
"participant_id": "R-HSA-381325",
"participant_name": "EP300 [nucleoplasm]",
"crossref": [
{
"id": "Q09472",
"database": "UniProt",
"url": ""
},
{
"id": "2735",
"database": "Guide to Pharmacology - Targets",
"url": ""
},
{
"id": "7XEZ",
"database": "PDB",
"url": ""
},
{
"id": "3T92",
"database": "PDB",
"url": ""
},
{
"id": "6GYT",
"database": "PDB",
"url": ""
},
{
"id": "6GYR",
"database": "PDB",
"url": ""
},
{
"id": "ENSG00000100393",
"database": "OpenTargets",
"url": ""
},
{
"id": "ENSG00000100393-EP300",
"database": "HPA",
"url": ""
},
{
"id": "6FGS",
"database": "PDB",
"url": ""
},
{
"id": "7W9V",
"database": "PDB",
"url": ""
},
{
"id": "3P57",
"database": "PDB",
"url": ""
},
{
"id": "4PZS",
"database": "PDB",
"url": ""
},
{
"id": "6V8B",
"database": "PDB",
"url": ""
},
{
"id": "6PGU",
"database": "PDB",
"url": ""
},
{
"id": "6PF1",
"database": "PDB",
"url": ""
},
{
"id": "8E1D",
"database": "PDB",
"url": ""
},
{
"id": "4PZR",
"database": "PDB",
"url": ""
},
{
"id": "7XFG",
"database": "PDB",
"url": ""
},
{
"id": "4BHW",
"database": "PDB",
"url": ""
},
{
"id": "HMDBP00011",
"database": "HMDB Protein",
"url": ""
},
{
"id": "6K4N",
"database": "PDB",
"url": ""
},
{
"id": "5BT3",
"database": "PDB",
"url": ""
},
{
"id": "8HAI",
"database": "PDB",
"url": ""
},
{
"id": "6V8N",
"database": "PDB",
"url": ""
},
{
"id": "Q09472",
"database": "GeneCards",
"url": ""
},
{
"id": "4PZT",
"database": "PDB",
"url": ""
},
{
"id": "6V8K",
"database": "PDB",
"url": ""
},
{
"id": "8HAH",
"database": "PDB",
"url": ""
},
{
"id": "8HAG",
"database": "PDB",
"url": ""
},
{
"id": "8GZC",
"database": "PDB",
"url": ""
},
{
"id": "8HAK",
"database": "PDB",
"url": ""
},
{
"id": "Q09472",
"database": "PRO",
"url": ""
},
{
"id": "5LKT",
"database": "PDB",
"url": ""
},
{
"id": "7LJE",
"database": "PDB",
"url": ""
},
{
"id": "8HAJ",
"database": "PDB",
"url": ""
},
{
"id": "6V90",
"database": "PDB",
"url": ""
},
{
"id": "15982",
"database": "Orphanet",
"url": ""
},
{
"id": "2MZD",
"database": "PDB",
"url": ""
},
{
"id": "7VHZ",
"database": "PDB",
"url": ""
},
{
"id": "6DS6",
"database": "PDB",
"url": ""
},
{
"id": "3IO2",
"database": "PDB",
"url": ""
},
{
"id": "7VI0",
"database": "PDB",
"url": ""
},
{
"id": "6FGN",
"database": "PDB",
"url": ""
},
{
"id": "3BIY",
"database": "PDB",
"url": ""
},
{
"id": "3I3J",
"database": "PDB",
"url": ""
},
{
"id": "EP300_HUMAN",
"database": "ZINC - Predictions - Purchasable",
"url": ""
},
{
"id": "EP300_HUMAN",
"database": "ZINC - Biogenic",
"url": ""
},
{
"id": "5NU5",
"database": "PDB",
"url": ""
},
{
"id": "2K8F",
"database": "PDB",
"url": ""
},
{
"id": "7UGI",
"database": "PDB",
"url": ""
},
{
"id": "2MH0",
"database": "PDB",
"url": ""
},
{
"id": "7VHY",
"database": "PDB",
"url": ""
},
{
"id": "EP300_HUMAN",
"database": "ZINC - Substances",
"url": ""
},
{
"id": "5XZC",
"database": "PDB",
"url": ""
},
{
"id": "Q09472",
"database": "ZINC target",
"url": ""
},
{
"id": "NP_001420.2",
"database": "RefSeq",
"url": ""
},
{
"id": "7SSK",
"database": "PDB",
"url": ""
},
{
"id": "1L3E",
"database": "PDB",
"url": ""
},
{
"id": "1P4Q",
"database": "PDB",
"url": ""
},
{
"id": "5LPK",
"database": "PDB",
"url": ""
},
{
"id": "EP300_HUMAN",
"database": "ZINC - Metabolites",
"url": ""
},
{
"id": "5LPM",
"database": "PDB",
"url": ""
},
{
"id": "7SZQ",
"database": "PDB",
"url": ""
},
{
"id": "7QGS",
"database": "PDB",
"url": ""
},
{
"id": "5LKU",
"database": "PDB",
"url": ""
},
{
"id": "ENST00000263253",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSP00000263253",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSG00000100393",
"database": "Ensembl",
"url": ""
},
{
"id": "7SS8",
"database": "PDB",
"url": ""
},
{
"id": "5LKX",
"database": "PDB",
"url": ""
},
{
"id": "Q09472",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "5LKZ",
"database": "PDB",
"url": ""
},
{
"id": "5KJ2",
"database": "PDB",
"url": ""
}
]
},
{
"participant_id": "R-HSA-389115",
"participant_name": "PCGF2 [nucleoplasm]",
"crossref": [
{
"id": "ENSP00000482815",
"database": "Ensembl",
"url": ""
},
{
"id": "XP_005257697.1",
"database": "RefSeq",
"url": ""
},
{
"id": "ENSP00000478970",
"database": "Ensembl",
"url": ""
},
{
"id": "ENST00000631610",
"database": "Ensembl",
"url": ""
},
{
"id": "P35227",
"database": "PRO",
"url": ""
},
{
"id": "ENST00000610440",
"database": "Ensembl",
"url": ""
},
{
"id": "P35227",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "ENST00000611883",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSG00000277258",
"database": "Ensembl",
"url": ""
},
{
"id": "XP_005257699.1",
"database": "RefSeq",
"url": ""
},
{
"id": "P35227",
"database": "UniProt",
"url": ""
},
{
"id": "ENSG00000277258",
"database": "OpenTargets",
"url": ""
},
{
"id": "ENST00000616199",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSG00000277258-PCGF2",
"database": "HPA",
"url": ""
},
{
"id": "ENST00000631566",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSP00000482063",
"database": "Ensembl",
"url": ""
},
{
"id": "24790",
"database": "Orphanet",
"url": ""
},
{
"id": "ENSG00000278644",
"database": "Ensembl",
"url": ""
},
{
"id": "XP_005257698.1",
"database": "RefSeq",
"url": ""
},
{
"id": "ENSP00000478517",
"database": "Ensembl",
"url": ""
},
{
"id": "ENST00000620225",
"database": "Ensembl",
"url": ""
},
{
"id": "NP_009075.1",
"database": "RefSeq",
"url": ""
},
{
"id": "P35227",
"database": "GeneCards",
"url": ""
},
{
"id": "XP_016880505.1",
"database": "RefSeq",
"url": ""
},
{
"id": "ENSP00000488872",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSP00000488868",
"database": "Ensembl",
"url": ""
}
]
},
{
"participant_id": "R-HSA-442488",
"participant_name": "NCOA3 [nucleoplasm]",
"crossref": [
{
"id": "Q9Y6Q9",
"database": "UniProt",
"url": ""
},
{
"id": "ENST00000372004",
"database": "Ensembl",
"url": ""
},
{
"id": "Q9Y6Q9",
"database": "PRO",
"url": ""
},
{
"id": "ENSP00000361065",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSP00000361073",
"database": "Ensembl",
"url": ""
},
{
"id": "ENST00000371998",
"database": "Ensembl",
"url": ""
},
{
"id": "2695",
"database": "Guide to Pharmacology - Targets",
"url": ""
},
{
"id": "ENSG00000124151",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSP00000361066",
"database": "Ensembl",
"url": ""
},
{
"id": "3L3Z",
"database": "PDB",
"url": ""
},
{
"id": "ENST00000371997",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSG00000124151",
"database": "OpenTargets",
"url": ""
},
{
"id": "HMDBP00026",
"database": "HMDB Protein",
"url": ""
},
{
"id": "Q9Y6Q9",
"database": "GeneCards",
"url": ""
},
{
"id": "ENSG00000124151-NCOA3",
"database": "HPA",
"url": ""
},
{
"id": "1KBH",
"database": "PDB",
"url": ""
},
{
"id": "6ES7",
"database": "PDB",
"url": ""
},
{
"id": "6SQC",
"database": "PDB",
"url": ""
},
{
"id": "NP_001167559.1",
"database": "RefSeq",
"url": ""
},
{
"id": "NP_006525.2",
"database": "RefSeq",
"url": ""
},
{
"id": "3L3X",
"database": "PDB",
"url": ""
},
{
"id": "25755",
"database": "Orphanet",
"url": ""
},
{
"id": "NP_858045.1",
"database": "RefSeq",
"url": ""
},
{
"id": "Q9Y6Q9",
"database": "Pharos - Targets",
"url": ""
}
]
},
{
"participant_id": "R-HSA-5617426",
"participant_name": "HOXA1 gene [nucleoplasm]",
"crossref": [
{
"id": "ENSG00000105991",
"database": "ENSEMBL",
"url": ""
}
]
},
{
"participant_id": "R-HSA-5617439",
"participant_name": "HOXA1 mRNA [cytosol]",
"crossref": [
{
"id": "ENST00000343060",
"database": "ENSEMBL",
"url": ""
}
]
},
{
"participant_id": "R-HSA-5617450",
"participant_name": "HOXB1 gene [nucleoplasm]",
"crossref": [
{
"id": "ENSG00000120094",
"database": "ENSEMBL",
"url": ""
}
]
},
{
"participant_id": "R-HSA-5617481",
"participant_name": "HOXA2 mRNA [cytosol]",
"crossref": [
{
"id": "ENST00000222718",
"database": "ENSEMBL",
"url": ""
}
]
},
{
"participant_id": "R-HSA-5617488",
"participant_name": "HOXB2 mRNA [cytosol]",
"crossref": [
{
"id": "ENST00000330070",
"database": "ENSEMBL",
"url": ""
}
]
},
{
"participant_id": "R-HSA-5617497",
"participant_name": "HOXA2 gene [nucleoplasm]",
"crossref": [
{
"id": "ENSG00000105996",
"database": "ENSEMBL",
"url": ""
}
]
},
{
"participant_id": "R-HSA-5617499",
"participant_name": "HOXB2 gene [nucleoplasm]",
"crossref": [
{
"id": "ENSG00000173917",
"database": "ENSEMBL",
"url": ""
}
]
},
{
"participant_id": "R-HSA-5617647",
"participant_name": "HOXA3 gene [nucleoplasm]",
"crossref": [
{
"id": "ENSG00000105997",
"database": "ENSEMBL",
"url": ""
}
]
},
{
"participant_id": "R-HSA-5617656",
"participant_name": "HOXB3 mRNA [cytosol]",
"crossref": [
{
"id": "ENST00000311626",
"database": "ENSEMBL",
"url": ""
}
]
},
{
"participant_id": "R-HSA-5617658",
"participant_name": "HOXB3 gene [nucleoplasm]",
"crossref": [
{
"id": "ENSG00000120093",
"database": "ENSEMBL",
"url": ""
}
]
},
{
"participant_id": "R-HSA-5617670",
"participant_name": "HOXA3 mRNA [cytosol]",
"crossref": [
{
"id": "ENST00000317201",
"database": "ENSEMBL",
"url": ""
}
]
},
{
"participant_id": "R-HSA-5617853",
"participant_name": "HOXD4 gene [nucleoplasm]",
"crossref": [
{
"id": "ENSG00000170166",
"database": "ENSEMBL",
"url": ""
}
]
},
{
"participant_id": "R-HSA-5617863",
"participant_name": "HOXC4 gene [nucleoplasm]",
"crossref": [
{
"id": "ENSG00000198353",
"database": "ENSEMBL",
"url": ""
}
]
},
{
"participant_id": "R-HSA-5617868",
"participant_name": "HOXC4 mRNA [cytosol]",
"crossref": [
{
"id": "ENST00000303406",
"database": "ENSEMBL",
"url": ""
}
]
},
{
"participant_id": "R-HSA-5617878",
"participant_name": "HOXD4 mRNA [cytosol]",
"crossref": [
{
"id": "ENST00000306324",
"database": "ENSEMBL",
"url": ""
}
]
},
{
"participant_id": "R-HSA-5617892",
"participant_name": "HOXB4 gene [nucleoplasm]",
"crossref": [
{
"id": "ENSG00000182742",
"database": "ENSEMBL",
"url": ""
}
]
},
{
"participant_id": "R-HSA-5617893",
"participant_name": "HOXB4 mRNA [cytosol]",
"crossref": [
{
"id": "ENST00000332503",
"database": "ENSEMBL",
"url": ""
}
]
},
{
"participant_id": "R-HSA-5687935",
"participant_name": "AJUBA [nucleoplasm]",
"crossref": [
{
"id": "ENST00000262713",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSG00000129474",
"database": "Ensembl",
"url": ""
},
{
"id": "NP_001276026.1",
"database": "RefSeq",
"url": ""
},
{
"id": "Q96IF1",
"database": "UniProt",
"url": ""
},
{
"id": "ENSG00000129474",
"database": "OpenTargets",
"url": ""
},
{
"id": "ENSP00000380543",
"database": "Ensembl",
"url": ""
},
{
"id": "Q96IF1",
"database": "Pharos - Targets",
"url": ""
},
{
"id": "ENSP00000262713",
"database": "Ensembl",
"url": ""
},
{
"id": "ENSG00000129474-AJUBA",
"database": "HPA",
"url": ""
},
{
"id": "HMDBP14098",
"database": "HMDB Protein",
"url": ""
},
{
"id": "NP_932352.1",
"database": "RefSeq",
"url": ""
},
{
"id": "Q96IF1",
"database": "GeneCards",
"url": ""
},
{
"id": "Q96IF1",
"database": "PRO",
"url": ""
},
{
"id": "NP_116265.1",
"database": "RefSeq",
"url": ""
},
{
"id": "ENST00000397388",
"database": "Ensembl",
"url": ""
}
]
}
],
"reaction_enzymes": [
{
"uniprot_ac": "A0A8I5ZM74",
"gene_name": "Kdm6a",
"activity": [
{
"ec_number": "1.14.11.68",
"activity": "2 2-oxoglutarate + N(6),N(6),N(6)-trimethyl-L-lysyl(27)-[histone H3] + 2 O2 = 2 CO2 + 2 formaldehyde + N(6)-methyl-L-lysyl(27)-[histone H3] + 2 succinate.",
"evidence": [
{
"id": "A0A8I5ZM74",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A0A8I5ZM74"
}
]
},
{
"ec_number": "1.14.11.68",
"activity": "",
"evidence": [
{
"id": "A0A8I5ZM74",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A0A8I5ZM74"
}
]
}
]
},
{
"uniprot_ac": "A0A8I6AFH2",
"gene_name": "Kdm6b",
"activity": [
{
"ec_number": "1.14.11.68",
"activity": "2 2-oxoglutarate + N(6),N(6),N(6)-trimethyl-L-lysyl(27)-[histone H3] + 2 O2 = 2 CO2 + 2 formaldehyde + N(6)-methyl-L-lysyl(27)-[histone H3] + 2 succinate.",
"evidence": [
{
"id": "A0A8I6AFH2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A0A8I6AFH2"
}
]
},
{
"ec_number": "1.14.11.68",
"activity": "",
"evidence": [
{
"id": "A0A8I6AFH2",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A0A8I6AFH2"
}
]
}
]
},
{
"uniprot_ac": "A0A8I6GMK8",
"gene_name": "Uty",
"activity": [
{
"ec_number": "1.14.11.68",
"activity": "2 2-oxoglutarate + N(6),N(6),N(6)-trimethyl-L-lysyl(27)-[histone H3] + 2 O2 = 2 CO2 + 2 formaldehyde + N(6)-methyl-L-lysyl(27)-[histone H3] + 2 succinate.",
"evidence": [
{
"id": "A0A8I6GMK8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A0A8I6GMK8"
}
]
},
{
"ec_number": "1.14.11.68",
"activity": "",
"evidence": [
{
"id": "A0A8I6GMK8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/A0A8I6GMK8"
}
]
}
]
},
{
"uniprot_ac": "O14607",
"gene_name": "UTY",
"activity": [
{
"ec_number": "1.14.11.68",
"activity": "2 2-oxoglutarate + N(6),N(6),N(6)-trimethyl-L-lysyl(27)-[histone H3] + 2 O2 = 2 CO2 + 2 formaldehyde + N(6)-methyl-L-lysyl(27)-[histone H3] + 2 succinate.",
"evidence": [
{
"id": "O14607",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O14607"
}
]
},
{
"ec_number": "1.14.11.68",
"activity": "",
"evidence": [
{
"id": "O14607",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O14607"
}
]
}
]
},
{
"uniprot_ac": "O14686",
"gene_name": "KMT2D",
"activity": [
{
"ec_number": "2.1.1.364",
"activity": "L-lysyl(4)-[histone H3] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl(4)-[histone H3] + S-adenosyl-L-homocysteine.",
"evidence": [
{
"id": "O14686",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O14686"
}
]
},
{
"ec_number": "2.1.1.364",
"activity": "",
"evidence": [
{
"id": "O14686",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O14686"
}
]
}
]
},
{
"uniprot_ac": "O15054",
"gene_name": "KDM6B",
"activity": [
{
"ec_number": "1.14.11.68",
"activity": "2 2-oxoglutarate + N(6),N(6),N(6)-trimethyl-L-lysyl(27)-[histone H3] + 2 O2 = 2 CO2 + 2 formaldehyde + N(6)-methyl-L-lysyl(27)-[histone H3] + 2 succinate.",
"evidence": [
{
"id": "O15054",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O15054"
}
]
},
{
"ec_number": "1.14.11.68",
"activity": "",
"evidence": [
{
"id": "O15054",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O15054"
}
]
}
]
},
{
"uniprot_ac": "O15379",
"gene_name": "HDAC3",
"activity": [
{
"ec_number": "3.5.1.98",
"activity": "H2O + N(6)-acetyl-L-lysyl-[histone] = acetate + L-lysyl-[histone].",
"evidence": [
{
"id": "O15379",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O15379"
}
]
},
{
"ec_number": "3.5.1.98",
"activity": "",
"evidence": [
{
"id": "O15379",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O15379"
}
]
},
{
"ec_number": "3.5.1.-",
"activity": "",
"evidence": [
{
"id": "O15379",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O15379"
}
]
}
]
},
{
"uniprot_ac": "O15550",
"gene_name": "KDM6A",
"activity": [
{
"ec_number": "1.14.11.68",
"activity": "2 2-oxoglutarate + N(6),N(6),N(6)-trimethyl-L-lysyl(27)-[histone H3] + 2 O2 = 2 CO2 + 2 formaldehyde + N(6)-methyl-L-lysyl(27)-[histone H3] + 2 succinate.",
"evidence": [
{
"id": "O15550",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O15550"
}
]
},
{
"ec_number": "1.14.11.68",
"activity": "",
"evidence": [
{
"id": "O15550",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O15550"
}
]
}
]
},
{
"uniprot_ac": "O70546",
"gene_name": "Kdm6a",
"activity": [
{
"ec_number": "1.14.11.68",
"activity": "2 2-oxoglutarate + N(6),N(6),N(6)-trimethyl-L-lysyl(27)-[histone H3] + 2 O2 = 2 CO2 + 2 formaldehyde + N(6)-methyl-L-lysyl(27)-[histone H3] + 2 succinate.",
"evidence": [
{
"id": "O70546",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O70546"
}
]
},
{
"ec_number": "1.14.11.68",
"activity": "",
"evidence": [
{
"id": "O70546",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O70546"
}
]
}
]
},
{
"uniprot_ac": "O75928",
"gene_name": "PIAS2",
"activity": [
{
"ec_number": "2.3.2.-",
"activity": "",
"evidence": [
{
"id": "O75928",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O75928"
}
]
}
]
},
{
"uniprot_ac": "P11161",
"gene_name": "EGR2",
"activity": [
{
"ec_number": "2.3.2.-",
"activity": "",
"evidence": [
{
"id": "P11161",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P11161"
}
]
}
]
},
{
"uniprot_ac": "P24928",
"gene_name": "POLR2A",
"activity": [
{
"ec_number": "2.7.7.6",
"activity": "a ribonucleoside 5'-triphosphate + RNA(n) = diphosphate + RNA(n+1).",
"evidence": [
{
"id": "P24928",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P24928"
}
]
},
{
"ec_number": "2.7.7.6",
"activity": "",
"evidence": [
{
"id": "P24928",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P24928"
}
]
},
{
"ec_number": "2.7.7.48",
"activity": "a ribonucleoside 5'-triphosphate + RNA(n) = diphosphate + RNA(n+1).",
"evidence": [
{
"id": "P24928",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P24928"
}
]
}
]
},
{
"uniprot_ac": "P30876",
"gene_name": "POLR2B",
"activity": [
{
"ec_number": "2.7.7.6",
"activity": "a ribonucleoside 5'-triphosphate + RNA(n) = diphosphate + RNA(n+1).",
"evidence": [
{
"id": "P30876",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P30876"
}
]
},
{
"ec_number": "2.7.7.6",
"activity": "",
"evidence": [
{
"id": "P30876",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P30876"
}
]
}
]
},
{
"uniprot_ac": "P79457",
"gene_name": "Uty",
"activity": [
{
"ec_number": "1.14.11.68",
"activity": "2 2-oxoglutarate + N(6),N(6),N(6)-trimethyl-L-lysyl(27)-[histone H3] + 2 O2 = 2 CO2 + 2 formaldehyde + N(6)-methyl-L-lysyl(27)-[histone H3] + 2 succinate.",
"evidence": [
{
"id": "P79457",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P79457"
}
]
},
{
"ec_number": "1.14.11.68",
"activity": "",
"evidence": [
{
"id": "P79457",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P79457"
}
]
}
]
},
{
"uniprot_ac": "Q09472",
"gene_name": "EP300",
"activity": [
{
"ec_number": "2.3.1.48",
"activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].",
"evidence": [
{
"id": "Q09472",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q09472"
}
]
},
{
"ec_number": "2.3.1.-",
"activity": "",
"evidence": [
{
"id": "Q09472",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q09472"
}
]
},
{
"ec_number": "2.3.1.48",
"activity": "",
"evidence": [
{
"id": "Q09472",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q09472"
}
]
}
]
},
{
"uniprot_ac": "Q15910",
"gene_name": "EZH2",
"activity": [
{
"ec_number": "2.1.1.356",
"activity": "L-lysyl(27)-[histone H3] + 3 S-adenosyl-L-methionine = 3 H(+) + N(6),N(6),N(6)-trimethyl-L-lysyl(27)-[histone H3] + 3 S-adenosyl-L-homocysteine.",
"evidence": [
{
"id": "Q15910",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q15910"
}
]
},
{
"ec_number": "2.1.1.356",
"activity": "",
"evidence": [
{
"id": "Q15910",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q15910"
}
]
}
]
},
{
"uniprot_ac": "Q5NCY0",
"gene_name": "Kdm6b",
"activity": [
{
"ec_number": "1.14.11.68",
"activity": "2 2-oxoglutarate + N(6),N(6),N(6)-trimethyl-L-lysyl(27)-[histone H3] + 2 O2 = 2 CO2 + 2 formaldehyde + N(6)-methyl-L-lysyl(27)-[histone H3] + 2 succinate.",
"evidence": [
{
"id": "Q5NCY0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5NCY0"
}
]
},
{
"ec_number": "1.14.11.68",
"activity": "",
"evidence": [
{
"id": "Q5NCY0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5NCY0"
}
]
}
]
},
{
"uniprot_ac": "Q6ZMT4",
"gene_name": "KDM7A",
"activity": [
{
"ec_number": "1.14.11.65",
"activity": "2 2-oxoglutarate + N(6),N(6)-dimethyl-L-lysyl(9)-[histone H3] + 2 O2 = 2 CO2 + 2 formaldehyde + L-lysyl(9)-[histone H3] + 2 succinate.",
"evidence": [
{
"id": "Q6ZMT4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q6ZMT4"
}
]
}
]
},
{
"uniprot_ac": "Q8NEZ4",
"gene_name": "KMT2C",
"activity": [
{
"ec_number": "2.1.1.364",
"activity": "L-lysyl(4)-[histone H3] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl(4)-[histone H3] + S-adenosyl-L-homocysteine.",
"evidence": [
{
"id": "Q8NEZ4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8NEZ4"
}
]
},
{
"ec_number": "2.1.1.364",
"activity": "",
"evidence": [
{
"id": "Q8NEZ4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8NEZ4"
}
]
}
]
},
{
"uniprot_ac": "Q92793",
"gene_name": "CREBBP",
"activity": [
{
"ec_number": "2.3.1.48",
"activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].",
"evidence": [
{
"id": "Q92793",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q92793"
}
]
},
{
"ec_number": "2.3.1.48",
"activity": "",
"evidence": [
{
"id": "Q92793",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q92793"
}
]
},
{
"ec_number": "2.3.1.-",
"activity": "",
"evidence": [
{
"id": "Q92793",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q92793"
}
]
}
]
},
{
"uniprot_ac": "Q9ULM6",
"gene_name": "CNOT6",
"activity": [
{
"ec_number": "3.1.13.4",
"activity": "Exonucleolytic cleavage of poly(A) to 5'-AMP.",
"evidence": [
{
"id": "Q9ULM6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9ULM6"
}
]
},
{
"ec_number": "3.1.13.4",
"activity": "",
"evidence": [
{
"id": "Q9ULM6",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9ULM6"
}
]
}
]
},
{
"uniprot_ac": "Q9Y6Q9",
"gene_name": "NCOA3",
"activity": [
{
"ec_number": "2.3.1.48",
"activity": "acetyl-CoA + L-lysyl-[histone] = CoA + H(+) + N(6)-acetyl-L-lysyl-[histone].",
"evidence": [
{
"id": "Q9Y6Q9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Y6Q9"
}
]
},
{
"ec_number": "2.3.1.48",
"activity": "",
"evidence": [
{
"id": "Q9Y6Q9",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Y6Q9"
}
]
}
]
}
],
"biomarkers": [],
"synthesized_glycans": [],
"cluster_types": [
{
"name": "isoformset.uniprotkb",
"label": "Isoforms"
},
{
"name": "homologset.mgi",
"label": "MGI Homologs"
}
],
"sequence_features": {
"n_linked_sites": [],
"o_linked_sites": [
181,
622,
625,
626,
731
],
"snv_sites": [
131,
181,
221,
324,
381,
405,
485,
580,
608,
622,
625,
741,
791,
803,
812,
966,
1059,
1069,
1151,
1255,
1272,
1348
],
"glycation_sites": [],
"phosphorylation_sites": [
769,
818,
827,
829,
1091
],
"sequon_annotation_sites": [
{
"start_pos": 1026,
"end_pos": 1028
},
{
"start_pos": 1346,
"end_pos": 1348
},
{
"start_pos": 236,
"end_pos": 238
},
{
"start_pos": 377,
"end_pos": 379
},
{
"start_pos": 386,
"end_pos": 388
},
{
"start_pos": 411,
"end_pos": 413
},
{
"start_pos": 444,
"end_pos": 446
},
{
"start_pos": 448,
"end_pos": 450
},
{
"start_pos": 620,
"end_pos": 622
},
{
"start_pos": 623,
"end_pos": 625
},
{
"start_pos": 638,
"end_pos": 640
},
{
"start_pos": 739,
"end_pos": 741
},
{
"start_pos": 910,
"end_pos": 912
}
]
},
"section_stats": [
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 5
},
{
"field": "total_sites",
"count": 5
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 1
},
{
"field": "o_linked_glycan_sites",
"count": 5
}
],
"sort_fields": [
"glytoucan_ac",
"type",
"subtype",
"site_category",
"site_seq",
"relation",
"comment",
"start_pos",
"start_aa",
"end_pos",
"end_aa",
"residue",
"site_lbl"
]
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 5
},
{
"field": "total_sites",
"count": 5
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 1
},
{
"field": "o_linked_glycan_sites",
"count": 5
}
],
"sort_fields": [
"glytoucan_ac",
"type",
"subtype",
"site_category",
"site_seq",
"relation",
"comment",
"start_pos",
"start_aa",
"end_pos",
"end_aa",
"residue",
"site_lbl"
]
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 5
},
{
"field": "total_sites",
"count": 5
}
],
"sort_fields": [
"start_pos",
"end_pos",
"kinase_uniprot_canonical_ac",
"kinase_gene_name",
"residue",
"comment",
"site_lbl"
]
},
{
"table_id": "snv",
"table_stats": [
{
"field": "total",
"count": 23
},
{
"field": "total_sites",
"count": 22
}
],
"sort_fields": [
"start_pos",
"end_pos",
"sequence_org",
"sequence_mut",
"comment",
"chr_id",
"chr_pos",
"ref_nt",
"alt_nt",
"minor_allelic_frequency",
"site_lbl",
"subjects_tested",
"subjects_positive",
"frequency"
]
},
{
"table_id": "snv_disease",
"table_stats": [
{
"field": "total",
"count": 7
},
{
"field": "total_sites",
"count": 7
}
],
"sort_fields": [
"start_pos",
"end_pos",
"sequence_org",
"sequence_mut",
"comment",
"chr_id",
"chr_pos",
"ref_nt",
"alt_nt",
"minor_allelic_frequency",
"site_lbl",
"subjects_tested",
"subjects_positive",
"frequency"
]
},
{
"table_id": "snv_non_disease",
"table_stats": [
{
"field": "total",
"count": 16
},
{
"field": "total_sites",
"count": 15
}
],
"sort_fields": [
"start_pos",
"end_pos",
"sequence_org",
"sequence_mut",
"comment",
"chr_id",
"chr_pos",
"ref_nt",
"alt_nt",
"minor_allelic_frequency",
"site_lbl",
"subjects_tested",
"subjects_positive",
"frequency"
]
},
{
"table_id": "publication",
"table_stats": [
{
"field": "total",
"count": 161
}
],
"sort_fields": [
"title",
"journal",
"date",
"authors"
]
}
]
}