{ "uniprot_canonical_ac": "O15519-1", "uniprot_ac": "O15519", "uniprot_id": "CFLAR_HUMAN", "mass": { "chemical_mass": 55344.0, "monoisotopic_mass": 55344.0 }, "refseq": { "ac": "NP_001120655", "name": "CASP8 and FADD-like apoptosis regulator isoform 1", "summary": "The protein encoded by this gene is a regulator of apoptosis and is structurally similar to caspase-8. However, the encoded protein lacks caspase activity and appears to be itself cleaved into two peptides by caspase-8. Several transcript variants encoding different isoforms have been found for this gene, and partial evidence for several more variants exists. [provided by RefSeq, Feb 2011].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001120655" }, "gene_names": [ { "name": "CFLAR", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O15519", "id": "O15519" }, { "name": "CASH", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O15519", "id": "O15519" }, { "name": "CASP8AP1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O15519", "id": "O15519" }, { "name": "CFLAR", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001120655", "id": "NP_001120655" }, { "name": "CLARP", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O15519", "id": "O15519" }, { "name": "MRIT", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O15519", "id": "O15519" }, { "name": "c-FLIP; c-FLIPL; c-FLIPR; c-FLIPS; CASH; CASP8AP1; Casper; cFLIP; CLARP; FLAME; FLAME-1; FLAME1; FLIP; I-FLICE; MRIT", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001120655", "id": "NP_001120655" } ], "protein_names": [ { "name": "CASP8 and FADD-like apoptosis regulator", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O15519" }, { "name": "CASH", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O15519" }, { "name": "CASP8 and FADD-like apoptosis regulator isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001120655", "id": "NP_001120655" }, { "name": "CLARP", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O15519" }, { "name": "Caspase homolog", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O15519" }, { "name": "Caspase-eight-related protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O15519" }, { "name": "Caspase-like apoptosis regulatory protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O15519" }, { "name": "Casper", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O15519" }, { "name": "Cellular FLICE-like inhibitory protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O15519" }, { "name": "FADD-like antiapoptotic molecule 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O15519" }, { "name": "FLAME-1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O15519" }, { "name": "I-FLICE", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O15519" }, { "name": "Inhibitor of FLICE", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O15519" }, { "name": "MACH-related inducer of toxicity", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O15519" }, { "name": "MRIT", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O15519" }, { "name": "Usurpin", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O15519" }, { "name": "c-FLIP", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O15519" }, { "name": "inhibitor of FLICE; caspase-related inducer of apoptosis; usurpin beta; caspase homolog; caspase-eight-related protein; MACH-related inducer of toxicity; FADD-like antiapoptotic molecule 1; cellular FLICE-like inhibitory protein; caspase-like apoptosis regulatory protein; testis secretory sperm-binding protein Li 233m", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001120655", "id": "NP_001120655" } ], "function": [ { "annotation": "Apoptosis regulator protein which may function as a crucial link between cell survival and cell death pathways in mammalian cells. Acts as an inhibitor of TNFRSF6 mediated apoptosis. A proteolytic fragment (p43) is likely retained in the death-inducing signaling complex (DISC) thereby blocking further recruitment and processing of caspase-8 at the complex. Full length and shorter isoforms have been shown either to induce apoptosis or to reduce TNFRSF-triggered apoptosis. Lacks enzymatic (caspase) activity.", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519#function" }, { "database": "PubMed", "id": "9880531", "url": "https://glygen.org/publication/PubMed/9880531" } ] }, { "annotation": "C-FLIP promotes drug resistance in non-small-cell lung cancer cells via upregulating FoxM1 expression.", "evidence": [ { "database": "RefSeq", "id": "NP_001120655", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001120655" }, { "database": "PubMed", "id": "35422085", "url": "https://glygen.org/publication/PubMed/35422085" } ] }, { "annotation": "CFLIPS regulates alternative NLRP3 inflammasome activation in human monocytes.", "evidence": [ { "database": "RefSeq", "id": "NP_001120655", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001120655" }, { "database": "PubMed", "id": "37591930", "url": "https://glygen.org/publication/PubMed/37591930" } ] }, { "annotation": "The interaction of CFLAR with p130Cas promotes cell migration.", "evidence": [ { "database": "RefSeq", "id": "NP_001120655", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001120655" }, { "database": "PubMed", "id": "36400248", "url": "https://glygen.org/publication/PubMed/36400248" } ] }, { "annotation": "The protein encoded by this gene is a regulator of apoptosis and is structurally similar to caspase-8. However, the encoded protein lacks caspase activity and appears to be itself cleaved into two peptides by caspase-8. Several transcript variants encoding different isoforms have been found for this gene, and partial evidence for several more variants exists. [provided by RefSeq, Feb 2011].", "evidence": [ { "database": "RefSeq", "id": "NP_001120655", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001120655" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "O15519", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O15519" } ], "glycoeffect": [], "start_pos": 293, "end_pos": 293, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "L", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "2", "chr_pos": "201160515", "ref_nt": "C", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "L293", "disease": [ { "disease_id": "DOID:1319", "recommended_name": { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain cancer", "description": "A central nervous system cancer that is characterized by the growth of abnormal cells in the tissues of the brain." }, "synonyms": [ { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "BT - Brain tumour", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "adult brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "adult malignant brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain neoplasm, adult", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant brain tumour", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant primary brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant primary brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant tumor of Brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant tumor of adult brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "neoplasm of brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary malignant neoplasm of brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "tumor of the Brain", "description": "" } ] }, { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] }, { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] } ], "mutagenesis": [ { "start_pos": 360, "end_pos": 360, "sequence_org": "Y", "sequence_mut": "F", "comment": "Decreases apoptosis-inducing activity. Reduces interaction with caspase-3 and proteolytic processing.", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" }, { "database": "PubMed", "id": "9208847", "url": "https://glygen.org/publication/PubMed/9208847" } ] }, { "start_pos": 376, "end_pos": 376, "sequence_org": "D", "sequence_mut": "A", "comment": "Abolishes proteolytic processing.", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" }, { "database": "PubMed", "id": "9228018", "url": "https://glygen.org/publication/PubMed/9228018" } ] }, { "start_pos": 376, "end_pos": 376, "sequence_org": "D", "sequence_mut": "N", "comment": "Abolishes proteolytic processing.", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" }, { "database": "PubMed", "id": "9228018", "url": "https://glygen.org/publication/PubMed/9228018" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "94.63", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000003402", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000003402" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "95.37", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000003402", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000003402" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "96.95", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000003402", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000003402" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "92.91", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000003402", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000003402" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "97.4", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000003402", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000003402" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "96.84", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000003402", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000003402" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "94.17", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000003402", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000003402" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "96.32", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000003402", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000003402" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "97.62", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000003402", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000003402" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "97.92", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000003402", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000003402" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "97.01", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000003402", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000003402" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "97.05", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000003402", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000003402" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "96.12", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000003402", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000003402" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O15519", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15519" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O15519", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15519" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O15519", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15519" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O15519", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15519" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O15519", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15519" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O15519", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15519" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O15519", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15519" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O15519", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15519" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O15519", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15519" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O15519", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15519" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O15519", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15519" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O15519", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15519" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" } ], "common_name": "Human" } ], "gene": [ { "name": "CFLAR", "url": "https://www.uniprot.org/uniprot/O15519", "locus": { "chromosome": "2", "start_pos": 201176687, "end_pos": 201116154, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000003402", "url": "https://www.ensembl.org/id/ENSG00000003402" } ] } } ], "crossref": [ { "id": "ENSG00000003402", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000003402", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "O15519", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O15519", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd00032", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00032", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd08337", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd08337", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd08340", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd08340", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL1955713", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL1955713", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "CFLAR", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=CFLAR", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "8837", "url": "https://www.ncbi.nlm.nih.gov/gene/8837", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "1876", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=1876", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O15519", "url": "https://www.ebi.ac.uk/intact/interactors/id:O15519*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001309", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001309", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001875", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001875", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011029", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011029", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011600", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011600", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR015917", "url": "https://www.ebi.ac.uk/interpro/entry/IPR015917", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR029030", "url": "https://www.ebi.ac.uk/interpro/entry/IPR029030", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:8837", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:8837", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "603599", "url": "http://www.omim.org/entry/603599", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O15519", "url": "https://www.nextprot.org/entry/NX_O15519", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "NCFRSIH", "url": "https://omabrowser.org/oma/group/NCFRSIH/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2873736at2759", "url": "http://www.orthodb.org/?query=2873736at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR48169", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48169", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR48169:SF3", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48169:SF3", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "2N5R", "url": "https://www.rcsb.org/structure/2N5R", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3H11", "url": "https://www.rcsb.org/structure/3H11", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3H13", "url": "https://www.rcsb.org/structure/3H13", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6M6O", "url": "https://www.rcsb.org/structure/6M6O", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7DEE", "url": "https://www.rcsb.org/structure/7DEE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7LXC", "url": "https://www.rcsb.org/structure/7LXC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00656", "url": "http://pfam.xfam.org/family/PF00656", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF01335", "url": "http://pfam.xfam.org/family/PF01335", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O15519", "url": "https://pharos.nih.gov/targets/O15519", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O15519", "url": "http://purl.obolibrary.org/obo/PR_O15519", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-75158", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75158", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001120655", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001120655", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "C9J408", "url": "https://www.uniprot.org/uniprot/C9J408", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9J408-1", "url": "https://www.uniprot.org/uniprot/C9J408-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9J4Q0", "url": "https://www.uniprot.org/uniprot/C9J4Q0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9J4Q0-1", "url": "https://www.uniprot.org/uniprot/C9J4Q0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9JSU3", "url": "https://www.uniprot.org/uniprot/C9JSU3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9JSU3-1", "url": "https://www.uniprot.org/uniprot/C9JSU3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9JV51", "url": "https://www.uniprot.org/uniprot/C9JV51", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9JV51-1", "url": "https://www.uniprot.org/uniprot/C9JV51-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PAP3", "url": "https://www.uniprot.org/uniprot/E9PAP3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PAP3-1", "url": "https://www.uniprot.org/uniprot/E9PAP3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8WBH9", "url": "https://www.uniprot.org/uniprot/F8WBH9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8WBH9-1", "url": "https://www.uniprot.org/uniprot/F8WBH9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "M0QY57", "url": "https://www.uniprot.org/uniprot/M0QY57", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "M0QY57-1", "url": "https://www.uniprot.org/uniprot/M0QY57-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "M0QYM0", "url": "https://www.uniprot.org/uniprot/M0QYM0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "M0QYM0-1", "url": "https://www.uniprot.org/uniprot/M0QYM0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "M0R1A8", "url": "https://www.uniprot.org/uniprot/M0R1A8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "M0R1A8-1", "url": "https://www.uniprot.org/uniprot/M0R1A8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O15519-1", "url": "https://www.uniprot.org/uniprot/O15519-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O15519-10", "url": "https://www.uniprot.org/uniprot/O15519-10", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O15519-11", "url": "https://www.uniprot.org/uniprot/O15519-11", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O15519-12", "url": "https://www.uniprot.org/uniprot/O15519-12", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O15519-13", "url": "https://www.uniprot.org/uniprot/O15519-13", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O15519-14", "url": "https://www.uniprot.org/uniprot/O15519-14", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O15519-15", "url": "https://www.uniprot.org/uniprot/O15519-15", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O15519-2", "url": "https://www.uniprot.org/uniprot/O15519-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O15519-3", "url": "https://www.uniprot.org/uniprot/O15519-3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O15519-4", "url": "https://www.uniprot.org/uniprot/O15519-4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O15519-5", "url": "https://www.uniprot.org/uniprot/O15519-5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O15519-6", "url": "https://www.uniprot.org/uniprot/O15519-6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O15519-7", "url": "https://www.uniprot.org/uniprot/O15519-7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O15519-8", "url": "https://www.uniprot.org/uniprot/O15519-8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O15519-9", "url": "https://www.uniprot.org/uniprot/O15519-9", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSAEVIHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLAELLYRVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSSLIFLMKDYMGRGKISKEKSFLDLVVELEKLNLVAPDQLDLLEKCLKNIHRIDLKTKIQKYKQSVQGAGTSYRNVLQAAIQKSLKDPSNNFRLHNGRSKEQRLKEQLGAQQEPVKKSIQESEAFLPQSIPEERYKMKSKPLGICLIIDCIGNETELLRDTFTSLGYEVQKFLHLSMHGISQILGQFACMPEHRDYDSFVCVLVSRGGSQSVYGVDQTHSGLPLHHIRRMFMGDSCPYLAGKPKMFFIQNYVVSEGQLEDSSLLEVDGPAMKNVEFKAQKRGLCTVHREADFFWSLCTADMSLLEQSHSSPSLYLQCLSQKLRQERKRPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT", "length": 480, "header": "sp|O15519-1|CFLAR_HUMAN Isoform 1 of CASP8 and FADD-like apoptosis regulator OS=Homo sapiens OX=9606 GN=CFLAR PE=1 SV=1 CANONICAL=O15519-1" }, "isoforms": [ { "isoform_ac": "C9J408-1", "url": "", "sequence": { "sequence": "MSAEVIHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLAELLYRVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSSLIFLMKDYMGRGKISKEK", "length": 129, "header": "tr|C9J408-1|C9J408_HUMAN Computationally mapped isoform of CASP8 and FADD like apoptosis regulator OS=Homo sapiens OX=9606 GN=CFLAR PE=1 SV=1 CANONICAL=O15519-1" }, "locus": { "chromosome": "2", "start_pos": 201133134, "end_pos": 201129866, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000441224.5", "url": "https://www.ensembl.org/id/ENST00000441224.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000411897.1", "url": "https://www.ensembl.org/id/ENSP00000411897.1" } ] } }, { "isoform_ac": "C9J4Q0-1", "url": "", "sequence": { "sequence": "MSAEVIHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLAELLYRVRR", "length": 64, "header": "tr|C9J4Q0-1|C9J4Q0_HUMAN Computationally mapped isoform of CASP8 and FADD like apoptosis regulator OS=Homo sapiens OX=9606 GN=CFLAR PE=1 SV=1 CANONICAL=O15519-1" }, "locus": { "chromosome": "2", "start_pos": 201130057, "end_pos": 201129866, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000433445.1", "url": "https://www.ensembl.org/id/ENST00000433445.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000391029.1", "url": "https://www.ensembl.org/id/ENSP00000391029.1" } ] } }, { "isoform_ac": "C9JSU3-1", "url": "", "sequence": { "sequence": "MSAEVIHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLAELLYRV", "length": 62, "header": "tr|C9JSU3-1|C9JSU3_HUMAN Computationally mapped isoform of CASP8 and FADD like apoptosis regulator OS=Homo sapiens OX=9606 GN=CFLAR PE=1 SV=1 CANONICAL=O15519-1" }, "locus": { "chromosome": "2", "start_pos": 201130051, "end_pos": 201129866, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000425030.1", "url": "https://www.ensembl.org/id/ENST00000425030.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000409570.1", "url": "https://www.ensembl.org/id/ENSP00000409570.1" } ] } }, { "isoform_ac": "C9JV51-1", "url": "", "sequence": { "sequence": "MSAEVIHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLAELLYRVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSSLIFLMKD", "length": 118, "header": "tr|C9JV51-1|C9JV51_HUMAN Computationally mapped isoform of CASP8 and FADD like apoptosis regulator OS=Homo sapiens OX=9606 GN=CFLAR PE=1 SV=1 CANONICAL=O15519-1" }, "locus": { "chromosome": "2", "start_pos": 201133101, "end_pos": 201129866, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000417748.1", "url": "https://www.ensembl.org/id/ENST00000417748.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000412882.1", "url": "https://www.ensembl.org/id/ENSP00000412882.1" } ] } }, { "isoform_ac": "E9PAP3-1", "url": "", "sequence": { "sequence": "MSAEVIHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLAELLYRVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSSLIFLMKDYMGRGKISKEKSFLDLVVELEKLNLVAPDQLDLLEKCLKNIHRIDLKTKIQKYKQSGGWNGTWMTKASFSLWLEIASLYILHIPDLPTPLPCIFMISAKCCQAVLNISVFKKESGICTGWQSYGHSGVLHVC", "length": 250, "header": "tr|E9PAP3-1|E9PAP3_HUMAN Computationally mapped isoform of CASP8 and FADD like apoptosis regulator OS=Homo sapiens OX=9606 GN=CFLAR PE=1 SV=1 CANONICAL=O15519-1" }, "locus": { "chromosome": "2", "start_pos": 201136424, "end_pos": 201129866, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000395148.6", "url": "https://www.ensembl.org/id/ENST00000395148.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000378580.2", "url": "https://www.ensembl.org/id/ENSP00000378580.2" } ] } }, { "isoform_ac": "F8WBH9-1", "url": "", "sequence": { "sequence": "MSAEVIHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLAELLYRVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSSLIFLMKDYMGRGKISKEKSFLDLVVELEKLNLVAPDQLDLLEKCLKNIHRIDLKTKIQKYKQSVQGAGTSYRNVLQAAIQKSLKDPSNNFRAGVQWRDLGSPQPPPPGFKRFSHLSLPSSWDYRNVPPRPAP", "length": 243, "header": "tr|F8WBH9-1|F8WBH9_HUMAN Computationally mapped isoform of CASP8 and FADD like apoptosis regulator OS=Homo sapiens OX=9606 GN=CFLAR PE=1 SV=1 CANONICAL=O15519-1" }, "locus": { "chromosome": "2", "start_pos": 201145382, "end_pos": 201129866, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000439154.6", "url": "https://www.ensembl.org/id/ENST00000439154.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000398551.2", "url": "https://www.ensembl.org/id/ENSP00000398551.2" } ] } }, { "isoform_ac": "M0QY57-1", "url": "", "sequence": { "sequence": "MAEIGEDLDKSDVSSLIFLMKDYMGRGKISKEKSFLDLVVELEKLNLVAPDQLDLLEKCLKNIHRIDLKTKIQKYKQSVQGAGTSYRNVLQAAIQKSLKDPSNNFRVSLEKTYGIPA", "length": 117, "header": "tr|M0QY57-1|M0QY57_HUMAN Computationally mapped isoform of CASP8 and FADD like apoptosis regulator OS=Homo sapiens OX=9606 GN=CFLAR PE=1 SV=1 CANONICAL=O15519-1" }, "locus": { "chromosome": "2", "start_pos": 201140472, "end_pos": 201133036, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000494258.5", "url": "https://www.ensembl.org/id/ENST00000494258.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000469608.1", "url": "https://www.ensembl.org/id/ENSP00000469608.1" } ] } }, { "isoform_ac": "M0QYM0-1", "url": "", "sequence": { "sequence": "MAEIGEDLDKSDVSSLIFLMKDYMGRGKISKEKSFLDLVVELEKLNLVAPDQLDLLEKCLKNIHRIDLKTKIQKYKQSVQGAGTSYRNVLQAAIQKSLKDPSNNFRLHNGRSKEQRLKEQLGAQQEPVKKSIQESEAFLPQSIPEERYKMKSKPLGICLIIDCIGNET", "length": 168, "header": "tr|M0QYM0-1|M0QYM0_HUMAN Computationally mapped isoform of CASP8 and FADD like apoptosis regulator OS=Homo sapiens OX=9606 GN=CFLAR PE=1 SV=1 CANONICAL=O15519-1" }, "locus": { "chromosome": "2", "start_pos": 201149834, "end_pos": 201133036, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000462763.5", "url": "https://www.ensembl.org/id/ENST00000462763.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000469917.1", "url": "https://www.ensembl.org/id/ENSP00000469917.1" } ] } }, { "isoform_ac": "M0R1A8-1", "url": "", "sequence": { "sequence": "MAEIGEDLDKSDVSSLIFLMKDYMGRGKISKEKSFLDLVVELEKLNLVAPDQLDLLEKCLKNIHRIDLKTKIQKYKQSVQGAGTSYRNVLQAAIQKSLKDPSNNFRMITPYAHCPDL", "length": 117, "header": "tr|M0R1A8-1|M0R1A8_HUMAN Computationally mapped isoform of CASP8 and FADD like apoptosis regulator OS=Homo sapiens OX=9606 GN=CFLAR PE=1 SV=1 CANONICAL=O15519-1" }, "locus": { "chromosome": "2", "start_pos": 201141406, "end_pos": 201133036, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000470178.6", "url": "https://www.ensembl.org/id/ENST00000470178.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000471749.1", "url": "https://www.ensembl.org/id/ENSP00000471749.1" } ] } }, { "isoform_ac": "O15519-1", "url": "", "sequence": { "sequence": "MSAEVIHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLAELLYRVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSSLIFLMKDYMGRGKISKEKSFLDLVVELEKLNLVAPDQLDLLEKCLKNIHRIDLKTKIQKYKQSVQGAGTSYRNVLQAAIQKSLKDPSNNFRLHNGRSKEQRLKEQLGAQQEPVKKSIQESEAFLPQSIPEERYKMKSKPLGICLIIDCIGNETELLRDTFTSLGYEVQKFLHLSMHGISQILGQFACMPEHRDYDSFVCVLVSRGGSQSVYGVDQTHSGLPLHHIRRMFMGDSCPYLAGKPKMFFIQNYVVSEGQLEDSSLLEVDGPAMKNVEFKAQKRGLCTVHREADFFWSLCTADMSLLEQSHSSPSLYLQCLSQKLRQERKRPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT", "length": 480, "header": "sp|O15519-1|CFLAR_HUMAN Isoform 1 of CASP8 and FADD-like apoptosis regulator OS=Homo sapiens OX=9606 GN=CFLAR PE=1 SV=1 CANONICAL=O15519-1" }, "locus": { "chromosome": "2", "start_pos": 201163970, "end_pos": 201129866, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000423241.6", "url": "https://www.ensembl.org/id/ENST00000423241.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000399420.2", "url": "https://www.ensembl.org/id/ENSP00000399420.2" } ] } }, { "isoform_ac": "O15519-10", "url": "", "sequence": { "sequence": "MSAEVIHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLAELLYRVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSSLIFLMKDYMGRGKISKEKSFLDLVVELEKLNLVAPDQLDLLEKCLKNIHRIDLKTKIQKYKQSVQGAGTSYRNVLQAAIQKSLKDPSNNFRLHNGRSKEQRLKEQLGAQQEPVKKSIQESEAFLPQSIPEERYKMKSKPLGICLIIDCIGNETENAHSWIFTLNSMATCMIGTAEFLPRRNIMFGCSTL", "length": 300, "header": "sp|O15519-10|CFLAR_HUMAN Isoform 10 of CASP8 and FADD-like apoptosis regulator OS=Homo sapiens OX=9606 GN=CFLAR PE=1 SV=1 CANONICAL=O15519-1" }, "locus": {} }, { "isoform_ac": "O15519-11", "url": "", "sequence": { "sequence": "MSAEVIHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLAELLYRVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSSLIFLMKDYMGRGKISKEKSFLDLVVELEKLNLVAPDQLDLLEKCLKNIHRIDLKTKIQKYKQSVQGAGTSYRNVLQAAIQKSLKDPSNNFRLHNGRSKEQRLKEQLGAQQEPVKKSIQESEAFLPQSIPEERYKMKSKPLGICLIIDCIGNETELLRDTFTSLGYEVQKFLHLSMHGISQILGQFACMPEHRDYDSFVCVLVSRGGSQSVYGVDQTHSGLPLHHIRRMFMGDSCPYLAGKPKMFFIQNYVVSEGQLEDSSLLEVDGPAMKNVEFKAQKRGLCTVHREADFFWSLCTADMSLLEQSHSSPSLYLQCLSQKLRQERGTIPGSGITESKDMHFSSLGCILLDVL", "length": 462, "header": "sp|O15519-11|CFLAR_HUMAN Isoform 11 of CASP8 and FADD-like apoptosis regulator OS=Homo sapiens OX=9606 GN=CFLAR PE=1 SV=1 CANONICAL=O15519-1" }, "locus": { "chromosome": "2", "start_pos": 201163077, "end_pos": 201129866, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000457277.5", "url": "https://www.ensembl.org/id/ENST00000457277.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000411535.1", "url": "https://www.ensembl.org/id/ENSP00000411535.1" } ] } }, { "isoform_ac": "O15519-12", "url": "", "sequence": { "sequence": "MSAEVIHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLAELLYRVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSSLIFLMKDYMGRGKISKEKSFLDLVVELEKLNLVAPDQLDLLEKCLKNIHRIDLKTKIQKYKQSVQGAGTSYRNVLQAAIQKSLKDPSNNFRLHNGRSKEQRLKEQLGAQQEPVKKSIQESEAFLPQSIPEERYKMKSKPLGICLIIDCIGNETGWSAMAQSQLTAISTSQVQAILLPQPPE", "length": 292, "header": "sp|O15519-12|CFLAR_HUMAN Isoform 12 of CASP8 and FADD-like apoptosis regulator OS=Homo sapiens OX=9606 GN=CFLAR PE=1 SV=1 CANONICAL=O15519-1" }, "locus": { "chromosome": "2", "start_pos": 201154219, "end_pos": 201129866, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000342795.9", "url": "https://www.ensembl.org/id/ENST00000342795.9" }, { "database": "Ensembl Peptide", "id": "ENSP00000342809.5", "url": "https://www.ensembl.org/id/ENSP00000342809.5" } ] } }, { "isoform_ac": "O15519-13", "url": "", "sequence": { "sequence": "MSAEVIHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLAELLYRVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSSLIFLMKDYMGRGKISKEKSFLDLVVELEKLNLVAPDQLDLLEKCLKNIHRIDLKTKIQKYKQSVQGAGTSYRNVLQAAIQKSLKDPSNNFR", "length": 202, "header": "sp|O15519-13|CFLAR_HUMAN Isoform 13 of CASP8 and FADD-like apoptosis regulator OS=Homo sapiens OX=9606 GN=CFLAR PE=1 SV=1 CANONICAL=O15519-1" }, "locus": {} }, { "isoform_ac": "O15519-14", "url": "", "sequence": { "sequence": "MSAEVIHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLAELLYRVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSSLIFLMKDYMGRGKISKEKSFLDLVVELEKLNLVAPDQLDLLEKCLKNIHRIDLKTKIQKYKQSVQGAGTSYRNVLQAAIQKSLKDPSNNFRLHNGRSKEQRLKEQLGAQQEPVKKSIQESEAFLPQSIPEERYKMKSKPLGICLIIDCIGNETELLRDTFTSLGYEVQKFLHLSMHGISQILGQFACMPEHRDYDSFVCVLVSRGGSQSVYGVDQTHSGLPLHHIRRMFMGDSCPYLAGKPKMFFIQNYVVSEGQLEDSSLLEVDGPAMKNVEFKAQKRGLCTVHREADFFWSLCTADMSLLEQSHSSPSLYLQCLSQKLRQER", "length": 435, "header": "sp|O15519-14|CFLAR_HUMAN Isoform 14 of CASP8 and FADD-like apoptosis regulator OS=Homo sapiens OX=9606 GN=CFLAR PE=1 SV=1 CANONICAL=O15519-1" }, "locus": {} }, { "isoform_ac": "O15519-15", "url": "", "sequence": { "sequence": "MAEIGEDLDKSDVSSLIFLMKDYMGRGKISKEKSFLDLVVELEKLNLVAPDQLDLLEKCLKNIHRIDLKTKIQKYKQSVQGAGTSYRNVLQAAIQKSLKDPSNNFRLHNGRSKEQRLKEQLGAQQEPVKKSIQESEAFLPQSIPEERYKMKSKPLGICLIIDCIGNETELLRDTFTSLGYEVQKFLHLSMHGISQILGQFACMPEHRDYDSFVCVLVSRGGSQSVYGVDQTHSGLPLHHIRRMFMGDSCPYLAGKPKMFFIQNYVVSEGQLEDSSLLEVDGPAMKNVEFKAQKRGLCTVHREADFFWSLCTADMSLLEQSHSSPSLYLQCLSQKLRQERKRPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT", "length": 384, "header": "sp|O15519-15|CFLAR_HUMAN Isoform 15 of CASP8 and FADD-like apoptosis regulator OS=Homo sapiens OX=9606 GN=CFLAR PE=1 SV=1 CANONICAL=O15519-1" }, "locus": { "chromosome": "2", "start_pos": 201163970, "end_pos": 201133036, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000443227.5", "url": "https://www.ensembl.org/id/ENST00000443227.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000413270.1", "url": "https://www.ensembl.org/id/ENSP00000413270.1" } ] } }, { "isoform_ac": "O15519-2", "url": "", "sequence": { "sequence": "MSAEVIHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLAELLYRVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSSLIFLMKDYMGRGKISKEKSFLDLVVELEKLNLVAPDQLDLLEKCLKNIHRIDLKTKIQKYKQSVQGAGTSYRNVLQAAIQKSLKDPSNNFRMITPYAHCPDLKILGNCSM", "length": 221, "header": "sp|O15519-2|CFLAR_HUMAN Isoform 2 of CASP8 and FADD-like apoptosis regulator OS=Homo sapiens OX=9606 GN=CFLAR PE=1 SV=1 CANONICAL=O15519-1" }, "locus": { "chromosome": "2", "start_pos": 201141430, "end_pos": 201129866, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000341222.10", "url": "https://www.ensembl.org/id/ENST00000341222.10" }, { "database": "Ensembl Peptide", "id": "ENSP00000339335.6", "url": "https://www.ensembl.org/id/ENSP00000339335.6" } ] } }, { "isoform_ac": "O15519-3", "url": "", "sequence": { "sequence": "MAEIGEDLDKSDVSSLIFLMKDYMGRGKISKEKSFLDLVVELEKLNLVAPDQLDLLEKCLKNIHRIDLKTKIQKYKQSVQGAGTSYRNVLQAAIQKSLKDPSNNFRLHNGRSKEQRLKEQLGAQQEPVKKSIQESEAFLPQSIPEERYKMKSKPLGICLIIDCIGNETELLRDTFTSLGYEVQKFLHLSMHGISQILGQFACMPEHRDYDSFVCVLVSRGGSQSVYGVDQTHSGLPLHHIRRMFMGDSCPYLAGKPKMFFIQNYVVSEGQLEDSSLLEVDGPAMKNVEFKAQKRGLCTVHREADFFWSLCTADMSLLEQSHSSPSLYLQCLSQKLRQERGTIPGSGITESKDMHFSSLGCILLDVL", "length": 366, "header": "sp|O15519-3|CFLAR_HUMAN Isoform 3 of CASP8 and FADD-like apoptosis regulator OS=Homo sapiens OX=9606 GN=CFLAR PE=1 SV=1 CANONICAL=O15519-1" }, "locus": { "chromosome": "2", "start_pos": 201163077, "end_pos": 201133036, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000479953.6", "url": "https://www.ensembl.org/id/ENST00000479953.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000471805.1", "url": "https://www.ensembl.org/id/ENSP00000471805.1" } ] } }, { "isoform_ac": "O15519-4", "url": "", "sequence": { "sequence": "MKSKPLGICLIIDCIGNETELLRDTFTSLGYEVQKFLHLSMHGISQILGQFACMPEHRDYDSFVCVLVSRGGSQSVYGVDQTHSGLPLHHIRRMFMGDSCPYLAGKPKMFFIQNYVVSEGQLEDSSLLEVDGPAMKNVEFKAQKRGLCTVHREADFFWSLCTADMSLLEQSHSSPSLYLQCLSQKLRQERKRPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT", "length": 235, "header": "sp|O15519-4|CFLAR_HUMAN Isoform 4 of CASP8 and FADD-like apoptosis regulator OS=Homo sapiens OX=9606 GN=CFLAR PE=1 SV=1 CANONICAL=O15519-1" }, "locus": {} }, { "isoform_ac": "O15519-5", "url": "", "sequence": { "sequence": "MSAEVIHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLAELLYRVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSSLIFLMKDYMGRGKISKEKSFLDLVVELEKLNLVAPDQLDLLEKCLKNIHRIDLKTKIQKYKQSVQGAGTSYRNVLQAAIQKSLKDPSNNFRLHNGRSKEQRLKEQLGAQQEPVKKSIQESEAFLPQSIPEERYKMKSKPLGICLIIDCIGNETELLRDTFTSLGYEVQKFLHLSMHGISQILGQFACMPEHRDYDSFVCVLVSRGGSQSVYGVDQTHSGLPLHHIRRMFMGDSCPYLAGKPKMFFIQNYVVSEGQLEDSSLLEVDGPAMKNVEFKAQKRGLCTVHREADFFWSLCTADMSLLEQSHSSPSLYLQCLSQKLRQERKRPLLDLHIELNGL", "length": 449, "header": "sp|O15519-5|CFLAR_HUMAN Isoform 5 of CASP8 and FADD-like apoptosis regulator OS=Homo sapiens OX=9606 GN=CFLAR PE=1 SV=1 CANONICAL=O15519-1" }, "locus": {} }, { "isoform_ac": "O15519-6", "url": "", "sequence": { "sequence": "MLERPPVCSKVDVVPPNVRDLLDILRERGKLSVGDLAELLYRVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSSLIFLMKDYMGRGKISKEKSFLDLVVELEKLNLVAPDQLDLLEKCLKNIHRIDLKTKIQKYKQSVQGAGTSYRNVLQAAIQKSLKDPSNNFRLHNGRSKEQRLKEQLGAQQEPVKKSIQESEAFLPQSIPEERYKMKSKPLGICLIIDCIGNETELLRDTFTSLGYEVQKFLHLSMHGISQILGQFACMPEHRDYDSFVCVLVSRGGSQSVYGVDQTHSGLPLHHIRRMFMGDSCPYLAGKPKMFFIQNYVVSEGQLEDSSLLEVDGPAMKNVEFKAQKRGLCTVHREADFFWSLCTADMSLLEQSHSSPSLYLQCLSQKLRQERKRPLLDLHIELNGYMYDSLEHTGGRY", "length": 442, "header": "sp|O15519-6|CFLAR_HUMAN Isoform 6 of CASP8 and FADD-like apoptosis regulator OS=Homo sapiens OX=9606 GN=CFLAR PE=1 SV=1 CANONICAL=O15519-1" }, "locus": {} }, { "isoform_ac": "O15519-7", "url": "", "sequence": { "sequence": "MAEIGEDLDKSDVSSLIFLMKDYMGRGKISKEKSFLDLVVELEKLNLVAPDQLDLLEKCLKNIHRIDLKTKIQKYKQSVQGAGTSYRNVLQAAIQKSLKDPSNNFREEPVKKSIQESEAFLPQSIPEERYKMKSKPLGICLIIDCIGNETELLRDTFTSLGYEVQKFLHLSMHGISQILGQFACMPEHRDYDSFVCVLVSRGGSQSVYGVDQTHSGLPLHHIRRMFMGDSCPYLAGKPKMFFIQNYVVSEGQLEDSSLLEVDGPAMKNVEFKAQKRGLCTVHREADFFWSLCTADMSLLEQSHSSPSLYLQCLSQKLRQERGTIPGSGITESKDMHFSSLGCILLDVL", "length": 348, "header": "sp|O15519-7|CFLAR_HUMAN Isoform 7 of CASP8 and FADD-like apoptosis regulator OS=Homo sapiens OX=9606 GN=CFLAR PE=1 SV=1 CANONICAL=O15519-1" }, "locus": {} }, { "isoform_ac": "O15519-8", "url": "", "sequence": { "sequence": "MSAEVIHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLAELLYRVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSSLIFLMKDYMGRGKISKEKSFLDLVVELEKLNLVAPDQLDLLEKCLKNIHRIDLKTKIQKYKQSVQGAGTSYRNVLQAAIQKSLKDPSNNFRSIPEERYKMKSKPLGICLIIDCIGNETELLRDTFTSLGYEVQKFLHLSMHGISQILGQFACMPEHRDYDSFVCVLVSRGGSQSVYGVDQTHSGLPLHHIRRMFMGDSCPYLAGKPKMFFIQNYVVSEGQLEDSSLLEVDGPAMKNVEFKAQKRGLCTVHREADFFWSLCTADMSLLEQSHSSPSLYLQCLSQKLRQERKRPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT", "length": 445, "header": "sp|O15519-8|CFLAR_HUMAN Isoform 8 of CASP8 and FADD-like apoptosis regulator OS=Homo sapiens OX=9606 GN=CFLAR PE=1 SV=1 CANONICAL=O15519-1" }, "locus": { "chromosome": "2", "start_pos": 201163970, "end_pos": 201129866, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000341582.10", "url": "https://www.ensembl.org/id/ENST00000341582.10" }, { "database": "Ensembl Peptide", "id": "ENSP00000345807.6", "url": "https://www.ensembl.org/id/ENSP00000345807.6" } ] } }, { "isoform_ac": "O15519-9", "url": "", "sequence": { "sequence": "MSAEVIHQVEEALDTDEKEMLLFLCRDVAIDVVPPNVRDLLDILRERGKLSVGDLAELLYRVRRFDLLKRILKMDRKAVETHLLRNPHLVSDYRVLMAEIGEDLDKSDVSSLIFLMKDYMGRGKISKEKSFLDLVVELEKLNLVAPDQLDLLEKCLKNIHRIDLKTKIQKYKQSVQGAGTSYRNVLQAAIQKSLKDPSNNFRSIPEERYKMKSKPLGICLIIDCIGNETELCGVRGPAGGQQPLGGGWASDEECGIQGSEARAVHSSPRS", "length": 270, "header": "sp|O15519-9|CFLAR_HUMAN Isoform 9 of CASP8 and FADD-like apoptosis regulator OS=Homo sapiens OX=9606 GN=CFLAR PE=1 SV=1 CANONICAL=O15519-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [ { "start_pos": 166, "end_pos": 166, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O15519", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15519" }, { "database": "PubMed", "id": "23519470", "url": "https://glygen.org/publication/PubMed/23519470" } ], "site_lbl": "Thr166" }, { "start_pos": 193, "end_pos": 193, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O15519", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15519" }, { "database": "PubMed", "id": "19343040", "url": "https://glygen.org/publication/PubMed/19343040" } ], "site_lbl": "Ser193" }, { "start_pos": 273, "end_pos": 273, "kinase_uniprot_canonical_ac": "P31749-1", "kinase_gene_name": "AKT1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O15519", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15519" }, { "database": "PubMed", "id": "19339247", "url": "https://glygen.org/publication/PubMed/19339247" } ], "site_lbl": "Ser273" } ], "glycation": [], "keywords": [], "publication": [ { "title": "Cell death attenuation by 'Usurpin', a mammalian DED-caspase homologue that precludes caspase-8 recruitment and activation by the CD-95 (Fas, APO-1) receptor complex.", "journal": "Cell Death Differ.", "date": "1998", "authors": "Rasper DM, Vaillancourt JP, Hadano S, Houtzager VM, Seiden I, Keen SL, Tawa P, Xanthoudakis S, Nasir J, Martindale D, Koop BF, Peterson EP, Thornberry NA, Huang J, MacPherson DP, Black SC, Hornung F, Lenardo MJ, Hayden MR, Roy S, Nicholson DW", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" } ], "reference": [ { "type": "PubMed", "id": "10200473", "url": "https://glygen.org/publication/PubMed/10200473" } ] }, { "title": "Cell cycle-dependent regulation of FLIP levels and susceptibility to Fas-mediated apoptosis.", "journal": "J. Immunol.", "date": "1999", "authors": "Algeciras-Schimnich A, Griffith T S, Lynch D H, Paya C V", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" } ], "reference": [ { "type": "PubMed", "id": "10227994", "url": "https://glygen.org/publication/PubMed/10227994" } ] }, { "title": "FADD/MORT1 and caspase-8 are recruited to TRAIL receptors 1 and 2 and are essential for apoptosis mediated by TRAIL receptor 2.", "journal": "Immunity", "date": "2000", "authors": "Sprick MR, Weigand MA, Rieser E, Rauch CT, Juo P, Blenis J, Krammer PH, Walczak H", "evidence": [ { "database": "Reactome", "id": "R-HSA-75158", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75158" } ], "reference": [ { "type": "PubMed", "id": "10894160", "url": "https://glygen.org/publication/PubMed/10894160" } ] }, { "title": "Cloning and characterization of three novel genes, ALS2CR1, ALS2CR2, and ALS2CR3, in the juvenile amyotrophic lateral sclerosis (ALS2) critical region at chromosome 2q33-q34: candidate genes for ALS2.", "journal": "Genomics", "date": "2001", "authors": "Hadano S, Yanagisawa Y, Skaug J, Fichter K, Nasir J, Martindale D, Koop BF, Scherer SW, Nicholson DW, Rouleau GA, Ikeda J, Hayden MR", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" } ], "reference": [ { "type": "PubMed", "id": "11161814", "url": "https://glygen.org/publication/PubMed/11161814" } ] }, { "title": "Caspase-10 is an initiator caspase in death receptor signaling.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "Wang J, Chun HJ, Wong W, Spencer DM, Lenardo MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-75158", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75158" } ], "reference": [ { "type": "PubMed", "id": "11717445", "url": "https://glygen.org/publication/PubMed/11717445" } ] }, { "title": "Caspase-10 is recruited to and activated at the native TRAIL and CD95 death-inducing signalling complexes in a FADD-dependent manner but can not functionally substitute caspase-8.", "journal": "The EMBO journal", "date": "2002", "authors": "Sprick MR, Rieser E, Stahl H, Grosse-Wilde A, Weigand MA, Walczak H", "evidence": [ { "database": "Reactome", "id": "R-HSA-75158", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75158" } ], "reference": [ { "type": "PubMed", "id": "12198154", "url": "https://glygen.org/publication/PubMed/12198154" } ] }, { "title": "Pro-apoptotic function of HBV X protein is mediated by interaction with c-FLIP and enhancement of death-inducing signal.", "journal": "EMBO J.", "date": "2003", "authors": "Kim Kyun-Hwan, Seong Baik L", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" } ], "reference": [ { "type": "PubMed", "id": "12727877", "url": "https://glygen.org/publication/PubMed/12727877" } ] }, { "title": "An unappreciated role for RNA surveillance.", "journal": "Genome Biol.", "date": "2004", "authors": "Hillman R Tyler, Green Richard E, Brenner Steven E", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" } ], "reference": [ { "type": "PubMed", "id": "14759258", "url": "https://glygen.org/publication/PubMed/14759258" } ] }, { "title": "Receptor-mediated endocytosis is not required for tumor necrosis factor-related apoptosis-inducing ligand (TRAIL)-induced apoptosis.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Kohlhaas SL, Craxton A, Sun XM, Pinkoski MJ, Cohen GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-75158", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75158" } ], "reference": [ { "type": "PubMed", "id": "17327223", "url": "https://glygen.org/publication/PubMed/17327223" } ] }, { "title": "Activation-induced degradation of FLIP(L) is mediated via the phosphatidylinositol 3-kinase/Akt signaling pathway in macrophages.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Shi B, Tran T, Sobkoviak R, Pope RM", "evidence": [ { "database": "iPTMnet", "id": "O15519", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15519" } ], "reference": [ { "type": "PubMed", "id": "19339247", "url": "https://glygen.org/publication/PubMed/19339247" } ] }, { "title": "PKC-mediated phosphorylation regulates c-FLIP ubiquitylation and stability.", "journal": "Cell death and differentiation", "date": "2009", "authors": "Kaunisto A, Kochin V, Asaoka T, Mikhailov A, Poukkula M, Meinander A, Eriksson JE", "evidence": [ { "database": "iPTMnet", "id": "O15519", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15519" } ], "reference": [ { "type": "PubMed", "id": "19343040", "url": "https://glygen.org/publication/PubMed/19343040" } ] }, { "title": "Unraveling the binding mechanism of trivalent tumor necrosis factor ligands and their receptors.", "journal": "Molecular & cellular proteomics : MCP", "date": "2011", "authors": "Reis CR, van Assen AH, Quax WJ, Cool RH", "evidence": [ { "database": "Reactome", "id": "R-HSA-75158", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75158" } ], "reference": [ { "type": "PubMed", "id": "20852190", "url": "https://glygen.org/publication/PubMed/20852190" } ] }, { "title": "Novel phosphorylation and ubiquitination sites regulate reactive oxygen species-dependent degradation of anti-apoptotic c-FLIP protein.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Wilkie-Grantham RP, Matsuzawa S, Reed JC", "evidence": [ { "database": "iPTMnet", "id": "O15519", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15519" } ], "reference": [ { "type": "PubMed", "id": "23519470", "url": "https://glygen.org/publication/PubMed/23519470" } ] }, { "title": "c-FLIP promotes drug resistance in non-small-cell lung cancer cells via upregulating FoxM1 expression.", "journal": "Acta pharmacologica Sinica", "date": "2022-11", "authors": "Wang Wen-Die, Shang Yue, Wang Chen, Ni Jun, Wang Ai-Min, Li Gao-Jie, Su Ling, Chen Shu-Zhen", "evidence": [ { "database": "RefSeq", "id": "NP_001120655", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001120655" } ], "reference": [ { "type": "PubMed", "id": "35422085", "url": "https://glygen.org/publication/PubMed/35422085" } ] }, { "title": "The interaction of CFLAR with p130Cas promotes cell migration.", "journal": "Biochimica et biophysica acta. Molecular cell research", "date": "2023-02", "authors": "Li Hao, Li Luqi, Qiu Xun, Zhang Jing, Hua Zichun", "evidence": [ { "database": "RefSeq", "id": "NP_001120655", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001120655" } ], "reference": [ { "type": "PubMed", "id": "36400248", "url": "https://glygen.org/publication/PubMed/36400248" } ] }, { "title": "cFLIPS regulates alternative NLRP3 inflammasome activation in human monocytes.", "journal": "Cellular & molecular immunology", "date": "2023-10", "authors": "Gao Yuhui, Yu Shi, Chen Mengdan, Wang Xun, Pan Lei, Wei Bin, Meng Guangxun", "evidence": [ { "database": "RefSeq", "id": "NP_001120655", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001120655" } ], "reference": [ { "type": "PubMed", "id": "37591930", "url": "https://glygen.org/publication/PubMed/37591930" } ] }, { "title": "Identification and characterization of a new member of the TNF family that induces apoptosis.", "journal": "Immunity", "date": "1995", "authors": "Wiley SR, Schooley K, Smolak PJ, Din WS, Huang CP, Nicholl JK, Sutherland GR, Smith TD, Rauch C, Smith CA, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-75158", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75158" } ], "reference": [ { "type": "PubMed", "id": "8777713", "url": "https://glygen.org/publication/PubMed/8777713" } ] }, { "title": "The receptor for the cytotoxic ligand TRAIL.", "journal": "Science (New York, N.Y.)", "date": "1997", "authors": "Pan G, O'Rourke K, Chinnaiyan AM, Gentz R, Ebner R, Ni J, Dixit VM", "evidence": [ { "database": "Reactome", "id": "R-HSA-75158", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75158" } ], "reference": [ { "type": "PubMed", "id": "9082980", "url": "https://glygen.org/publication/PubMed/9082980" } ] }, { "title": "Casper is a FADD- and caspase-related inducer of apoptosis.", "journal": "Immunity", "date": "1997", "authors": "Shu HB, Halpin DR, Goeddel DV", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" } ], "reference": [ { "type": "PubMed", "id": "9208847", "url": "https://glygen.org/publication/PubMed/9208847" } ] }, { "title": "I-FLICE, a novel inhibitor of tumor necrosis factor receptor-1- and CD-95-induced apoptosis.", "journal": "J. Biol. Chem.", "date": "1997", "authors": "Hu S, Vincenz C, Ni J, Gentz R, Dixit VM", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" } ], "reference": [ { "type": "PubMed", "id": "9211860", "url": "https://glygen.org/publication/PubMed/9211860" } ] }, { "title": "Inhibition of death receptor signals by cellular FLIP.", "journal": "Nature", "date": "1997", "authors": "Irmler M, Thome M, Hahne M, Schneider P, Hofmann K, Steiner V, Bodmer J L, Schr\u00f6ter M, Burns K, Mattmann C, Rimoldi D, French L E, Tschopp J", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" } ], "reference": [ { "type": "PubMed", "id": "9217161", "url": "https://glygen.org/publication/PubMed/9217161" } ] }, { "title": "FLAME-1, a novel FADD-like anti-apoptotic molecule that regulates Fas/TNFR1-induced apoptosis.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Srinivasula SM, Ahmad M, Ottilie S, Bullrich F, Banks S, Wang Y, Fernandes-Alnemri T, Croce CM, Litwack G, Tomaselli KJ, Armstrong RC, Alnemri ES", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" } ], "reference": [ { "type": "PubMed", "id": "9228018", "url": "https://glygen.org/publication/PubMed/9228018" } ] }, { "title": "CASH, a novel caspase homologue with death effector domains.", "journal": "J. Biol. Chem.", "date": "1997", "authors": "Goltsev YV, Kovalenko AV, Arnold E, Varfolomeev EE, Brodianskii VM, Wallach D", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" } ], "reference": [ { "type": "PubMed", "id": "9289491", "url": "https://glygen.org/publication/PubMed/9289491" } ] }, { "title": "TRAIL-R2: a novel apoptosis-mediating receptor for TRAIL.", "journal": "The EMBO journal", "date": "1997", "authors": "Walczak H, Degli-Esposti MA, Johnson RS, Smolak PJ, Waugh JY, Boiani N, Timour MS, Gerhart MJ, Schooley KA, Smith CA, Goodwin RG, Rauch CT", "evidence": [ { "database": "Reactome", "id": "R-HSA-75158", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75158" } ], "reference": [ { "type": "PubMed", "id": "9311998", "url": "https://glygen.org/publication/PubMed/9311998" } ] }, { "title": "MRIT, a novel death-effector domain-containing protein, interacts with caspases and BclXL and initiates cell death.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1997", "authors": "Han D K, Chaudhary P M, Wright M E, Friedman C, Trask B J, Riedel R T, Baskin D G, Schwartz S M, Hood L", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" } ], "reference": [ { "type": "PubMed", "id": "9326610", "url": "https://glygen.org/publication/PubMed/9326610" } ] }, { "title": "CLARP, a death effector domain-containing protein interacts with caspase-8 and regulates apoptosis.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1997", "authors": "Inohara N, Koseki T, Hu Y, Chen S, N\u00fa\u00f1ez G", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" } ], "reference": [ { "type": "PubMed", "id": "9380701", "url": "https://glygen.org/publication/PubMed/9380701" } ] }, { "title": "The role of c-FLIP in modulation of CD95-induced apoptosis.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Scaffidi C, Schmitz I, Krammer PH, Peter ME", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" } ], "reference": [ { "type": "PubMed", "id": "9880531", "url": "https://glygen.org/publication/PubMed/9880531" } ] } ], "pathway": [ { "id": "hsa:8837", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:8837", "resource": "KEGG Pathway" }, { "id": "R-HSA-75158", "name": "TRAIL signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75158", "resource": "Reactome", "description": "TRAIL signaling" } ], "orthologs": [ { "uniprot_canonical_ac": "C0H5Y5-1", "protein_name": "CASP8 and FADD-like apoptosis regulator", "gene_name": "Cflar", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MALSTVSAEVIHQVEESLDEDEKEMMLFLCRDVTENLAPPNVRDLLDCLSERGQLSFAALAELLYRVRRFDLLKRILKTDKAAVEDHLCRSPHLVSDYRVLLMEIGENLNQSDVSSLIFLTKDYTGRGKVAKDKSFLDLVIELEKLNLIGSDQLNLLEKCLKSIHRIDLKTKIQKYTQSSQEARSNMNALQASLPKLSIKEHLYNSRLQNGRSKEPRFVEHHGIQRKPVKTSIQESGIFLPPHIHEESYRMQSKPLGICLIIDCIGNDTEYLRETFTSLGYRVQPFLFPSSHEITQIVRRFSNMTQHQDYDSFVCVLVSRGGSQSMMGVDQVYSGFSLENVKDMFKGDMCPSLRGKPKLFFIQNYEALEDNSLEVDGPAIKNVNSRHLHPRHCTTHPDADIFWSLCTADVSRLEQPSSSLSVYLQKLSQLLEQGRKRSLVDLHVELMDKVYAWNSNVPSKEKYYLSLQHTLRKKLILSHT", "length": 480 }, "evidence": [ { "id": "45917974", "url": "http://www.informatics.jax.org/homology/45917974", "database": "MGI" }, { "id": "O15519", "url": "https://omabrowser.org/oma/group/O15519/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "O35732-1", "protein_name": "CASP8 and FADD-like apoptosis regulator", "gene_name": "Cflar", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAQSPVSAEVIHQVEECLDEDEKEMMLFLCRDVTENLAAPNVRDLLDSLSERGQLSFATLAELLYRVRRFDLLKRILKTDKATVEDHLRRNPHLVSDYRVLLMEIGESLDQNDVSSLVFLTRDYTGRGKIAKDKSFLDLVIELEKLNLIASDQLNLLEKCLKNIHRIDLNTKIQKYTQSSQGARSNMNTLQASLPKLSIKYNSRLQNGRSKEPRFVEYRDSQRTLVKTSIQESGAFLPPHIREETYRMQSKPLGICLIIDCIGNDTKYLQETFTSLGYHIQLFLFPKSHDITQIVRRYASMAQHQDYDSFACVLVSLGGSQSMMGRDQVHSGFSLDHVKNMFTGDTCPSLRGKPKLFFIQNYESLGSQLEDSSLEVDGPSIKNVDSKPLQPRHCTTHPEADIFWSLCTADVSHLEKPSSSSSVYLQKLSQQLKQGRRRPLVDLHVELMDKVYAWNSGVSSKEKYSLSLQHTLRKKLILAPT", "length": 481 }, "evidence": [ { "id": "45917974", "url": "http://www.informatics.jax.org/homology/45917974", "database": "MGI" }, { "id": "O15519", "url": "https://omabrowser.org/oma/group/O15519/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 36, "go_terms": [ { "name": "regulation of apoptotic process", "id": "GO:0042981", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042981", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" } ], "pmid": "" }, { "name": "skeletal myofibril assembly", "id": "GO:0014866", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0014866", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" } ], "pmid": "" }, { "name": "skeletal muscle tissue regeneration", "id": "GO:0043403", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043403", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" } ], "pmid": "" }, { "name": "positive regulation of glomerular mesangial cell proliferation", "id": "GO:0072126", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0072126", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" } ], "pmid": "" }, { "name": "negative regulation of myoblast fusion", "id": "GO:1901740", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901740", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" } ], "pmid": "" }, { "name": "positive regulation of extracellular matrix organization", "id": "GO:1903055", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903055", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" } ], "pmid": "" }, { "name": "negative regulation of reactive oxygen species biosynthetic process", "id": "GO:1903427", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903427", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" } ], "pmid": "" }, { "name": "negative regulation of cellular response to transforming growth factor beta stimulus", "id": "GO:1903845", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903845", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" } ], "pmid": "" }, { "name": "negative regulation of hepatocyte apoptotic process", "id": "GO:1903944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903944", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" } ], "pmid": "" }, { "name": "positive regulation of hepatocyte proliferation", "id": "GO:2000347", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000347", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" } ], "pmid": "" }, { "name": "proteolysis", "id": "GO:0006508", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006508", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" } ], "pmid": "" }, { "name": "positive regulation of neuron projection development", "id": "GO:0010976", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010976", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" } ], "pmid": "" }, { "name": "cellular response to insulin stimulus", "id": "GO:0032869", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032869", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" } ], "pmid": "" }, { "name": "positive regulation of apoptotic process", "id": "GO:0043065", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043065", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" } ], "pmid": "" }, { "name": "negative regulation of apoptotic process", "id": "GO:0043066", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043066", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" } ], "pmid": "" }, { "name": "positive regulation of NF-kappaB transcription factor activity", "id": "GO:0051092", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051092", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" } ], "pmid": "" }, { "name": "positive regulation of ERK1 and ERK2 cascade", "id": "GO:0070374", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070374", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" } ], "pmid": "" }, { "name": "apoptotic process", "id": "GO:0006915", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006915", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" } ], "pmid": "" }, { "name": "keratinocyte differentiation", "id": "GO:0030216", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030216", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" } ], "pmid": "" }, { "name": "erythrocyte differentiation", "id": "GO:0030218", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030218", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" } ], "pmid": "" }, { "name": "cellular response to hypoxia", "id": "GO:0071456", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071456", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" } ], "pmid": "" }, { "name": "positive regulation of canonical NF-kappaB signal transduction", "id": "GO:0043123", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043123", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" } ], "pmid": "" }, { "name": "neuron differentiation", "id": "GO:0030182", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030182", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" } ], "pmid": "" }, { "name": "cellular response to dexamethasone stimulus", "id": "GO:0071549", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071549", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" } ], "pmid": "" }, { "name": "skeletal muscle atrophy", "id": "GO:0014732", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0014732", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" } ], "pmid": "" }, { "name": "negative regulation of extrinsic apoptotic signaling pathway", "id": "GO:2001237", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2001237", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" } ], "pmid": "" }, { "name": "cellular response to epidermal growth factor stimulus", "id": "GO:0071364", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071364", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" } ], "pmid": "" }, { "name": "cellular response to estradiol stimulus", "id": "GO:0071392", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071392", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" } ], "pmid": "" }, { "name": "cellular response to nitric oxide", "id": "GO:0071732", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071732", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" } ], "pmid": "" }, { "name": "negative regulation of cardiac muscle cell apoptotic process", "id": "GO:0010667", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010667", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" } ], "pmid": "" }, { "name": "regulation of skeletal muscle satellite cell proliferation", "id": "GO:0014842", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0014842", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" } ], "pmid": "" }, { "name": "negative regulation of extrinsic apoptotic signaling pathway via death domain receptors", "id": "GO:1902042", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902042", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" } ], "pmid": "" }, { "name": "wound healing", "id": "GO:0042060", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042060", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" } ], "pmid": "" }, { "name": "skeletal muscle tissue development", "id": "GO:0007519", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007519", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" } ], "pmid": "" }, { "name": "response to testosterone", "id": "GO:0033574", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033574", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" } ], "pmid": "" }, { "name": "regulation of necroptotic process", "id": "GO:0060544", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060544", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 5, "go_terms": [ { "name": "protease binding", "id": "GO:0002020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002020", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" } ], "pmid": "" }, { "name": "enzyme activator activity", "id": "GO:0008047", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008047", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" } ], "pmid": "" }, { "name": "protein-containing complex binding", "id": "GO:0044877", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044877", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" } ], "pmid": "" }, { "name": "cysteine-type endopeptidase activity involved in apoptotic process", "id": "GO:0097153", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097153", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" } ], "pmid": "" }, { "name": "death receptor binding", "id": "GO:0005123", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005123", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 5, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" } ], "pmid": "" }, { "name": "CD95 death-inducing signaling complex", "id": "GO:0031265", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031265", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" } ], "pmid": "" }, { "name": "ripoptosome", "id": "GO:0097342", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097342", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" } ], "pmid": "" }, { "name": "death-inducing signaling complex", "id": "GO:0031264", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031264", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 262, "end_pos": 264, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Proteolytically processed by CASP8 generating subunit p43 and p12.", "evidence": [ { "database": "UniProtKB", "id": "O15519", "url": "https://www.uniprot.org/uniprot/O15519" }, { "database": "PubMed", "id": "9228018", "url": "https://glygen.org/publication/PubMed/9228018" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [ 293 ], "glycation_sites": [], "phosphorylation_sites": [ 166, 193, 273 ], "sequon_annotation_sites": [ { "start_pos": 262, "end_pos": 264 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 27 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }