{ "uniprot_canonical_ac": "O15514-1", "uniprot_ac": "O15514", "uniprot_id": "RPB4_HUMAN", "mass": { "chemical_mass": 16311.0, "monoisotopic_mass": 16311.0 }, "refseq": { "ac": "NP_004796", "name": "DNA-directed RNA polymerase II subunit RPB4", "summary": "This gene encodes the fourth largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. In yeast, this polymerase subunit is associated with the polymerase under suboptimal growth conditions and may have a stress protective role. A sequence for a ribosomal pseudogene is contained within the 3' untranslated region of the transcript from this gene. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004796" }, "gene_names": [ { "name": "POLR2D", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O15514", "id": "O15514" }, { "name": "HSRBP4; HSRPB4; RBP4; RPB16; RPB4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004796", "id": "NP_004796" }, { "name": "POLR2D", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004796", "id": "NP_004796" } ], "protein_names": [ { "name": "DNA-directed RNA polymerase II subunit RPB4", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O15514" }, { "name": "DNA-directed RNA polymerase II subunit D", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O15514" }, { "name": "DNA-directed RNA polymerase II subunit RPB4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004796", "id": "NP_004796" }, { "name": "RNA polymerase II 16 kDa subunit", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O15514" }, { "name": "RNA polymerase II subunit B4", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O15514" }, { "name": "RNA polymerase II subunit hsRBP4; RNA polymerase II subunit B4; DNA-directed RNA polymerase II subunit D; DNA-directed RNA polymerase II 16 kDa polypeptide; RNA polymerase II 16 kDa subunit; polymerase (RNA) II (DNA directed) polypeptide D; polymerase (RNA) II subunit D; RNA polymerase II subunit hsRPB4", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004796", "id": "NP_004796" }, { "name": "RPB16", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O15514" } ], "function": [ { "annotation": "DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Component of RNA polymerase II which synthesizes mRNA precursors and many functional non-coding RNAs. Pol II is the central component of the basal RNA polymerase II transcription machinery. It is composed of mobile elements that move relative to each other. RPB4 is part of a subcomplex with RPB7 that binds to a pocket formed by RPB1, RPB2 and RPB6 at the base of the clamp element. The RPB4-RPB7 subcomplex seems to lock the clamp via RPB7 in the closed conformation thus preventing double-stranded DNA to enter the active site cleft. The RPB4-RPB7 subcomplex binds single-stranded DNA and RNA (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "O15514", "url": "https://www.uniprot.org/uniprot/O15514#function" }, { "database": "PubMed", "id": "9852112", "url": "https://glygen.org/publication/PubMed/9852112" } ] }, { "annotation": "Identification of the RNA binding region of Rpb4. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_004796", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004796" }, { "database": "PubMed", "id": "16282592", "url": "https://glygen.org/publication/PubMed/16282592" } ] }, { "annotation": "Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)", "evidence": [ { "database": "RefSeq", "id": "NP_004796", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004796" }, { "database": "PubMed", "id": "19237606", "url": "https://glygen.org/publication/PubMed/19237606" } ] }, { "annotation": "This gene encodes the fourth largest subunit of RNA polymerase II, the polymerase responsible for synthesizing messenger RNA in eukaryotes. In yeast, this polymerase subunit is associated with the polymerase under suboptimal growth conditions and may have a stress protective role. A sequence for a ribosomal pseudogene is contained within the 3' untranslated region of the transcript from this gene. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_004796", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004796" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "81.58", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000144231", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000144231" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "75.85", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000144231", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000144231" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "78.01", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000144231", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000144231" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "84.78", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000144231", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000144231" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "87.85", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000144231", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000144231" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "79.03", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000144231", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000144231" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "79.17", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000144231", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000144231" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "85", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000144231", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000144231" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "79.61", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000144231", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000144231" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "80.4", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000144231", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000144231" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O15514", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15514" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O15514", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15514" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O15514", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15514" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O15514", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15514" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O15514", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15514" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O15514", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15514" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O15514", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15514" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O15514", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15514" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O15514", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15514" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O15514", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15514" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O15514", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15514" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O15514", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15514" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O15514", "url": "https://www.uniprot.org/uniprot/O15514" } ], "common_name": "Human" } ], "gene": [ { "name": "POLR2D", "url": "https://www.uniprot.org/uniprot/O15514", "locus": { "chromosome": "2", "start_pos": 127843553, "end_pos": 127858155, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000144231", "url": "https://www.ensembl.org/id/ENSG00000144231" } ] } } ], "crossref": [ { "id": "ENSG00000144231", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000144231", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "POLR2D", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=POLR2D", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "5433", "url": "https://www.ncbi.nlm.nih.gov/gene/5433", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "9191", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=9191", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O15514", "url": "https://www.ebi.ac.uk/intact/interactors/id:O15514*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR005574", "url": "https://www.ebi.ac.uk/interpro/entry/IPR005574", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006590", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006590", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR010997", "url": "https://www.ebi.ac.uk/interpro/entry/IPR010997", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR038324", "url": "https://www.ebi.ac.uk/interpro/entry/IPR038324", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR045222", "url": "https://www.ebi.ac.uk/interpro/entry/IPR045222", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:5433", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:5433", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "606017", "url": "http://www.omim.org/entry/606017", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O15514", "url": "https://www.nextprot.org/entry/NX_O15514", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "TMRKFQS", "url": "https://omabrowser.org/oma/group/TMRKFQS/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5477031at2759", "url": "http://www.orthodb.org/?query=5477031at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR21297", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR21297", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR21297:SF0", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR21297:SF0", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "2C35", "url": "https://www.rcsb.org/structure/2C35", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5IY6", "url": "https://www.rcsb.org/structure/5IY6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5IY7", "url": "https://www.rcsb.org/structure/5IY7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5IY8", "url": "https://www.rcsb.org/structure/5IY8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5IY9", "url": "https://www.rcsb.org/structure/5IY9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5IYA", "url": "https://www.rcsb.org/structure/5IYA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5IYB", "url": "https://www.rcsb.org/structure/5IYB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5IYC", "url": "https://www.rcsb.org/structure/5IYC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5IYD", "url": "https://www.rcsb.org/structure/5IYD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6DRD", "url": "https://www.rcsb.org/structure/6DRD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6O9L", "url": "https://www.rcsb.org/structure/6O9L", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6XRE", "url": "https://www.rcsb.org/structure/6XRE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7LBM", "url": "https://www.rcsb.org/structure/7LBM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF03874", "url": "http://pfam.xfam.org/family/PF03874", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O15514", "url": "https://pharos.nih.gov/targets/O15514", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O15514", "url": "http://purl.obolibrary.org/obo/PR_O15514", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-112382", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-112382", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-113418", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-113418", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-167152", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-167152", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-167158", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-167158", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-167160", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-167160", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-167161", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-167161", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-167162", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-167162", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-167172", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-167172", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-167200", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-167200", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-167238", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-167238", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-167242", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-167242", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-167243", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-167243", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-167246", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-167246", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-167287", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-167287", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-167290", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-167290", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-168325", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168325", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-203927", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203927", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5601884", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5601884", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-674695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-674695", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6781823", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6781823", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6781827", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6781827", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6782135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6782135", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6782210", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6782210", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6796648", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6796648", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6803529", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803529", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-72086", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72086", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-72165", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72165", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-72203", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72203", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-73776", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-73776", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-73779", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-73779", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-75953", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75953", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-75955", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75955", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-76042", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-76042", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-77075", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-77075", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8851708", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8851708", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9670095", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9670095", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_004796", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004796", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "E9PB93", "url": "https://www.uniprot.org/uniprot/E9PB93", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PB93-1", "url": "https://www.uniprot.org/uniprot/E9PB93-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PHV4", "url": "https://www.uniprot.org/uniprot/E9PHV4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PHV4-1", "url": "https://www.uniprot.org/uniprot/E9PHV4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O15514", "url": "https://www.uniprot.org/uniprot/O15514", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O15514-1", "url": "https://www.uniprot.org/uniprot/O15514-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAAGGSDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEVFMKTLNYTARFSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKRSFQY", "length": 142, "header": "sp|O15514-1|RPB4_HUMAN Isoform 1 of DNA-directed RNA polymerase II subunit RPB4 OS=Homo sapiens OX=9606 GN=POLR2D PE=1 SV=1 CANONICAL=O15514-1" }, "isoforms": [ { "isoform_ac": "E9PB93-1", "url": "", "sequence": { "sequence": "MLLEHRKQQNESAEDEQELSEVFMKTLNYTARFSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKRSFQY", "length": 104, "header": "tr|E9PB93-1|RPB4_HUMAN Computationally mapped isoform of DNA-directed RNA polymerase II subunit RPB4 OS=Homo sapiens OX=9606 GN=POLR2D PE=1 SV=1 CANONICAL=O15514-1" }, "locus": { "chromosome": "2", "start_pos": 127853064, "end_pos": 127848110, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000409698.1", "url": "https://www.ensembl.org/id/ENST00000409698.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000387117.1", "url": "https://www.ensembl.org/id/ENSP00000387117.1" } ] } }, { "isoform_ac": "E9PHV4-1", "url": "", "sequence": { "sequence": "MAAGGSDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEVFMKTLNYTARFSRFKNRETIASVRSLEGRFEDEELQQILDDIQTKRSFQY", "length": 110, "header": "tr|E9PHV4-1|RPB4_HUMAN Computationally mapped isoform of DNA-directed RNA polymerase II subunit RPB4 OS=Homo sapiens OX=9606 GN=POLR2D PE=1 SV=1 CANONICAL=O15514-1" }, "locus": { "chromosome": "2", "start_pos": 127858100, "end_pos": 127848110, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000409955.1", "url": "https://www.ensembl.org/id/ENST00000409955.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000387323.1", "url": "https://www.ensembl.org/id/ENSP00000387323.1" } ] } }, { "isoform_ac": "O15514-1", "url": "", "sequence": { "sequence": "MAAGGSDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEVFMKTLNYTARFSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKRSFQY", "length": 142, "header": "sp|O15514-1|RPB4_HUMAN Isoform 1 of DNA-directed RNA polymerase II subunit RPB4 OS=Homo sapiens OX=9606 GN=POLR2D PE=1 SV=1 CANONICAL=O15514-1" }, "locus": { "chromosome": "2", "start_pos": 127858100, "end_pos": 127848110, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000272645.9", "url": "https://www.ensembl.org/id/ENST00000272645.9" }, { "database": "Ensembl Peptide", "id": "ENSP00000272645.3", "url": "https://www.ensembl.org/id/ENSP00000272645.3" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "The general transcription factors IIA, IIB, IIF, and IIE are required for RNA polymerase II transcription from the human U1 small nuclear RNA promoter.", "journal": "Molecular and cellular biology", "date": "1999", "authors": "Kuhlman TC, Cho H, Reinberg D, Hernandez N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "10022900", "url": "https://glygen.org/publication/PubMed/10022900" } ] }, { "title": "Reconstitution of the transcription factor TFIIH: assignment of functions for the three enzymatic subunits, XPB, XPD, and cdk7.", "journal": "Molecular cell", "date": "1999", "authors": "Tirode F, Busso D, Coin F, Egly JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-167161", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-167161" } ], "reference": [ { "type": "PubMed", "id": "10024882", "url": "https://glygen.org/publication/PubMed/10024882" } ] }, { "title": "NELF, a multisubunit complex containing RD, cooperates with DSIF to repress RNA polymerase II elongation.", "journal": "Cell", "date": "1999", "authors": "Yamaguchi Y, Takagi T, Wada T, Yano K, Furuya A, Sugimoto S, Hasegawa J, Handa H", "evidence": [ { "database": "Reactome", "id": "R-HSA-674695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-674695" } ], "reference": [ { "type": "PubMed", "id": "10199401", "url": "https://glygen.org/publication/PubMed/10199401" } ] }, { "title": "AT-AC pre-mRNA splicing mechanisms and conservation of minor introns in voltage-gated ion channel genes.", "journal": "Molecular and cellular biology", "date": "1999", "authors": "Wu Q, Krainer AR", "evidence": [ { "database": "Reactome", "id": "R-HSA-72165", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72165" } ], "reference": [ { "type": "PubMed", "id": "10207048", "url": "https://glygen.org/publication/PubMed/10207048" } ] }, { "title": "Estrogen induction of the cyclin D1 promoter: involvement of a cAMP response-like element.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Sabbah M, Courilleau D, Mester J, Redeuilh G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "10500157", "url": "https://glygen.org/publication/PubMed/10500157" } ] }, { "title": "Two separate sequences of PB2 subunit constitute the RNA cap-binding site of influenza virus RNA polymerase.", "journal": "Genes to cells : devoted to molecular & cellular mechanisms", "date": "1999", "authors": "Honda A, Mizumoto K, Ishihama A", "evidence": [ { "database": "Reactome", "id": "R-HSA-168325", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168325" } ], "reference": [ { "type": "PubMed", "id": "10526235", "url": "https://glygen.org/publication/PubMed/10526235" } ] }, { "title": "Peeling by binding or twisting by cranking: models for promoter opening and transcription initiation by RNA polymerase II.", "journal": "BioEssays : news and reviews in molecular, cellular and developmental biology", "date": "2000", "authors": "Fiedler U, Marc Timmers HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-167161", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-167161" } ], "reference": [ { "type": "PubMed", "id": "10723029", "url": "https://glygen.org/publication/PubMed/10723029" } ] }, { "title": "Domains in the SPT5 protein that modulate its transcriptional regulatory properties.", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Ivanov D, Kwak YT, Guo J, Gaynor RB", "evidence": [ { "database": "Reactome", "id": "R-HSA-167158", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-167158" } ], "reference": [ { "type": "PubMed", "id": "10757782", "url": "https://glygen.org/publication/PubMed/10757782" } ] }, { "title": "Recruitment of nuclear receptor corepressor and coactivator to the retinoic acid receptor by retinoid ligands. Influence of DNA-heterodimer interactions.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Klein ES, Wang JW, Khalifa B, Gavigan SA, Chandraratna RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "10777502", "url": "https://glygen.org/publication/PubMed/10777502" } ] }, { "title": "Transcriptional activation of transforming growth factor alpha by estradiol: requirement for both a GC-rich site and an estrogen response element half-site.", "journal": "Journal of molecular endocrinology", "date": "2000", "authors": "Vyhlidal C, Samudio I, Kladde MP, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "10828826", "url": "https://glygen.org/publication/PubMed/10828826" } ] }, { "title": "Tat modifies the activity of CDK9 to phosphorylate serine 5 of the RNA polymerase II carboxyl-terminal domain during human immunodeficiency virus type 1 transcription.", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Zhou M, Halanski MA, Radonovich MF, Kashanchi F, Peng J, Price DH, Brady JN", "evidence": [ { "database": "Reactome", "id": "R-HSA-167152", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-167152" } ], "reference": [ { "type": "PubMed", "id": "10866664", "url": "https://glygen.org/publication/PubMed/10866664" } ] }, { "title": "Promoter analysis and chromosomal mapping of human EBAG9 gene.", "journal": "Biochemical and biophysical research communications", "date": "2000", "authors": "Ikeda K, Sato M, Tsutsumi O, Tsuchiya F, Tsuneizumi M, Emi M, Imoto I, Inazawa J, Muramatsu M, Inoue S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "10873660", "url": "https://glygen.org/publication/PubMed/10873660" } ] }, { "title": "Functional association of U2 snRNP with the ATP-independent spliceosomal complex E.", "journal": "Molecular cell", "date": "2000", "authors": "Das R, Zhou Z, Reed R", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "10882114", "url": "https://glygen.org/publication/PubMed/10882114" } ] }, { "title": "Control of elongation by RNA polymerase II.", "journal": "Trends in biochemical sciences", "date": "2000", "authors": "Conaway JW, Shilatifard A, Dvir A, Conaway RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-167158", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-167158" } ], "reference": [ { "type": "PubMed", "id": "10916156", "url": "https://glygen.org/publication/PubMed/10916156" } ] }, { "title": "Selective nuclear export of viral mRNAs in influenza-virus-infected cells.", "journal": "Trends in microbiology", "date": "2000", "authors": "Chen Z, Krug RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-168325", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168325" } ], "reference": [ { "type": "PubMed", "id": "10920397", "url": "https://glygen.org/publication/PubMed/10920397" } ] }, { "title": "The RNA-binding protein TIA-1 is a novel mammalian splicing regulator acting through intron sequences adjacent to a 5' splice site.", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Del Gatto-Konczak F, Bourgeois CF, Le Guiner C, Kister L, Gesnel MC, Stevenin J, Breathnach R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803529", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803529" } ], "reference": [ { "type": "PubMed", "id": "10938105", "url": "https://glygen.org/publication/PubMed/10938105" } ] }, { "title": "XAB2, a novel tetratricopeptide repeat protein involved in transcription-coupled DNA repair and transcription.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Nakatsu Y, Asahina H, Citterio E, Rademakers S, Vermeulen W, Kamiuchi S, Yeo JP, Khaw MC, Saijo M, Kodo N, Matsuda T, Hoeijmakers JH, Tanaka K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6781823", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6781823" } ], "reference": [ { "type": "PubMed", "id": "10944529", "url": "https://glygen.org/publication/PubMed/10944529" } ] }, { "title": "An intronic splicing silencer causes skipping of the IIIb exon of fibroblast growth factor receptor 2 through involvement of polypyrimidine tract binding protein.", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Carstens RP, Wagner EJ, Garcia-Blanco MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803529", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803529" } ], "reference": [ { "type": "PubMed", "id": "10982855", "url": "https://glygen.org/publication/PubMed/10982855" } ] }, { "title": "p53 and c-Jun functionally synergize in the regulation of the DNA repair gene hMSH2 in response to UV.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Scherer SJ, Maier SM, Seifert M, Hanselmann RG, Zang KD, Muller-Hermelink HK, Angel P, Welter C, Schartl M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6796648", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6796648" } ], "reference": [ { "type": "PubMed", "id": "10984493", "url": "https://glygen.org/publication/PubMed/10984493" } ] }, { "title": "Synergistic, p160 coactivator-dependent enhancement of estrogen receptor function by CARM1 and p300.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Chen D, Huang SM, Stallcup MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11010967", "url": "https://glygen.org/publication/PubMed/11010967" } ] }, { "title": "The protein Aly links pre-messenger-RNA splicing to nuclear export in metazoans.", "journal": "Nature", "date": "2000", "authors": "Zhou Z, Luo MJ, Straesser K, Katahira J, Hurt E, Reed R", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "11014198", "url": "https://glygen.org/publication/PubMed/11014198" } ] }, { "title": "MYB oncogene amplification in hereditary BRCA1 breast cancer.", "journal": "Cancer research", "date": "2000", "authors": "Kauraniemi P, Hedenfalk I, Persson K, Duggan DJ, Tanner M, Johannsson O, Olsson H, Trent JM, Isola J, Borg A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11034064", "url": "https://glygen.org/publication/PubMed/11034064" } ] }, { "title": "Functional analysis of the human CDC5L complex and identification of its components by mass spectrometry.", "journal": "The EMBO journal", "date": "2000", "authors": "Ajuh P, Kuster B, Panov K, Zomerdijk JC, Mann M, Lamond AI", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "11101529", "url": "https://glygen.org/publication/PubMed/11101529" } ] }, { "title": "PDZK1 and GREB1 are estrogen-regulated genes expressed in hormone-responsive breast cancer.", "journal": "Cancer research", "date": "2000", "authors": "Ghosh MG, Thompson DA, Weigel RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11103799", "url": "https://glygen.org/publication/PubMed/11103799" } ] }, { "title": "Cofactor dynamics and sufficiency in estrogen receptor-regulated transcription.", "journal": "Cell", "date": "2000", "authors": "Shang Y, Hu X, DiRenzo J, Lazar MA, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11136970", "url": "https://glygen.org/publication/PubMed/11136970" } ] }, { "title": "Transcriptional activation of cathepsin D gene expression by 17beta-estradiol: mechanism of aryl hydrocarbon receptor-mediated inhibition.", "journal": "Molecular and cellular endocrinology", "date": "2001", "authors": "Wang F, Samudio I, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11165043", "url": "https://glygen.org/publication/PubMed/11165043" } ] }, { "title": "Role for a bidentate ribonuclease in the initiation step of RNA interference.", "journal": "Nature", "date": "2001", "authors": "Bernstein E, Caudy AA, Hammond SM, Hannon GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-203927", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203927" } ], "reference": [ { "type": "PubMed", "id": "11201747", "url": "https://glygen.org/publication/PubMed/11201747" } ] }, { "title": "The 100-kda U5 snRNP protein (hPrp28p) contacts the 5' splice site through its ATPase site.", "journal": "RNA (New York, N.Y.)", "date": "2001", "authors": "Ismaili N, Sha M, Gustafson EH, Konarska MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "11233976", "url": "https://glygen.org/publication/PubMed/11233976" } ] }, { "title": "Structural basis of transcription: RNA polymerase II at 2.8 angstrom resolution.", "journal": "Science (New York, N.Y.)", "date": "2001", "authors": "Cramer P, Bushnell DA, Kornberg RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-75955", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75955" } ], "reference": [ { "type": "PubMed", "id": "11313498", "url": "https://glygen.org/publication/PubMed/11313498" } ] }, { "title": "Structural basis of transcription: an RNA polymerase II elongation complex at 3.3 A resolution.", "journal": "Science (New York, N.Y.)", "date": "2001", "authors": "Gnatt AL, Cramer P, Fu J, Bushnell DA, Kornberg RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-75955", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75955" } ], "reference": [ { "type": "PubMed", "id": "11313499", "url": "https://glygen.org/publication/PubMed/11313499" } ] }, { "title": "Functions of SR proteins in the U12-dependent AT-AC pre-mRNA splicing pathway.", "journal": "RNA (New York, N.Y.)", "date": "2001", "authors": "Hastings ML, Krainer AR", "evidence": [ { "database": "Reactome", "id": "R-HSA-72165", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72165" } ], "reference": [ { "type": "PubMed", "id": "11333026", "url": "https://glygen.org/publication/PubMed/11333026" } ] }, { "title": "Transcriptional activation of genes by 17 beta-estradiol through estrogen receptor-Sp1 interactions.", "journal": "Vitamins and hormones", "date": "2001", "authors": "Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11345900", "url": "https://glygen.org/publication/PubMed/11345900" } ] }, { "title": "Identification of a p53 response element in the promoter region of the hMSH2 gene required for expression in A2780 ovarian cancer cells.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Warnick CT, Dabbas B, Ford CD, Strait KA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6796648", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6796648" } ], "reference": [ { "type": "PubMed", "id": "11350971", "url": "https://glygen.org/publication/PubMed/11350971" } ] }, { "title": "Estrogen regulation of cyclin D1 gene expression in ZR-75 breast cancer cells involves multiple enhancer elements.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Castro-Rivera E, Samudio I, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11410592", "url": "https://glygen.org/publication/PubMed/11410592" } ] }, { "title": "Analysis of the open region of RNA polymerase II transcription complexes in the early phase of elongation.", "journal": "Nucleic acids research", "date": "2001", "authors": "Fiedler U, Timmers HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-73776", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-73776" } ], "reference": [ { "type": "PubMed", "id": "11433015", "url": "https://glygen.org/publication/PubMed/11433015" } ] }, { "title": "Estrogen receptor interaction with estrogen response elements.", "journal": "Nucleic acids research", "date": "2001", "authors": "Klinge CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11452016", "url": "https://glygen.org/publication/PubMed/11452016" } ] }, { "title": "A cellular function for the RNA-interference enzyme Dicer in the maturation of the let-7 small temporal RNA.", "journal": "Science (New York, N.Y.)", "date": "2001", "authors": "Hutvagner G, McLachlan J, Pasquinelli AE, Balint E, Tuschl T, Zamore PD", "evidence": [ { "database": "Reactome", "id": "R-HSA-203927", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203927" } ], "reference": [ { "type": "PubMed", "id": "11452083", "url": "https://glygen.org/publication/PubMed/11452083" } ] }, { "title": "Promoter clearance by RNA polymerase II is an extended, multistep process strongly affected by sequence.", "journal": "Molecular and cellular biology", "date": "2001", "authors": "Pal M, McKean D, Luse DS", "evidence": [ { "database": "Reactome", "id": "R-HSA-73776", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-73776" } ], "reference": [ { "type": "PubMed", "id": "11486021", "url": "https://glygen.org/publication/PubMed/11486021" } ] }, { "title": "Selective coactivation of estrogen-dependent transcription by CITED1 CBP/p300-binding protein.", "journal": "Genes & development", "date": "2001", "authors": "Yahata T, Shao W, Endoh H, Hur J, Coser KR, Sun H, Ueda Y, Kato S, Isselbacher KJ, Brown M, Shioda T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11581164", "url": "https://glygen.org/publication/PubMed/11581164" } ] }, { "title": "Splicing-related catalysis by protein-free snRNAs.", "journal": "Nature", "date": "2001", "authors": "Valadkhan S, Manley JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-72165", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72165" } ], "reference": [ { "type": "PubMed", "id": "11607023", "url": "https://glygen.org/publication/PubMed/11607023" } ] }, { "title": "Synergism between ERalpha transactivation function 1 (AF-1) and AF-2 mediated by steroid receptor coactivator protein-1: requirement for the AF-1 alpha-helical core and for a direct interaction between the N- and C-terminal domains.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2001", "authors": "Metivier R, Penot G, Flouriot G, Pakdel F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "11682626", "url": "https://glygen.org/publication/PubMed/11682626" } ] }, { "title": "Strong natural pausing by RNA polymerase II within 10 bases of transcription start may result in repeated slippage and reextension of the nascent RNA.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Pal M, Luse DS", "evidence": [ { "database": "Reactome", "id": "R-HSA-167162", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-167162" } ], "reference": [ { "type": "PubMed", "id": "11739720", "url": "https://glygen.org/publication/PubMed/11739720" } ] }, { "title": "Translocation after synthesis of a four-nucleotide RNA commits RNA polymerase II to promoter escape.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Kugel JF, Goodrich JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-167162", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-167162" } ], "reference": [ { "type": "PubMed", "id": "11784853", "url": "https://glygen.org/publication/PubMed/11784853" } ] }, { "title": "Crystallization of the Oct-1/SNAP190 peptide/DNA complex.", "journal": "Acta crystallographica. Section D, Biological crystallography", "date": "2002", "authors": "Hovde S, Brooks A, Strong K, Geiger JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "11856838", "url": "https://glygen.org/publication/PubMed/11856838" } ] }, { "title": "A Rad26-Def1 complex coordinates repair and RNA pol II proteolysis in response to DNA damage.", "journal": "Nature", "date": "2002", "authors": "Woudstra EC, Gilbert C, Fellows J, Jansen L, Brouwer J, Erdjument-Bromage H, Tempst P, Svejstrup JQ", "evidence": [ { "database": "Reactome", "id": "R-HSA-674695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-674695" } ], "reference": [ { "type": "PubMed", "id": "11859374", "url": "https://glygen.org/publication/PubMed/11859374" } ] }, { "title": "P-TEFb containing cyclin K and Cdk9 can activate transcription via RNA.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Lin X, Taube R, Fujinaga K, Peterlin BM", "evidence": [ { "database": "Reactome", "id": "R-HSA-674695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-674695" } ], "reference": [ { "type": "PubMed", "id": "11884399", "url": "https://glygen.org/publication/PubMed/11884399" } ] }, { "title": "Transcription-coupled and DNA damage-dependent ubiquitination of RNA polymerase II in vitro.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Lee KB, Wang D, Lippard SJ, Sharp PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6781823", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6781823" } ], "reference": [ { "type": "PubMed", "id": "11904382", "url": "https://glygen.org/publication/PubMed/11904382" } ] }, { "title": "p53 Binds and activates the xeroderma pigmentosum DDB2 gene in humans but not mice.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Tan T, Chu G", "evidence": [ { "database": "Reactome", "id": "R-HSA-6796648", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6796648" } ], "reference": [ { "type": "PubMed", "id": "11971958", "url": "https://glygen.org/publication/PubMed/11971958" } ] }, { "title": "Cyclin K as a direct transcriptional target of the p53 tumor suppressor.", "journal": "Neoplasia (New York, N.Y.)", "date": "2002", "authors": "Mori T, Anazawa Y, Matsui K, Fukuda S, Nakamura Y, Arakawa H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6796648", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6796648" } ], "reference": [ { "type": "PubMed", "id": "11988847", "url": "https://glygen.org/publication/PubMed/11988847" } ] }, { "title": "Purification and characterization of native spliceosomes suitable for three-dimensional structural analysis.", "journal": "RNA (New York, N.Y.)", "date": "2002", "authors": "Jurica MS, Licklider LJ, Gygi SR, Grigorieff N, Moore MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "11991638", "url": "https://glygen.org/publication/PubMed/11991638" } ] }, { "title": "The RNA polymerase of influenza a virus is stabilized by interaction with its viral RNA promoter.", "journal": "Journal of virology", "date": "2002", "authors": "Brownlee GG, Sharps JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-168325", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168325" } ], "reference": [ { "type": "PubMed", "id": "12072510", "url": "https://glygen.org/publication/PubMed/12072510" } ] }, { "title": "Large-scale proteomic analysis of the human spliceosome.", "journal": "Genome research", "date": "2002", "authors": "Rappsilber J, Ryder U, Lamond AI, Mann M", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "12176931", "url": "https://glygen.org/publication/PubMed/12176931" } ] }, { "title": "Transcription-coupled nucleotide excision repair as a determinant of cisplatin sensitivity of human cells.", "journal": "Cancer research", "date": "2002", "authors": "Furuta T, Ueda T, Aune G, Sarasin A, Kraemer KH, Pommier Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-6781823", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6781823" } ], "reference": [ { "type": "PubMed", "id": "12208738", "url": "https://glygen.org/publication/PubMed/12208738" } ] }, { "title": "FCP1, a phosphatase specific for the heptapeptide repeat of the largest subunit of RNA polymerase II, stimulates transcription elongation.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Mandal SS, Cho H, Kim S, Cabane K, Reinberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-113418", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-113418" } ], "reference": [ { "type": "PubMed", "id": "12370301", "url": "https://glygen.org/publication/PubMed/12370301" } ] }, { "title": "A Non-sequence-specific double-stranded RNA structural element regulates splicing of two mutually exclusive exons of fibroblast growth factor receptor 2 (FGFR2).", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Muh SJ, Hovhannisyan RH, Carstens RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803529", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803529" } ], "reference": [ { "type": "PubMed", "id": "12393912", "url": "https://glygen.org/publication/PubMed/12393912" } ] }, { "title": "Ribonuclease activity and RNA binding of recombinant human Dicer.", "journal": "The EMBO journal", "date": "2002", "authors": "Provost P, Dishart D, Doucet J, Frendewey D, Samuelsson B, Radmark O", "evidence": [ { "database": "Reactome", "id": "R-HSA-203927", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203927" } ], "reference": [ { "type": "PubMed", "id": "12411504", "url": "https://glygen.org/publication/PubMed/12411504" } ] }, { "title": "Human Dicer preferentially cleaves dsRNAs at their termini without a requirement for ATP.", "journal": "The EMBO journal", "date": "2002", "authors": "Zhang H, Kolb FA, Brondani V, Billy E, Filipowicz W", "evidence": [ { "database": "Reactome", "id": "R-HSA-203927", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203927" } ], "reference": [ { "type": "PubMed", "id": "12411505", "url": "https://glygen.org/publication/PubMed/12411505" } ] }, { "title": "Small nuclear ribonucleoprotein remodeling during catalytic activation of the spliceosome.", "journal": "Science (New York, N.Y.)", "date": "2002", "authors": "Makarov EM, Makarova OV, Urlaub H, Gentzel M, Will CL, Wilm M, Luhrmann R", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "12411573", "url": "https://glygen.org/publication/PubMed/12411573" } ] }, { "title": "Activator recruitment by the general transcription machinery: X-ray structural analysis of the Oct-1 POU domain/human U1 octamer/SNAP190 peptide ternary complex.", "journal": "Genes & development", "date": "2002", "authors": "Hovde S, Hinkley CS, Strong K, Brooks A, Gu L, Henry RW, Geiger J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "12414730", "url": "https://glygen.org/publication/PubMed/12414730" } ] }, { "title": "5' exon interactions within the human spliceosome establish a framework for exon junction complex structure and assembly.", "journal": "Genes & development", "date": "2002", "authors": "Reichert VL, Le Hir H, Jurica MS, Moore MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "12414731", "url": "https://glygen.org/publication/PubMed/12414731" } ] }, { "title": "Protein composition of human prespliceosomes isolated by a tobramycin affinity-selection method.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Hartmuth K, Urlaub H, Vornlocher HP, Will CL, Gentzel M, Wilm M, Luhrmann R", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "12477934", "url": "https://glygen.org/publication/PubMed/12477934" } ] }, { "title": "Crosstalk between CARM1 methylation and CBP acetylation on histone H3.", "journal": "Current biology : CB", "date": "2002", "authors": "Daujat S, Bauer UM, Shah V, Turner B, Berger S, Kouzarides T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "12498683", "url": "https://glygen.org/publication/PubMed/12498683" } ] }, { "title": "The C-terminal domain of pol II and a DRB-sensitive kinase are required for 3' processing of U2 snRNA.", "journal": "The EMBO journal", "date": "2003", "authors": "Medlin JE, Uguen P, Taylor A, Bentley DL, Murphy S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "12574128", "url": "https://glygen.org/publication/PubMed/12574128" } ] }, { "title": "Two domains of the progesterone receptor interact with the estrogen receptor and are required for progesterone activation of the c-Src/Erk pathway in mammalian cells.", "journal": "Molecular and cellular biology", "date": "2003", "authors": "Ballare C, Uhrig M, Bechtold T, Sancho E, Di Domenico M, Migliaccio A, Auricchio F, Beato M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "12612073", "url": "https://glygen.org/publication/PubMed/12612073" } ] }, { "title": "Structure-function analysis of human Spt4: evidence that hSpt4 and hSpt5 exert their roles in transcriptional elongation as parts of the DSIF complex.", "journal": "Genes to cells : devoted to molecular & cellular mechanisms", "date": "2003", "authors": "Kim DK, Inukai N, Yamada T, Furuya A, Sato H, Yamaguchi Y, Wada T, Handa H", "evidence": [ { "database": "Reactome", "id": "R-HSA-167158", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-167158" } ], "reference": [ { "type": "PubMed", "id": "12653964", "url": "https://glygen.org/publication/PubMed/12653964" } ] }, { "title": "Chromosomal protein HMGN1 enhances the rate of DNA repair in chromatin.", "journal": "The EMBO journal", "date": "2003", "authors": "Birger Y, West KL, Postnikov YV, Lim JH, Furusawa T, Wagner JP, Laufer CS, Kraemer KH, Bustin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6781823", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6781823" } ], "reference": [ { "type": "PubMed", "id": "12660172", "url": "https://glygen.org/publication/PubMed/12660172" } ] }, { "title": "The RNA polymerase II elongation complex.", "journal": "Annual review of biochemistry", "date": "2003", "authors": "Shilatifard A, Conaway RC, Conaway JW", "evidence": [ { "database": "Reactome", "id": "R-HSA-112382", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-112382" } ], "reference": [ { "type": "PubMed", "id": "12676794", "url": "https://glygen.org/publication/PubMed/12676794" } ] }, { "title": "The ubiquitin ligase activity in the DDB2 and CSA complexes is differentially regulated by the COP9 signalosome in response to DNA damage.", "journal": "Cell", "date": "2003", "authors": "Groisman R, Polanowska J, Kuraoka I, Sawada J, Saijo M, Drapkin R, Kisselev AF, Tanaka K, Nakatani Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-6781823", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6781823" } ], "reference": [ { "type": "PubMed", "id": "12732143", "url": "https://glygen.org/publication/PubMed/12732143" } ] }, { "title": "The ATRX syndrome protein forms a chromatin-remodeling complex with Daxx and localizes in promyelocytic leukemia nuclear bodies.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2003", "authors": "Xue Y, Gibbons R, Yan Z, Yang D, McDowell TL, Sechi S, Qin J, Zhou S, Higgs D, Wang W", "evidence": [ { "database": "Reactome", "id": "R-HSA-9670095", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9670095" } ], "reference": [ { "type": "PubMed", "id": "12953102", "url": "https://glygen.org/publication/PubMed/12953102" } ] }, { "title": "Profiling of estrogen up- and down-regulated gene expression in human breast cancer cells: insights into gene networks and pathways underlying estrogenic control of proliferation and cell phenotype.", "journal": "Endocrinology", "date": "2003", "authors": "Frasor J, Danes JM, Komm B, Chang KC, Lyttle CR, Katzenellenbogen BS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "12959972", "url": "https://glygen.org/publication/PubMed/12959972" } ] }, { "title": "Polymerase II promoter activation: closed complex formation and ATP-driven start site opening.", "journal": "Science (New York, N.Y.)", "date": "1992", "authors": "Wang W, Carey M, Gralla JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-167161", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-167161" } ], "reference": [ { "type": "PubMed", "id": "1310361", "url": "https://glygen.org/publication/PubMed/1310361" } ] }, { "title": "The GW182 protein colocalizes with mRNA degradation associated proteins hDcp1 and hLSm4 in cytoplasmic GW bodies.", "journal": "RNA (New York, N.Y.)", "date": "2003", "authors": "Eystathioy T, Jakymiw A, Chan EK, Seraphin B, Cougot N, Fritzler MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "13130130", "url": "https://glygen.org/publication/PubMed/13130130" } ] }, { "title": "The nuclear RNase III Drosha initiates microRNA processing.", "journal": "Nature", "date": "2003", "authors": "Lee Y, Ahn C, Han J, Choi H, Kim J, Yim J, Lee J, Provost P, Radmark O, Kim S, Kim VN", "evidence": [ { "database": "Reactome", "id": "R-HSA-203927", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203927" } ], "reference": [ { "type": "PubMed", "id": "14508493", "url": "https://glygen.org/publication/PubMed/14508493" } ] }, { "title": "The comings and goings of nucleotide excision repair factors on damaged DNA.", "journal": "The EMBO journal", "date": "2003", "authors": "Riedl T, Hanaoka F, Egly JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6782135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6782135" } ], "reference": [ { "type": "PubMed", "id": "14517266", "url": "https://glygen.org/publication/PubMed/14517266" } ] }, { "title": "A simple whole cell lysate system for in vitro splicing reveals a stepwise assembly of the exon-exon junction complex.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Kataoka N, Dreyfuss G", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "14625303", "url": "https://glygen.org/publication/PubMed/14625303" } ] }, { "title": "Nuclear export of microRNA precursors.", "journal": "Science (New York, N.Y.)", "date": "2004", "authors": "Lund E, Guttinger S, Calado A, Dahlberg JE, Kutay U", "evidence": [ { "database": "Reactome", "id": "R-HSA-203927", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203927" } ], "reference": [ { "type": "PubMed", "id": "14631048", "url": "https://glygen.org/publication/PubMed/14631048" } ] }, { "title": "Acetylation and methylation in nuclear receptor gene activation.", "journal": "Methods in enzymology", "date": "2003", "authors": "Xu W, Cho H, Evans RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "14631847", "url": "https://glygen.org/publication/PubMed/14631847" } ] }, { "title": "Estrogen receptor-alpha directs ordered, cyclical, and combinatorial recruitment of cofactors on a natural target promoter.", "journal": "Cell", "date": "2003", "authors": "Metivier R, Penot G, Hubner MR, Reid G, Brand H, Kos M, Gannon F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "14675539", "url": "https://glygen.org/publication/PubMed/14675539" } ] }, { "title": "Exportin-5 mediates the nuclear export of pre-microRNAs and short hairpin RNAs.", "journal": "Genes & development", "date": "2003", "authors": "Yi R, Qin Y, Macara IG, Cullen BR", "evidence": [ { "database": "Reactome", "id": "R-HSA-203927", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203927" } ], "reference": [ { "type": "PubMed", "id": "14681208", "url": "https://glygen.org/publication/PubMed/14681208" } ] }, { "title": "Dynamics of human immunodeficiency virus transcription: P-TEFb phosphorylates RD and dissociates negative effectors from the transactivation response element.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Fujinaga K, Irwin D, Huang Y, Taube R, Kurosu T, Peterlin BM", "evidence": [ { "database": "Reactome", "id": "R-HSA-167200", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-167200" } ], "reference": [ { "type": "PubMed", "id": "14701750", "url": "https://glygen.org/publication/PubMed/14701750" } ] }, { "title": "Role of the C-terminal domain of RNA polymerase II in U2 snRNA transcription and 3' processing.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Jacobs EY, Ogiwara I, Weiner AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "14701755", "url": "https://glygen.org/publication/PubMed/14701755" } ] }, { "title": "Prp5 bridges U1 and U2 snRNPs and enables stable U2 snRNP association with intron RNA.", "journal": "The EMBO journal", "date": "2004", "authors": "Xu YZ, Newnham CM, Kameoka S, Huang T, Konarska MM, Query CC", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "14713954", "url": "https://glygen.org/publication/PubMed/14713954" } ] }, { "title": "Exportin 5 is a RanGTP-dependent dsRNA-binding protein that mediates nuclear export of pre-miRNAs.", "journal": "RNA (New York, N.Y.)", "date": "2004", "authors": "Bohnsack MT, Czaplinski K, Gorlich D", "evidence": [ { "database": "Reactome", "id": "R-HSA-203927", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203927" } ], "reference": [ { "type": "PubMed", "id": "14730017", "url": "https://glygen.org/publication/PubMed/14730017" } ] }, { "title": "Genome-wide identification of high-affinity estrogen response elements in human and mouse.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2004", "authors": "Bourdeau V, Deschenes J, Metivier R, Nagai Y, Nguyen D, Bretschneider N, Gannon F, White JH, Mader S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15001666", "url": "https://glygen.org/publication/PubMed/15001666" } ] }, { "title": "Cellular control of gene expression by T-type cyclin/CDK9 complexes.", "journal": "Gene", "date": "2004", "authors": "Garriga J, Grana X", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15276198", "url": "https://glygen.org/publication/PubMed/15276198" } ] }, { "title": "Estrogens and progesterone promote persistent CCND1 gene activation during G1 by inducing transcriptional derepression via c-Jun/c-Fos/estrogen receptor (progesterone receptor) complex assembly to a distal regulatory element and recruitment of cyclin D1 to its own gene promoter.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Cicatiello L, Addeo R, Sasso A, Altucci L, Petrizzi VB, Borgo R, Cancemi M, Caporali S, Caristi S, Scafoglio C, Teti D, Bresciani F, Perillo B, Weisz A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15282324", "url": "https://glygen.org/publication/PubMed/15282324" } ] }, { "title": "Argonaute2 is the catalytic engine of mammalian RNAi.", "journal": "Science (New York, N.Y.)", "date": "2004", "authors": "Liu J, Carmell MA, Rivas FV, Marsden CG, Thomson JM, Song JJ, Hammond SM, Joshua-Tor L, Hannon GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-203927", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203927" } ], "reference": [ { "type": "PubMed", "id": "15284456", "url": "https://glygen.org/publication/PubMed/15284456" } ] }, { "title": "Nucleocytoplasmic transport: the influenza virus NS1 protein regulates the transport of spliced NS2 mRNA and its precursor NS1 mRNA.", "journal": "Genes & development", "date": "1992", "authors": "Alonso-Caplen FV, Nemeroff ME, Qiu Y, Krug RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-168325", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168325" } ], "reference": [ { "type": "PubMed", "id": "1531330", "url": "https://glygen.org/publication/PubMed/1531330" } ] }, { "title": "Transcriptional complexes engaged by apo-estrogen receptor-alpha isoforms have divergent outcomes.", "journal": "The EMBO journal", "date": "2004", "authors": "Metivier R, Penot G, Carmouche RP, Hubner MR, Reid G, Denger S, Manu D, Brand H, Kos M, Benes V, Gannon F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15343269", "url": "https://glygen.org/publication/PubMed/15343269" } ] }, { "title": "Discovery of estrogen receptor alpha target genes and response elements in breast tumor cells.", "journal": "Genome biology", "date": "2004", "authors": "Lin CY, Strom A, Vega VB, Kong SL, Yeo AL, Thomsen JS, Chan WC, Doray B, Bangarusamy DK, Ramasamy A, Vergara LA, Tang S, Chong A, Bajic VB, Miller LD, Gustafsson JA, Liu ET", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15345050", "url": "https://glygen.org/publication/PubMed/15345050" } ] }, { "title": "Oct-1 and Oct-2 potentiate functional interactions of a transcription factor with the proximal sequence element of small nuclear RNA genes.", "journal": "Molecular and cellular biology", "date": "1992", "authors": "Murphy S, Yoon JB, Gerster T, Roeder RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "1535687", "url": "https://glygen.org/publication/PubMed/1535687" } ] }, { "title": "Identification of mammalian microRNA host genes and transcription units.", "journal": "Genome research", "date": "2004", "authors": "Rodriguez A, Griffiths-Jones S, Ashurst JL, Bradley A", "evidence": [ { "database": "Reactome", "id": "R-HSA-203927", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203927" } ], "reference": [ { "type": "PubMed", "id": "15364901", "url": "https://glygen.org/publication/PubMed/15364901" } ] }, { "title": "MicroRNA genes are transcribed by RNA polymerase II.", "journal": "The EMBO journal", "date": "2004", "authors": "Lee Y, Kim M, Han J, Yeom KH, Lee S, Baek SH, Kim VN", "evidence": [ { "database": "Reactome", "id": "R-HSA-203927", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203927" } ], "reference": [ { "type": "PubMed", "id": "15372072", "url": "https://glygen.org/publication/PubMed/15372072" } ] }, { "title": "Elongation by RNA polymerase II: the short and long of it.", "journal": "Genes & development", "date": "2004", "authors": "Sims RJ 3rd, Belotserkovskaya R, Reinberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-674695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-674695" } ], "reference": [ { "type": "PubMed", "id": "15489290", "url": "https://glygen.org/publication/PubMed/15489290" } ] }, { "title": "Global gene expression analysis of estrogen receptor transcription factor cross talk in breast cancer: identification of estrogen-induced/activator protein-1-dependent genes.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2005", "authors": "DeNardo DG, Kim HT, Hilsenbeck S, Cuba V, Tsimelzon A, Brown PH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15514030", "url": "https://glygen.org/publication/PubMed/15514030" } ] }, { "title": "Human microRNAs are processed from capped, polyadenylated transcripts that can also function as mRNAs.", "journal": "RNA (New York, N.Y.)", "date": "2004", "authors": "Cai X, Hagedorn CH, Cullen BR", "evidence": [ { "database": "Reactome", "id": "R-HSA-203927", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203927" } ], "reference": [ { "type": "PubMed", "id": "15525708", "url": "https://glygen.org/publication/PubMed/15525708" } ] }, { "title": "The Microprocessor complex mediates the genesis of microRNAs.", "journal": "Nature", "date": "2004", "authors": "Gregory RI, Yan KP, Amuthan G, Chendrimada T, Doratotaj B, Cooch N, Shiekhattar R", "evidence": [ { "database": "Reactome", "id": "R-HSA-203927", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203927" } ], "reference": [ { "type": "PubMed", "id": "15531877", "url": "https://glygen.org/publication/PubMed/15531877" } ] }, { "title": "The Drosha-DGCR8 complex in primary microRNA processing.", "journal": "Genes & development", "date": "2004", "authors": "Han J, Lee Y, Yeom KH, Kim YK, Jin H, Kim VN", "evidence": [ { "database": "Reactome", "id": "R-HSA-203927", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203927" } ], "reference": [ { "type": "PubMed", "id": "15574589", "url": "https://glygen.org/publication/PubMed/15574589" } ] }, { "title": "The spacer region of XPG mediates recruitment to nucleotide excision repair complexes and determines substrate specificity.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Dunand-Sauthier I, Hohl M, Thorel F, Jaquier-Gubler P, Clarkson SG, Scharer OD", "evidence": [ { "database": "Reactome", "id": "R-HSA-6782135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6782135" } ], "reference": [ { "type": "PubMed", "id": "15590680", "url": "https://glygen.org/publication/PubMed/15590680" } ] }, { "title": "A novel intronic cis element, ISE/ISS-3, regulates rat fibroblast growth factor receptor 2 splicing through activation of an upstream exon and repression of a downstream exon containing a noncanonical branch point sequence.", "journal": "Molecular and cellular biology", "date": "2005", "authors": "Hovhannisyan RH, Carstens RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803529", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803529" } ], "reference": [ { "type": "PubMed", "id": "15601847", "url": "https://glygen.org/publication/PubMed/15601847" } ] }, { "title": "Specific and potent RNAi in the nucleus of human cells.", "journal": "Nature structural & molecular biology", "date": "2005", "authors": "Robb GB, Brown KM, Khurana J, Rana TM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "15643423", "url": "https://glygen.org/publication/PubMed/15643423" } ] }, { "title": "Identification of the mismatch repair genes PMS2 and MLH1 as p53 target genes by using serial analysis of binding elements.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Chen J, Sadowski I", "evidence": [ { "database": "Reactome", "id": "R-HSA-6796648", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6796648" } ], "reference": [ { "type": "PubMed", "id": "15781865", "url": "https://glygen.org/publication/PubMed/15781865" } ] }, { "title": "Expression of HOXB2, a retinoic acid signaling target in pancreatic cancer and pancreatic intraepithelial neoplasia.", "journal": "Clinical cancer research : an official journal of the American Association for Cancer Research", "date": "2005", "authors": "Segara D, Biankin AV, Kench JG, Langusch CC, Dawson AC, Skalicky DA, Gotley DC, Coleman MJ, Sutherland RL, Henshall SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "15867264", "url": "https://glygen.org/publication/PubMed/15867264" } ] }, { "title": "TRBP recruits the Dicer complex to Ago2 for microRNA processing and gene silencing.", "journal": "Nature", "date": "2005", "authors": "Chendrimada TP, Gregory RI, Kumaraswamy E, Norman J, Cooch N, Nishikura K, Shiekhattar R", "evidence": [ { "database": "Reactome", "id": "R-HSA-203927", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203927" } ], "reference": [ { "type": "PubMed", "id": "15973356", "url": "https://glygen.org/publication/PubMed/15973356" } ] }, { "title": "GREB 1 is a critical regulator of hormone dependent breast cancer growth.", "journal": "Breast cancer research and treatment", "date": "2005", "authors": "Rae JM, Johnson MD, Scheys JO, Cordero KE, Larios JM, Lippman ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "15986123", "url": "https://glygen.org/publication/PubMed/15986123" } ] }, { "title": "Cotranscriptional spliceosome assembly occurs in a stepwise fashion and requires the cap binding complex.", "journal": "Molecular cell", "date": "2005", "authors": "Gornemann J, Kotovic KM, Hujer K, Neugebauer KM", "evidence": [ { "database": "Reactome", "id": "R-HSA-72086", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72086" } ], "reference": [ { "type": "PubMed", "id": "15989964", "url": "https://glygen.org/publication/PubMed/15989964" } ] }, { "title": "Chromosome-wide mapping of estrogen receptor binding reveals long-range regulation requiring the forkhead protein FoxA1.", "journal": "Cell", "date": "2005", "authors": "Carroll JS, Liu XS, Brodsky AS, Li W, Meyer CA, Szary AJ, Eeckhoute J, Shao W, Hestermann EV, Geistlinger TR, Fox EA, Silver PA, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "16009131", "url": "https://glygen.org/publication/PubMed/16009131" } ] }, { "title": "Cathepsin D: newly discovered functions of a long-standing aspartic protease in cancer and apoptosis.", "journal": "Cancer letters", "date": "2006", "authors": "Liaudet-Coopman E, Beaujouin M, Derocq D, Garcia M, Glondu-Lassis M, Laurent-Matha V, Prebois C, Rochefort H, Vignon F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "16046058", "url": "https://glygen.org/publication/PubMed/16046058" } ] }, { "title": "HoxB2 binds mutant SOD1 and is altered in transgenic model of ALS.", "journal": "Human molecular genetics", "date": "2005", "authors": "Zhai J, Lin H, Canete-Soler R, Schlaepfer WW", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "16079151", "url": "https://glygen.org/publication/PubMed/16079151" } ] }, { "title": "From the Cover: Location analysis of estrogen receptor alpha target promoters reveals that FOXA1 defines a domain of the estrogen response.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Laganiere J, Deblois G, Lefebvre C, Bataille AR, Robert F, Giguere V", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "16087863", "url": "https://glygen.org/publication/PubMed/16087863" } ] }, { "title": "Downstream targets of growth factor and oestrogen signalling and endocrine resistance: the potential roles of c-Myc, cyclin D1 and cyclin E.", "journal": "Endocrine-related cancer", "date": "2005", "authors": "Butt AJ, McNeil CM, Musgrove EA, Sutherland RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "16113099", "url": "https://glygen.org/publication/PubMed/16113099" } ] }, { "title": "TRBP, a regulator of cellular PKR and HIV-1 virus expression, interacts with Dicer and functions in RNA silencing.", "journal": "EMBO reports", "date": "2005", "authors": "Haase AD, Jaskiewicz L, Zhang H, Laine S, Sack R, Gatignol A, Filipowicz W", "evidence": [ { "database": "Reactome", "id": "R-HSA-203927", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203927" } ], "reference": [ { "type": "PubMed", "id": "16142218", "url": "https://glygen.org/publication/PubMed/16142218" } ] }, { "title": "Integrator, a multiprotein mediator of small nuclear RNA processing, associates with the C-terminal repeat of RNA polymerase II.", "journal": "Cell", "date": "2005", "authors": "Baillat D, Hakimi MA, Naar AM, Shilatifard A, Cooch N, Shiekhattar R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "16239144", "url": "https://glygen.org/publication/PubMed/16239144" } ] }, { "title": "Recognition of RNA polymerase II and transcription bubbles by XPG, CSB, and TFIIH: insights for transcription-coupled repair and Cockayne Syndrome.", "journal": "Molecular cell", "date": "2005", "authors": "Sarker AH, Tsutakawa SE, Kostek S, Ng C, Shin DS, Peris M, Campeau E, Tainer JA, Nogales E, Cooper PK", "evidence": [ { "database": "Reactome", "id": "R-HSA-6782135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6782135" } ], "reference": [ { "type": "PubMed", "id": "16246722", "url": "https://glygen.org/publication/PubMed/16246722" } ] }, { "title": "Passenger-strand cleavage facilitates assembly of siRNA into Ago2-containing RNAi enzyme complexes.", "journal": "Cell", "date": "2005", "authors": "Matranga C, Tomari Y, Shin C, Bartel DP, Zamore PD", "evidence": [ { "database": "Reactome", "id": "R-HSA-203927", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203927" } ], "reference": [ { "type": "PubMed", "id": "16271386", "url": "https://glygen.org/publication/PubMed/16271386" } ] }, { "title": "Crystal structure and RNA binding of the Rpb4/Rpb7 subunits of human RNA polymerase II.", "journal": "Nucleic Acids Res.", "date": "2005", "authors": "Meka H, Werner F, Cordell SC, Onesti S, Brick P", "evidence": [ { "database": "UniProtKB", "id": "O15514", "url": "https://www.uniprot.org/uniprot/O15514" }, { "database": "RefSeq", "id": "NP_004796", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004796" } ], "reference": [ { "type": "PubMed", "id": "16282592", "url": "https://glygen.org/publication/PubMed/16282592" } ] }, { "title": "Mechanism of estrogen activation of c-myc oncogene expression.", "journal": "Oncogene", "date": "1992", "authors": "Dubik D, Shiu RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "1630819", "url": "https://glygen.org/publication/PubMed/1630819" } ] }, { "title": "P-TEFb is not an essential elongation factor for the intronless human U2 snRNA and histone H2b genes.", "journal": "The EMBO journal", "date": "2005", "authors": "Medlin J, Scurry A, Taylor A, Zhang F, Peterlin BM, Murphy S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "16308568", "url": "https://glygen.org/publication/PubMed/16308568" } ] }, { "title": "Biochemical analysis of the EJC reveals two new factors and a stable tetrameric protein core.", "journal": "RNA (New York, N.Y.)", "date": "2005", "authors": "Tange TO, Shibuya T, Jurica MS, Moore MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "16314458", "url": "https://glygen.org/publication/PubMed/16314458" } ] }, { "title": "A human, ATP-independent, RISC assembly machine fueled by pre-miRNA.", "journal": "Genes & development", "date": "2005", "authors": "Maniataki E, Mourelatos Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-203927", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203927" } ], "reference": [ { "type": "PubMed", "id": "16357216", "url": "https://glygen.org/publication/PubMed/16357216" } ] }, { "title": "The antisense strand of small interfering RNAs directs histone methylation and transcriptional gene silencing in human cells.", "journal": "RNA (New York, N.Y.)", "date": "2006", "authors": "Weinberg MS, Villeneuve LM, Ehsani A, Amarzguioui M, Aagaard L, Chen ZX, Riggs AD, Rossi JJ, Morris KV", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "16373483", "url": "https://glygen.org/publication/PubMed/16373483" } ] }, { "title": "Characterization of sequences and mechanisms through which ISE/ISS-3 regulates FGFR2 splicing.", "journal": "Nucleic acids research", "date": "2006", "authors": "Hovhannisyan RH, Warzecha CC, Carstens RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803529", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803529" } ], "reference": [ { "type": "PubMed", "id": "16410617", "url": "https://glygen.org/publication/PubMed/16410617" } ] }, { "title": "The role of PACT in the RNA silencing pathway.", "journal": "The EMBO journal", "date": "2006", "authors": "Lee Y, Hur I, Park SY, Kim YK, Suh MR, Kim VN", "evidence": [ { "database": "Reactome", "id": "R-HSA-203927", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203927" } ], "reference": [ { "type": "PubMed", "id": "16424907", "url": "https://glygen.org/publication/PubMed/16424907" } ] }, { "title": "Fox-2 mediates epithelial cell-specific fibroblast growth factor receptor 2 exon choice.", "journal": "Molecular and cellular biology", "date": "2006", "authors": "Baraniak AP, Chen JR, Garcia-Blanco MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803529", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803529" } ], "reference": [ { "type": "PubMed", "id": "16449636", "url": "https://glygen.org/publication/PubMed/16449636" } ] }, { "title": "MicroRNA fingerprints during human megakaryocytopoiesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Garzon R, Pichiorri F, Palumbo T, Iuliano R, Cimmino A, Aqeilan R, Volinia S, Bhatt D, Alder H, Marcucci G, Calin GA, Liu CG, Bloomfield CD, Andreeff M, Croce CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "16549775", "url": "https://glygen.org/publication/PubMed/16549775" } ] }, { "title": "Identification of RNA-binding proteins that regulate FGFR2 splicing through the use of sensitive and specific dual color fluorescence minigene assays.", "journal": "RNA (New York, N.Y.)", "date": "2006", "authors": "Newman EA, Muh SJ, Hovhannisyan RH, Warzecha CC, Jones RB, McKeehan WL, Carstens RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803529", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803529" } ], "reference": [ { "type": "PubMed", "id": "16603716", "url": "https://glygen.org/publication/PubMed/16603716" } ] }, { "title": "CSA-dependent degradation of CSB by the ubiquitin-proteasome pathway establishes a link between complementation factors of the Cockayne syndrome.", "journal": "Genes & development", "date": "2006", "authors": "Groisman R, Kuraoka I, Chevallier O, Gaye N, Magnaldo T, Tanaka K, Kisselev AF, Harel-Bellan A, Nakatani Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-6781823", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6781823" } ], "reference": [ { "type": "PubMed", "id": "16751180", "url": "https://glygen.org/publication/PubMed/16751180" } ] }, { "title": "Protein composition and electron microscopy structure of affinity-purified human spliceosomal B complexes isolated under physiological conditions.", "journal": "Molecular and cellular biology", "date": "2006", "authors": "Deckert J, Hartmuth K, Boehringer D, Behzadnia N, Will CL, Kastner B, Stark H, Urlaub H, Luhrmann R", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "16809785", "url": "https://glygen.org/publication/PubMed/16809785" } ] }, { "title": "The unorthodox SNAP50 zinc finger domain contributes to cooperative promoter recognition by human SNAPC.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Jawdekar GW, Hanzlowsky A, Hovde SL, Jelencic B, Feig M, Geiger JH, Henry RW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "16901896", "url": "https://glygen.org/publication/PubMed/16901896" } ] }, { "title": "Cockayne syndrome A and B proteins differentially regulate recruitment of chromatin remodeling and repair factors to stalled RNA polymerase II in vivo.", "journal": "Molecular cell", "date": "2006", "authors": "Fousteri M, Vermeulen W, van Zeeland AA, Mullenders LH", "evidence": [ { "database": "Reactome", "id": "R-HSA-6781823", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6781823" } ], "reference": [ { "type": "PubMed", "id": "16916636", "url": "https://glygen.org/publication/PubMed/16916636" } ] }, { "title": "Functional association between viral and cellular transcription during influenza virus infection.", "journal": "Reviews in medical virology", "date": "2006", "authors": "Engelhardt OG, Fodor E", "evidence": [ { "database": "Reactome", "id": "R-HSA-168325", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168325" } ], "reference": [ { "type": "PubMed", "id": "16933365", "url": "https://glygen.org/publication/PubMed/16933365" } ] }, { "title": "Argonaute-1 directs siRNA-mediated transcriptional gene silencing in human cells.", "journal": "Nature structural & molecular biology", "date": "2006", "authors": "Kim DH, Villeneuve LM, Morris KV, Rossi JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "16936726", "url": "https://glygen.org/publication/PubMed/16936726" } ] }, { "title": "A cell-type-specific transcriptional network required for estrogen regulation of cyclin D1 and cell cycle progression in breast cancer.", "journal": "Genes & development", "date": "2006", "authors": "Eeckhoute J, Carroll JS, Geistlinger TR, Torres-Arzayus MI, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "16980581", "url": "https://glygen.org/publication/PubMed/16980581" } ] }, { "title": "Recruitment of the nucleotide excision repair endonuclease XPG to sites of UV-induced dna damage depends on functional TFIIH.", "journal": "Molecular and cellular biology", "date": "2006", "authors": "Zotter A, Luijsterburg MS, Warmerdam DO, Ibrahim S, Nigg A, van Cappellen WA, Hoeijmakers JH, van Driel R, Vermeulen W, Houtsmuller AB", "evidence": [ { "database": "Reactome", "id": "R-HSA-6782135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6782135" } ], "reference": [ { "type": "PubMed", "id": "17000769", "url": "https://glygen.org/publication/PubMed/17000769" } ] }, { "title": "Genome-wide analysis of estrogen receptor binding sites.", "journal": "Nature genetics", "date": "2006", "authors": "Carroll JS, Meyer CA, Song J, Li W, Geistlinger TR, Eeckhoute J, Brodsky AS, Keeton EK, Fertuck KC, Hall GF, Wang Q, Bekiranov S, Sementchenko V, Fox EA, Silver PA, Gingeras TR, Liu XS, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17013392", "url": "https://glygen.org/publication/PubMed/17013392" } ] }, { "title": "Intronic microRNA (miRNA).", "journal": "Journal of biomedicine & biotechnology", "date": "2006", "authors": "Lin SL, Miller JD, Ying SY", "evidence": [ { "database": "Reactome", "id": "R-HSA-203927", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203927" } ], "reference": [ { "type": "PubMed", "id": "17057362", "url": "https://glygen.org/publication/PubMed/17057362" } ] }, { "title": "Small dsRNAs induce transcriptional activation in human cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Li LC, Okino ST, Zhao H, Pookot D, Place RF, Urakami S, Enokida H, Dahiya R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "17085592", "url": "https://glygen.org/publication/PubMed/17085592" } ] }, { "title": "Protein composition of human mRNPs spliced in vitro and differential requirements for mRNP protein recruitment.", "journal": "RNA (New York, N.Y.)", "date": "2007", "authors": "Merz C, Urlaub H, Will CL, Luhrmann R", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "17095540", "url": "https://glygen.org/publication/PubMed/17095540" } ] }, { "title": "RNA polymerase III transcribes human microRNAs.", "journal": "Nature structural & molecular biology", "date": "2006", "authors": "Borchert GM, Lanier W, Davidson BL", "evidence": [ { "database": "Reactome", "id": "R-HSA-203927", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203927" } ], "reference": [ { "type": "PubMed", "id": "17099701", "url": "https://glygen.org/publication/PubMed/17099701" } ] }, { "title": "Nuclear export of influenza A virus mRNAs requires ongoing RNA polymerase II activity.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2007", "authors": "Amorim MJ, Read EK, Dalton RM, Medcalf L, Digard P", "evidence": [ { "database": "Reactome", "id": "R-HSA-168325", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168325" } ], "reference": [ { "type": "PubMed", "id": "17132145", "url": "https://glygen.org/publication/PubMed/17132145" } ] }, { "title": "Noncoding RNA synthesis and loss of Polycomb group repression accompanies the colinear activation of the human HOXA cluster.", "journal": "RNA (New York, N.Y.)", "date": "2007", "authors": "Sessa L, Breiling A, Lavorgna G, Silvestri L, Casari G, Orlando V", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "17185360", "url": "https://glygen.org/publication/PubMed/17185360" } ] }, { "title": "The Spt6 SH2 domain binds Ser2-P RNAPII to direct Iws1-dependent mRNA splicing and export.", "journal": "Genes & development", "date": "2007", "authors": "Yoh SM, Cho H, Pickle L, Evans RM, Jones KA", "evidence": [ { "database": "Reactome", "id": "R-HSA-112382", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-112382" } ], "reference": [ { "type": "PubMed", "id": "17234882", "url": "https://glygen.org/publication/PubMed/17234882" } ] }, { "title": "Cooperative demethylation by JMJD2C and LSD1 promotes androgen receptor-dependent gene expression.", "journal": "Nature cell biology", "date": "2007", "authors": "Wissmann M, Yin N, Muller JM, Greschik H, Fodor BD, Jenuwein T, Vogler C, Schneider R, Gunther T, Buettner R, Metzger E, Schule R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17277772", "url": "https://glygen.org/publication/PubMed/17277772" } ] }, { "title": "CPD damage recognition by transcribing RNA polymerase II.", "journal": "Science (New York, N.Y.)", "date": "2007", "authors": "Brueckner F, Hennecke U, Carell T, Cramer P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6781823", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6781823" } ], "reference": [ { "type": "PubMed", "id": "17290000", "url": "https://glygen.org/publication/PubMed/17290000" } ] }, { "title": "Composition and three-dimensional EM structure of double affinity-purified, human prespliceosomal A complexes.", "journal": "The EMBO journal", "date": "2007", "authors": "Behzadnia N, Golas MM, Hartmuth K, Sander B, Kastner B, Deckert J, Dube P, Will CL, Urlaub H, Stark H, Luhrmann R", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "17332742", "url": "https://glygen.org/publication/PubMed/17332742" } ] }, { "title": "Promoter-selective activation domains in Oct-1 and Oct-2 direct differential activation of an snRNA and mRNA promoter.", "journal": "Cell", "date": "1992", "authors": "Tanaka M, Lai JS, Herr W", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "1739980", "url": "https://glygen.org/publication/PubMed/1739980" } ] }, { "title": "Overlapping roles of the methylated DNA-binding protein MBD1 and polycomb group proteins in transcriptional repression of HOXA genes and heterochromatin foci formation.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Sakamoto Y, Watanabe S, Ichimura T, Kawasuji M, Koseki H, Baba H, Nakao M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "17428788", "url": "https://glygen.org/publication/PubMed/17428788" } ] }, { "title": "Human TRBP and PACT directly interact with each other and associate with dicer to facilitate the production of small interfering RNA.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Kok KH, Ng MH, Ching YP, Jin DY", "evidence": [ { "database": "Reactome", "id": "R-HSA-203927", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203927" } ], "reference": [ { "type": "PubMed", "id": "17452327", "url": "https://glygen.org/publication/PubMed/17452327" } ] }, { "title": "Regulation of GREB1 transcription by estrogen receptor alpha through a multipartite enhancer spread over 20 kb of upstream flanking sequences.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Deschenes J, Bourdeau V, White JH, Mader S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17463000", "url": "https://glygen.org/publication/PubMed/17463000" } ] }, { "title": "XPG stabilizes TFIIH, allowing transactivation of nuclear receptors: implications for Cockayne syndrome in XP-G/CS patients.", "journal": "Molecular cell", "date": "2007", "authors": "Ito S, Kuraoka I, Chymkowitch P, Compe E, Takedachi A, Ishigami C, Coin F, Egly JM, Tanaka K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6782135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6782135" } ], "reference": [ { "type": "PubMed", "id": "17466625", "url": "https://glygen.org/publication/PubMed/17466625" } ] }, { "title": "Distinct roles for the XPB/p52 and XPD/p44 subcomplexes of TFIIH in damaged DNA opening during nucleotide excision repair.", "journal": "Molecular cell", "date": "2007", "authors": "Coin F, Oksenych V, Egly JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6782135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6782135" } ], "reference": [ { "type": "PubMed", "id": "17466626", "url": "https://glygen.org/publication/PubMed/17466626" } ] }, { "title": "The DEAD-box p68/p72 proteins and the noncoding RNA steroid receptor activator SRA: eclectic regulators of disparate biological functions.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2007", "authors": "Caretti G, Lei EP, Sartorelli V", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17495528", "url": "https://glygen.org/publication/PubMed/17495528" } ] }, { "title": "NELF interacts with CBC and participates in 3' end processing of replication-dependent histone mRNAs.", "journal": "Molecular cell", "date": "2007", "authors": "Narita T, Yung TM, Yamamoto J, Tsuboi Y, Tanabe H, Tanaka K, Yamaguchi Y, Handa H", "evidence": [ { "database": "Reactome", "id": "R-HSA-72086", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72086" } ], "reference": [ { "type": "PubMed", "id": "17499042", "url": "https://glygen.org/publication/PubMed/17499042" } ] }, { "title": "Novel estrogen receptor-alpha binding sites and estradiol target genes identified by chromatin immunoprecipitation cloning in breast cancer.", "journal": "Cancer research", "date": "2007", "authors": "Lin Z, Reierstad S, Huang CC, Bulun SE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17510434", "url": "https://glygen.org/publication/PubMed/17510434" } ] }, { "title": "RNA helicase A interacts with RISC in human cells and functions in RISC loading.", "journal": "Molecular cell", "date": "2007", "authors": "Robb GB, Rana TM", "evidence": [ { "database": "Reactome", "id": "R-HSA-203927", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203927" } ], "reference": [ { "type": "PubMed", "id": "17531811", "url": "https://glygen.org/publication/PubMed/17531811" } ] }, { "title": "HOX4 genes encode transcription factors with potential auto- and cross-regulatory capacities.", "journal": "The EMBO journal", "date": "1991", "authors": "Zappavigna V, Renucci A, Izpisua-Belmonte JC, Urier G, Peschle C, Duboule D", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "1756725", "url": "https://glygen.org/publication/PubMed/1756725" } ] }, { "title": "Splicing remodels messenger ribonucleoprotein architecture via eIF4A3-dependent and -independent recruitment of exon junction complex components.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Zhang Z, Krainer AR", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "17606899", "url": "https://glygen.org/publication/PubMed/17606899" } ] }, { "title": "The AP-1 transcription factor regulates breast cancer cell growth via cyclins and E2F factors.", "journal": "Oncogene", "date": "2008", "authors": "Shen Q, Uray IP, Li Y, Krisko TI, Strecker TE, Kim HT, Brown PH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17637753", "url": "https://glygen.org/publication/PubMed/17637753" } ] }, { "title": "Sealing of chromosomal DNA nicks during nucleotide excision repair requires XRCC1 and DNA ligase III alpha in a cell-cycle-specific manner.", "journal": "Molecular cell", "date": "2007", "authors": "Moser J, Kool H, Giakzidis I, Caldecott K, Mullenders LH, Fousteri MI", "evidence": [ { "database": "Reactome", "id": "R-HSA-6782210", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6782210" } ], "reference": [ { "type": "PubMed", "id": "17643379", "url": "https://glygen.org/publication/PubMed/17643379" } ] }, { "title": "DNA methylation regulates MicroRNA expression.", "journal": "Cancer biology & therapy", "date": "2007", "authors": "Han L, Witmer PD, Casey E, Valle D, Sukumar S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "17660710", "url": "https://glygen.org/publication/PubMed/17660710" } ] }, { "title": "Long-range activation of GREB1 by estrogen receptor via three distal consensus estrogen-responsive elements in breast cancer cells.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2007", "authors": "Sun J, Nawaz Z, Slingerland JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17666587", "url": "https://glygen.org/publication/PubMed/17666587" } ] }, { "title": "Mechanism of and requirement for estrogen-regulated MYB expression in estrogen-receptor-positive breast cancer cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Drabsch Y, Hugo H, Zhang R, Dowhan DH, Miao YR, Gewirtz AM, Barry SC, Ramsay RG, Gonda TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "17690249", "url": "https://glygen.org/publication/PubMed/17690249" } ] }, { "title": "UTX and JMJD3 are histone H3K27 demethylases involved in HOX gene regulation and development.", "journal": "Nature", "date": "2007", "authors": "Agger K, Cloos PA, Christensen J, Pasini D, Rose S, Rappsilber J, Issaeva I, Canaani E, Salcini AE, Helin K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "17713478", "url": "https://glygen.org/publication/PubMed/17713478" } ] }, { "title": "Demethylation of H3K27 regulates polycomb recruitment and H2A ubiquitination.", "journal": "Science (New York, N.Y.)", "date": "2007", "authors": "Lee MG, Villa R, Trojer P, Norman J, Yan KP, Reinberg D, Di Croce L, Shiekhattar R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "17761849", "url": "https://glygen.org/publication/PubMed/17761849" } ] }, { "title": "A histone H3 lysine 27 demethylase regulates animal posterior development.", "journal": "Nature", "date": "2007", "authors": "Lan F, Bayliss PE, Rinn JL, Whetstine JR, Wang JK, Chen S, Iwase S, Alpatov R, Issaeva I, Canaani E, Roberts TM, Chang HY, Shi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "17851529", "url": "https://glygen.org/publication/PubMed/17851529" } ] }, { "title": "Proteomic and functional analysis of Argonaute-containing mRNA-protein complexes in human cells.", "journal": "EMBO reports", "date": "2007", "authors": "Hock J, Weinmann L, Ender C, Rudel S, Kremmer E, Raabe M, Urlaub H, Meister G", "evidence": [ { "database": "Reactome", "id": "R-HSA-203927", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203927" } ], "reference": [ { "type": "PubMed", "id": "17932509", "url": "https://glygen.org/publication/PubMed/17932509" } ] }, { "title": "Protein-free spliceosomal snRNAs catalyze a reaction that resembles the first step of splicing.", "journal": "RNA (New York, N.Y.)", "date": "2007", "authors": "Valadkhan S, Mohammadi A, Wachtel C, Manley JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-72165", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72165" } ], "reference": [ { "type": "PubMed", "id": "17940139", "url": "https://glygen.org/publication/PubMed/17940139" } ] }, { "title": "Structural basis for the recruitment of ERCC1-XPF to nucleotide excision repair complexes by XPA.", "journal": "The EMBO journal", "date": "2007", "authors": "Tsodikov OV, Ivanov D, Orelli B, Staresincic L, Shoshani I, Oberman R, Scharer OD, Wagner G, Ellenberger T", "evidence": [ { "database": "Reactome", "id": "R-HSA-6782135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6782135" } ], "reference": [ { "type": "PubMed", "id": "17948053", "url": "https://glygen.org/publication/PubMed/17948053" } ] }, { "title": "Heterogeneous ribonucleoprotein m is a splicing regulatory protein that can enhance or silence splicing of alternatively spliced exons.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Hovhannisyan RH, Carstens RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803529", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803529" } ], "reference": [ { "type": "PubMed", "id": "17959601", "url": "https://glygen.org/publication/PubMed/17959601" } ] }, { "title": "Isolation of XAB2 complex involved in pre-mRNA splicing, transcription, and transcription-coupled repair.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Kuraoka I, Ito S, Wada T, Hayashida M, Lee L, Saijo M, Nakatsu Y, Matsumoto M, Matsunaga T, Handa H, Qin J, Nakatani Y, Tanaka K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6781823", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6781823" } ], "reference": [ { "type": "PubMed", "id": "17981804", "url": "https://glygen.org/publication/PubMed/17981804" } ] }, { "title": "Serine-7 of the RNA polymerase II CTD is specifically required for snRNA gene expression.", "journal": "Science (New York, N.Y.)", "date": "2007", "authors": "Egloff S, O'Reilly D, Chapman RD, Taylor A, Tanzhaus K, Pitts L, Eick D, Murphy S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "18079403", "url": "https://glygen.org/publication/PubMed/18079403" } ] }, { "title": "Sequential recruitment of the repair factors during NER: the role of XPG in initiating the resynthesis step.", "journal": "The EMBO journal", "date": "2008", "authors": "Mocquet V, Laine JP, Riedl T, Yajin Z, Lee MY, Egly JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6782135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6782135" } ], "reference": [ { "type": "PubMed", "id": "18079701", "url": "https://glygen.org/publication/PubMed/18079701" } ] }, { "title": "RNA polymerase II pauses and associates with pre-mRNA processing factors at both ends of genes.", "journal": "Nature structural & molecular biology", "date": "2008", "authors": "Glover-Cutter K, Kim S, Espinosa J, Bentley DL", "evidence": [ { "database": "Reactome", "id": "R-HSA-72086", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72086" } ], "reference": [ { "type": "PubMed", "id": "18157150", "url": "https://glygen.org/publication/PubMed/18157150" } ] }, { "title": "In vitro reconstitution of the human RISC-loading complex.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "MacRae IJ, Ma E, Zhou M, Robinson CV, Doudna JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-203927", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203927" } ], "reference": [ { "type": "PubMed", "id": "18178619", "url": "https://glygen.org/publication/PubMed/18178619" } ] }, { "title": "DNA oxidation as triggered by H3K9me2 demethylation drives estrogen-induced gene expression.", "journal": "Science (New York, N.Y.)", "date": "2008", "authors": "Perillo B, Ombra MN, Bertoni A, Cuozzo C, Sacchetti S, Sasso A, Chiariotti L, Malorni A, Abbondanza C, Avvedimento EV", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18187655", "url": "https://glygen.org/publication/PubMed/18187655" } ] }, { "title": "Cohesins localize with CTCF at the KSHV latency control region and at cellular c-myc and H19/Igf2 insulators.", "journal": "The EMBO journal", "date": "2008", "authors": "Stedman W, Kang H, Lin S, Kissil JL, Bartolomei MS, Lieberman PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18219272", "url": "https://glygen.org/publication/PubMed/18219272" } ] }, { "title": "MicroRNA-373 induces expression of genes with complementary promoter sequences.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Place RF, Li LC, Pookot D, Noonan EJ, Dahiya R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "18227514", "url": "https://glygen.org/publication/PubMed/18227514" } ] }, { "title": "Genome-wide mapping and characterization of hypomethylated sites in human tissues and breast cancer cell lines.", "journal": "Genome research", "date": "2008", "authors": "Shann YJ, Cheng C, Chiao CH, Chen DT, Li PH, Hsu MT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18256232", "url": "https://glygen.org/publication/PubMed/18256232" } ] }, { "title": "Both Oct-1 and Oct-2A contain domains which can activate the ubiquitously expressed U2 snRNA genes.", "journal": "The EMBO journal", "date": "1991", "authors": "Yang J, Muller-Immergluck MM, Seipel K, Janson L, Westin G, Schaffner W, Pettersson U", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "1829677", "url": "https://glygen.org/publication/PubMed/1829677" } ] }, { "title": "Isolation of an active step I spliceosome and composition of its RNP core.", "journal": "Nature", "date": "2008", "authors": "Bessonov S, Anokhina M, Will CL, Urlaub H, Luhrmann R", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "18322460", "url": "https://glygen.org/publication/PubMed/18322460" } ] }, { "title": "Transient cyclical methylation of promoter DNA.", "journal": "Nature", "date": "2008", "authors": "Kangaspeska S, Stride B, Metivier R, Polycarpou-Schwarz M, Ibberson D, Carmouche RP, Benes V, Gannon F, Reid G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18322535", "url": "https://glygen.org/publication/PubMed/18322535" } ] }, { "title": "FoxA1 translates epigenetic signatures into enhancer-driven lineage-specific transcription.", "journal": "Cell", "date": "2008", "authors": "Lupien M, Eeckhoute J, Meyer CA, Wang Q, Zhang Y, Li W, Carroll JS, Liu XS, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18358809", "url": "https://glygen.org/publication/PubMed/18358809" } ] }, { "title": "Estrogen and MYB in breast cancer: potential for new therapies.", "journal": "Expert opinion on biological therapy", "date": "2008", "authors": "Gonda TJ, Leo P, Ramsay RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18476782", "url": "https://glygen.org/publication/PubMed/18476782" } ] }, { "title": "Meta-analysis of human cancer microarrays reveals GATA3 is integral to the estrogen receptor alpha pathway.", "journal": "Molecular cancer", "date": "2008", "authors": "Wilson BJ, Giguere V", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18533032", "url": "https://glygen.org/publication/PubMed/18533032" } ] }, { "title": "hnRNP H and hnRNP F complex with Fox2 to silence fibroblast growth factor receptor 2 exon IIIc.", "journal": "Molecular and cellular biology", "date": "2008", "authors": "Mauger DM, Lin C, Garcia-Blanco MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803529", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803529" } ], "reference": [ { "type": "PubMed", "id": "18573884", "url": "https://glygen.org/publication/PubMed/18573884" } ] }, { "title": "Distinct activities of the DExD/H-box splicing factor hUAP56 facilitate stepwise assembly of the spliceosome.", "journal": "Genes & development", "date": "2008", "authors": "Shen H, Zheng X, Shen J, Zhang L, Zhao R, Green MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "18593880", "url": "https://glygen.org/publication/PubMed/18593880" } ] }, { "title": "Nucleotide excision repair driven by the dissociation of CAK from TFIIH.", "journal": "Molecular cell", "date": "2008", "authors": "Coin F, Oksenych V, Mocquet V, Groh S, Blattner C, Egly JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6781823", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6781823" } ], "reference": [ { "type": "PubMed", "id": "18614043", "url": "https://glygen.org/publication/PubMed/18614043" } ] }, { "title": "Cleavage of the star strand facilitates assembly of some microRNAs into Ago2-containing silencing complexes in mammals.", "journal": "Molecules and cells", "date": "2008", "authors": "Shin C", "evidence": [ { "database": "Reactome", "id": "R-HSA-203927", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203927" } ], "reference": [ { "type": "PubMed", "id": "18728384", "url": "https://glygen.org/publication/PubMed/18728384" } ] }, { "title": "Cathepsin D: a cellular roadmap.", "journal": "Biochemical and biophysical research communications", "date": "2008", "authors": "Zaidi N, Maurer A, Nieke S, Kalbacher H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18762174", "url": "https://glygen.org/publication/PubMed/18762174" } ] }, { "title": "MicroRNAs in the Hox network: an apparent link to posterior prevalence.", "journal": "Nature reviews. Genetics", "date": "2008", "authors": "Yekta S, Tabin CJ, Bartel DP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "18781158", "url": "https://glygen.org/publication/PubMed/18781158" } ] }, { "title": "Effect of asymmetric terminal structures of short RNA duplexes on the RNA interference activity and strand selection.", "journal": "Nucleic acids research", "date": "2008", "authors": "Sano M, Sierant M, Miyagishi M, Nakanishi M, Takagi Y, Sutou S", "evidence": [ { "database": "Reactome", "id": "R-HSA-203927", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203927" } ], "reference": [ { "type": "PubMed", "id": "18782830", "url": "https://glygen.org/publication/PubMed/18782830" } ] }, { "title": "Marking time: the dynamic role of chromatin and covalent modification in transcription.", "journal": "The international journal of biochemistry & cell biology", "date": "2009", "authors": "Reid G, Gallais R, Metivier R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "18805503", "url": "https://glygen.org/publication/PubMed/18805503" } ] }, { "title": "Fluorescence correlation spectroscopy and fluorescence cross-correlation spectroscopy reveal the cytoplasmic origination of loaded nuclear RISC in vivo in human cells.", "journal": "Nucleic acids research", "date": "2008", "authors": "Ohrt T, Mutze J, Staroske W, Weinmann L, Hock J, Crell K, Meister G, Schwille P", "evidence": [ { "database": "Reactome", "id": "R-HSA-203927", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203927" } ], "reference": [ { "type": "PubMed", "id": "18842624", "url": "https://glygen.org/publication/PubMed/18842624" } ] }, { "title": "MicroRNA-directed transcriptional gene silencing in mammalian cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Kim DH, Saetrom P, Snove O Jr, Rossi JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "18852463", "url": "https://glygen.org/publication/PubMed/18852463" } ] }, { "title": "A piRNA pathway primed by individual transposons is linked to de novo DNA methylation in mice.", "journal": "Molecular cell", "date": "2008", "authors": "Aravin AA, Sachidanandam R, Bourc'his D, Schaefer C, Pezic D, Toth KF, Bestor T, Hannon GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5601884", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5601884" } ], "reference": [ { "type": "PubMed", "id": "18922463", "url": "https://glygen.org/publication/PubMed/18922463" } ] }, { "title": "Molecular characterization of human Argonaute-containing ribonucleoprotein complexes and their bound target mRNAs.", "journal": "RNA (New York, N.Y.)", "date": "2008", "authors": "Landthaler M, Gaidatzis D, Rothballer A, Chen PY, Soll SJ, Dinic L, Ojo T, Hafner M, Zavolan M, Tuschl T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "18978028", "url": "https://glygen.org/publication/PubMed/18978028" } ] }, { "title": "CXXC5 is a novel BMP4-regulated modulator of Wnt signaling in neural stem cells.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Andersson T, Sodersten E, Duckworth JK, Cascante A, Fritz N, Sacchetti P, Cervenka I, Bryja V, Hermanson O", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19001364", "url": "https://glygen.org/publication/PubMed/19001364" } ] }, { "title": "Transcriptional regulation of the cyclin D1 gene at a glance.", "journal": "Journal of cell science", "date": "2008", "authors": "Klein EA, Assoian RK", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19020303", "url": "https://glygen.org/publication/PubMed/19020303" } ] }, { "title": "Spliceosomal cleavage generates the 3' end of telomerase RNA.", "journal": "Nature", "date": "2008", "authors": "Box JA, Bunch JT, Tang W, Baumann P", "evidence": [ { "database": "Reactome", "id": "R-HSA-72165", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72165" } ], "reference": [ { "type": "PubMed", "id": "19052544", "url": "https://glygen.org/publication/PubMed/19052544" } ] }, { "title": "Characterization of cDNAs encoding the polypyrimidine tract-binding protein.", "journal": "Genes & development", "date": "1991", "authors": "Gil A, Sharp PA, Jamison SF, Garcia-Blanco MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803529", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803529" } ], "reference": [ { "type": "PubMed", "id": "1906035", "url": "https://glygen.org/publication/PubMed/1906035" } ] }, { "title": "The lysine demethylase LSD1 (KDM1) is required for maintenance of global DNA methylation.", "journal": "Nature genetics", "date": "2009", "authors": "Wang J, Hevi S, Kurash JK, Lei H, Gay F, Bajko J, Su H, Sun W, Chang H, Xu G, Gaudet F, Li E, Chen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19098913", "url": "https://glygen.org/publication/PubMed/19098913" } ] }, { "title": "Isolation and characterization of post-splicing lariat-intron complexes.", "journal": "Nucleic acids research", "date": "2009", "authors": "Yoshimoto R, Kataoka N, Okawa K, Ohno M", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "19103666", "url": "https://glygen.org/publication/PubMed/19103666" } ] }, { "title": "The truncated Hoxa1 protein interacts with Hoxa1 and Pbx1 in stem cells.", "journal": "Journal of cellular biochemistry", "date": "2009", "authors": "Fernandez CC, Gudas LJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "19115252", "url": "https://glygen.org/publication/PubMed/19115252" } ] }, { "title": "TFIP11 interacts with mDEAH9, an RNA helicase involved in spliceosome disassembly.", "journal": "International journal of molecular sciences", "date": "2008", "authors": "Wen X, Tannukit S, Paine ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "19165350", "url": "https://glygen.org/publication/PubMed/19165350" } ] }, { "title": "Importin 8 is a gene silencing factor that targets argonaute proteins to distinct mRNAs.", "journal": "Cell", "date": "2009", "authors": "Weinmann L, Hock J, Ivacevic T, Ohrt T, Mutze J, Schwille P, Kremmer E, Benes V, Urlaub H, Meister G", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "19167051", "url": "https://glygen.org/publication/PubMed/19167051" } ] }, { "title": "Transcriptional inhibiton of Hoxd4 expression by miRNA-10a in human breast cancer cells.", "journal": "BMC molecular biology", "date": "2009", "authors": "Tan Y, Zhang B, Wu T, Skogerbo G, Zhu X, Guo X, He S, Chen R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "19232136", "url": "https://glygen.org/publication/PubMed/19232136" } ] }, { "title": "Genetic polymorphisms in 85 DNA repair genes and bladder cancer risk.", "journal": "Carcinogenesis", "date": "2009", "authors": "Michiels S, Laplanche A, Boulet T, Dessen P, Guillonneau B, Mejean A, Desgrandchamps F, Lathrop M, Sarasin A, Benhamou S", "evidence": [ { "database": "RefSeq", "id": "NP_004796", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004796" } ], "reference": [ { "type": "PubMed", "id": "19237606", "url": "https://glygen.org/publication/PubMed/19237606" } ] }, { "title": "Breast cancer, estrogen receptor and ligands.", "journal": "Archiv der Pharmazie", "date": "2009", "authors": "Bai Z, Gust R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19274700", "url": "https://glygen.org/publication/PubMed/19274700" } ] }, { "title": "Coordination of dual incision and repair synthesis in human nucleotide excision repair.", "journal": "The EMBO journal", "date": "2009", "authors": "Staresincic L, Fagbemi AF, Enzlin JH, Gourdin AM, Wijgers N, Dunand-Sauthier I, Giglia-Mari G, Clarkson SG, Vermeulen W, Scharer OD", "evidence": [ { "database": "Reactome", "id": "R-HSA-6782135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6782135" } ], "reference": [ { "type": "PubMed", "id": "19279666", "url": "https://glygen.org/publication/PubMed/19279666" } ] }, { "title": "ESRP1 and ESRP2 are epithelial cell-type-specific regulators of FGFR2 splicing.", "journal": "Molecular cell", "date": "2009", "authors": "Warzecha CC, Sato TK, Nabet B, Hogenesch JB, Carstens RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803529", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803529" } ], "reference": [ { "type": "PubMed", "id": "19285943", "url": "https://glygen.org/publication/PubMed/19285943" } ] }, { "title": "Histone modifications at human enhancers reflect global cell-type-specific gene expression.", "journal": "Nature", "date": "2009", "authors": "Heintzman ND, Hon GC, Hawkins RD, Kheradpour P, Stark A, Harp LF, Ye Z, Lee LK, Stuart RK, Ching CW, Ching KA, Antosiewicz-Bourget JE, Liu H, Zhang X, Green RD, Lobanenkov VV, Stewart R, Thomson JA, Crawford GE, Kellis M, Ren B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19295514", "url": "https://glygen.org/publication/PubMed/19295514" } ] }, { "title": "Genomic responses from the estrogen-responsive element-dependent signaling pathway mediated by estrogen receptor alpha are required to elicit cellular alterations.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Nott SL, Huang Y, Li X, Fluharty BR, Qiu X, Welshons WV, Yeh S, Muyan M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19321454", "url": "https://glygen.org/publication/PubMed/19321454" } ] }, { "title": "E2-mediated cathepsin D (CTSD) activation involves looping of distal enhancer elements.", "journal": "Molecular oncology", "date": "2008", "authors": "Bretschneider N, Kangaspeska S, Seifert M, Reid G, Gannon F, Denger S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19383337", "url": "https://glygen.org/publication/PubMed/19383337" } ] }, { "title": "The C-terminal domains of human TNRC6A, TNRC6B, and TNRC6C silence bound transcripts independently of Argonaute proteins.", "journal": "RNA (New York, N.Y.)", "date": "2009", "authors": "Lazzaretti D, Tournier I, Izaurralde E", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "19383768", "url": "https://glygen.org/publication/PubMed/19383768" } ] }, { "title": "A C-terminal silencing domain in GW182 is essential for miRNA function.", "journal": "RNA (New York, N.Y.)", "date": "2009", "authors": "Eulalio A, Helms S, Fritzsch C, Fauser M, Izaurralde E", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "19383769", "url": "https://glygen.org/publication/PubMed/19383769" } ] }, { "title": "Abortive initiation is increased only for the weakest members of a set of down mutants of the adenovirus 2 major late promoter.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Jacob GA, Luse SW, Luse DS", "evidence": [ { "database": "Reactome", "id": "R-HSA-167162", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-167162" } ], "reference": [ { "type": "PubMed", "id": "1939271", "url": "https://glygen.org/publication/PubMed/1939271" } ] }, { "title": "Mammalian GW182 contains multiple Argonaute-binding sites and functions in microRNA-mediated translational repression.", "journal": "RNA (New York, N.Y.)", "date": "2009", "authors": "Takimoto K, Wakiyama M, Yokoyama S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "19398495", "url": "https://glygen.org/publication/PubMed/19398495" } ] }, { "title": "Both strands of siRNA have potential to guide posttranscriptional gene silencing in mammalian cells.", "journal": "PloS one", "date": "2009", "authors": "Wei JX, Yang J, Sun JF, Jia LT, Zhang Y, Zhang HZ, Li X, Meng YL, Yao LB, Yang AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-203927", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203927" } ], "reference": [ { "type": "PubMed", "id": "19401777", "url": "https://glygen.org/publication/PubMed/19401777" } ] }, { "title": "Exon, intron and splice site locations in the spliceosomal B complex.", "journal": "The EMBO journal", "date": "2009", "authors": "Wolf E, Kastner B, Deckert J, Merz C, Stark H, Luhrmann R", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "19536130", "url": "https://glygen.org/publication/PubMed/19536130" } ] }, { "title": "TFIIH-associated Cdk7 kinase functions in phosphorylation of C-terminal domain Ser7 residues, promoter-proximal pausing, and termination by RNA polymerase II.", "journal": "Molecular and cellular biology", "date": "2009", "authors": "Glover-Cutter K, Larochelle S, Erickson B, Zhang C, Shokat K, Fisher RP, Bentley DL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "19667075", "url": "https://glygen.org/publication/PubMed/19667075" } ] }, { "title": "The DEAD-box protein p72 regulates ERalpha-/oestrogen-dependent transcription and cell growth, and is associated with improved survival in ERalpha-positive breast cancer.", "journal": "Oncogene", "date": "2009", "authors": "Wortham NC, Ahamed E, Nicol SM, Thomas RS, Periyasamy M, Jiang J, Ochocka AM, Shousha S, Huson L, Bray SE, Coombes RC, Ali S, Fuller-Pace FV", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "19718048", "url": "https://glygen.org/publication/PubMed/19718048" } ] }, { "title": "Re-capping the message.", "journal": "Trends in biochemical sciences", "date": "2009", "authors": "Schoenberg DR, Maquat LE", "evidence": [ { "database": "Reactome", "id": "R-HSA-72086", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72086" } ], "reference": [ { "type": "PubMed", "id": "19729311", "url": "https://glygen.org/publication/PubMed/19729311" } ] }, { "title": "Retinoic acid receptor antagonists inhibit miR-10a expression and block metastatic behavior of pancreatic cancer.", "journal": "Gastroenterology", "date": "2009", "authors": "Weiss FU, Marques IJ, Woltering JM, Vlecken DH, Aghdassi A, Partecke LI, Heidecke CD, Lerch MM, Bagowski CP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "19747919", "url": "https://glygen.org/publication/PubMed/19747919" } ] }, { "title": "Sequential activation of HOX2 homeobox genes by retinoic acid in human embryonal carcinoma cells.", "journal": "Nature", "date": "1990", "authors": "Simeone A, Acampora D, Arcioni L, Andrews PW, Boncinelli E, Mavilio F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "1975088", "url": "https://glygen.org/publication/PubMed/1975088" } ] }, { "title": "Hypoxia-inducible mir-210 regulates normoxic gene expression involved in tumor initiation.", "journal": "Molecular cell", "date": "2009", "authors": "Huang X, Ding L, Bennewith KL, Tong RT, Welford SM, Ang KK, Story M, Le QT, Giaccia AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "19782034", "url": "https://glygen.org/publication/PubMed/19782034" } ] }, { "title": "Epigenetic silencing of the RASSF1A tumor suppressor gene through HOXB3-mediated induction of DNMT3B expression.", "journal": "Molecular cell", "date": "2009", "authors": "Palakurthy RK, Wajapeyee N, Santra MK, Gazin C, Lin L, Gobeil S, Green MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "19854132", "url": "https://glygen.org/publication/PubMed/19854132" } ] }, { "title": "The XPA-binding domain of ERCC1 is required for nucleotide excision repair but not other DNA repair pathways.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Orelli B, McClendon TB, Tsodikov OV, Ellenberger T, Niedernhofer LJ, Scharer OD", "evidence": [ { "database": "Reactome", "id": "R-HSA-6782135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6782135" } ], "reference": [ { "type": "PubMed", "id": "19940136", "url": "https://glygen.org/publication/PubMed/19940136" } ] }, { "title": "Progression through the RNA polymerase II CTD cycle.", "journal": "Molecular cell", "date": "2009", "authors": "Buratowski S", "evidence": [ { "database": "Reactome", "id": "R-HSA-77075", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-77075" } ], "reference": [ { "type": "PubMed", "id": "19941815", "url": "https://glygen.org/publication/PubMed/19941815" } ] }, { "title": "DSIF, the Paf1 complex, and Tat-SF1 have nonredundant, cooperative roles in RNA polymerase II elongation.", "journal": "Genes & development", "date": "2009", "authors": "Chen Y, Yamaguchi Y, Tsugeno Y, Yamamoto J, Yamada T, Nakamura M, Hisatake K, Handa H", "evidence": [ { "database": "Reactome", "id": "R-HSA-112382", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-112382" } ], "reference": [ { "type": "PubMed", "id": "19952111", "url": "https://glygen.org/publication/PubMed/19952111" } ] }, { "title": "ATP-dependent human RISC assembly pathways.", "journal": "Nature structural & molecular biology", "date": "2010", "authors": "Yoda M, Kawamata T, Paroo Z, Ye X, Iwasaki S, Liu Q, Tomari Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-203927", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203927" } ], "reference": [ { "type": "PubMed", "id": "19966796", "url": "https://glygen.org/publication/PubMed/19966796" } ] }, { "title": "Regulation of HOXA2 gene expression by the ATP-dependent chromatin remodeling enzyme CHD8.", "journal": "FEBS letters", "date": "2010", "authors": "Yates JA, Menon T, Thompson BA, Bochar DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "20085832", "url": "https://glygen.org/publication/PubMed/20085832" } ] }, { "title": "AFF4, a component of the ELL/P-TEFb elongation complex and a shared subunit of MLL chimeras, can link transcription elongation to leukemia.", "journal": "Molecular cell", "date": "2010", "authors": "Lin C, Smith ER, Takahashi H, Lai KC, Martin-Brown S, Florens L, Washburn MP, Conaway JW, Conaway RC, Shilatifard A", "evidence": [ { "database": "Reactome", "id": "R-HSA-112382", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-112382" } ], "reference": [ { "type": "PubMed", "id": "20159561", "url": "https://glygen.org/publication/PubMed/20159561" } ] }, { "title": "Distinct factors control histone variant H3.3 localization at specific genomic regions.", "journal": "Cell", "date": "2010", "authors": "Goldberg AD, Banaszynski LA, Noh KM, Lewis PW, Elsaesser SJ, Stadler S, Dewell S, Law M, Guo X, Li X, Wen D, Chapgier A, DeKelver RC, Miller JC, Lee YL, Boydston EA, Holmes MC, Gregory PD, Greally JM, Rafii S, Yang C, Scambler PJ, Garrick D, Gibbons RJ, Higgs DR, Cristea IM, Urnov FD, Zheng D, Allis CD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9670095", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9670095" } ], "reference": [ { "type": "PubMed", "id": "20211137", "url": "https://glygen.org/publication/PubMed/20211137" } ] }, { "title": "A CTCF-independent role for cohesin in tissue-specific transcription.", "journal": "Genome research", "date": "2010", "authors": "Schmidt D, Schwalie PC, Ross-Innes CS, Hurtado A, Brown GD, Carroll JS, Flicek P, Odom DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "20219941", "url": "https://glygen.org/publication/PubMed/20219941" } ] }, { "title": "A novel Wilms tumor 1 (WT1) target gene negatively regulates the WNT signaling pathway.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Kim MS, Yoon SK, Bollig F, Kitagaki J, Hur W, Whye NJ, Wu YP, Rivera MN, Park JY, Kim HS, Malik K, Bell DW, Englert C, Perantoni AO, Lee SB", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "20220130", "url": "https://glygen.org/publication/PubMed/20220130" } ] }, { "title": "Three DNA polymerases, recruited by different mechanisms, carry out NER repair synthesis in human cells.", "journal": "Molecular cell", "date": "2010", "authors": "Ogi T, Limsirichaikul S, Overmeer RM, Volker M, Takenaka K, Cloney R, Nakazawa Y, Niimi A, Miki Y, Jaspers NG, Mullenders LH, Yamashita S, Fousteri MI, Lehmann AR", "evidence": [ { "database": "Reactome", "id": "R-HSA-6782210", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6782210" } ], "reference": [ { "type": "PubMed", "id": "20227374", "url": "https://glygen.org/publication/PubMed/20227374" } ] }, { "title": "Contribution of DEAH-box protein DHX16 in human pre-mRNA splicing.", "journal": "The Biochemical journal", "date": "2010", "authors": "Gencheva M, Kato M, Newo AN, Lin RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "20423332", "url": "https://glygen.org/publication/PubMed/20423332" } ] }, { "title": "The integrator complex recognizes a new double mark on the RNA polymerase II carboxyl-terminal domain.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Egloff S, Szczepaniak SA, Dienstbier M, Taylor A, Knight S, Murphy S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "20457598", "url": "https://glygen.org/publication/PubMed/20457598" } ] }, { "title": "Novel trans-tail regulation of H2B ubiquitylation and H3K4 methylation by the N terminus of histone H2A.", "journal": "Molecular and cellular biology", "date": "2010", "authors": "Zheng S, Wyrick JJ, Reese JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "20498280", "url": "https://glygen.org/publication/PubMed/20498280" } ] }, { "title": "A ubiquitin-binding domain in Cockayne syndrome B required for transcription-coupled nucleotide excision repair.", "journal": "Molecular cell", "date": "2010", "authors": "Anindya R, Mari PO, Kristensen U, Kool H, Giglia-Mari G, Mullenders LH, Fousteri M, Vermeulen W, Egly JM, Svejstrup JQ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6781827", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6781827" } ], "reference": [ { "type": "PubMed", "id": "20541997", "url": "https://glygen.org/publication/PubMed/20541997" } ] }, { "title": "Role of EBAG9 protein in coat protein complex I-dependent glycoprotein maturation and secretion processes in tumor cells.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2010", "authors": "Wolf J, Reimer TA, Schuck S, Ruder C, Gerlach K, Muller EC, Otto A, Dorken B, Rehm A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "20570965", "url": "https://glygen.org/publication/PubMed/20570965" } ] }, { "title": "Daxx is an H3.3-specific histone chaperone and cooperates with ATRX in replication-independent chromatin assembly at telomeres.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Lewis PW, Elsaesser SJ, Noh KM, Stadler SC, Allis CD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9670095", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9670095" } ], "reference": [ { "type": "PubMed", "id": "20651253", "url": "https://glygen.org/publication/PubMed/20651253" } ] }, { "title": "The histone demethylase JMJD2B is regulated by estrogen receptor alpha and hypoxia, and is a key mediator of estrogen induced growth.", "journal": "Cancer research", "date": "2010", "authors": "Yang J, Jubb AM, Pike L, Buffa FM, Turley H, Baban D, Leek R, Gatter KC, Ragoussis J, Harris AL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "20682797", "url": "https://glygen.org/publication/PubMed/20682797" } ] }, { "title": "Characterization of purified human Bact spliceosomal complexes reveals compositional and morphological changes during spliceosome activation and first step catalysis.", "journal": "RNA (New York, N.Y.)", "date": "2010", "authors": "Bessonov S, Anokhina M, Krasauskas A, Golas MM, Sander B, Will CL, Urlaub H, Stark H, Luhrmann R", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "20980672", "url": "https://glygen.org/publication/PubMed/20980672" } ] }, { "title": "RNA interference against transcription elongation factor SII does not support its role in transcription-coupled nucleotide excision repair.", "journal": "Mutation research", "date": "2011", "authors": "Mackinnon-Roy C, Stubbert LJ, McKay BC", "evidence": [ { "database": "Reactome", "id": "R-HSA-6781823", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6781823" } ], "reference": [ { "type": "PubMed", "id": "21070792", "url": "https://glygen.org/publication/PubMed/21070792" } ] }, { "title": "Histone H3K27ac separates active from poised enhancers and predicts developmental state.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Creyghton MP, Cheng AW, Welstead GG, Kooistra T, Carey BW, Steine EJ, Hanna J, Lodato MA, Frampton GM, Sharp PA, Boyer LA, Young RA, Jaenisch R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21106759", "url": "https://glygen.org/publication/PubMed/21106759" } ] }, { "title": "FOXA1 is a key determinant of estrogen receptor function and endocrine response.", "journal": "Nature genetics", "date": "2011", "authors": "Hurtado A, Holmes KA, Ross-Innes CS, Schmidt D, Carroll JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21151129", "url": "https://glygen.org/publication/PubMed/21151129" } ] }, { "title": "The human U1 snRNA promoter correctly initiates transcription in vitro and is activated by PSE1.", "journal": "Genes & development", "date": "1990", "authors": "Gunderson SI, Knuth MW, Burgess RR", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "2125285", "url": "https://glygen.org/publication/PubMed/2125285" } ] }, { "title": "Replication protein A safeguards genome integrity by controlling NER incision events.", "journal": "The Journal of cell biology", "date": "2011", "authors": "Overmeer RM, Moser J, Volker M, Kool H, Tomkinson AE, van Zeeland AA, Mullenders LH, Fousteri M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6782210", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6782210" } ], "reference": [ { "type": "PubMed", "id": "21282463", "url": "https://glygen.org/publication/PubMed/21282463" } ] }, { "title": "Identification and characterization of an inhibitory fibroblast growth factor receptor 2 (FGFR2) molecule, up-regulated in an Apert Syndrome mouse model.", "journal": "The Biochemical journal", "date": "2011", "authors": "Wheldon LM, Khodabukus N, Patey SJ, Smith TG, Heath JK, Hajihosseini MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-8851708", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8851708" } ], "reference": [ { "type": "PubMed", "id": "21355848", "url": "https://glygen.org/publication/PubMed/21355848" } ] }, { "title": "Transcriptional gene silencing in mammalian cells by miRNA mimics that target gene promoters.", "journal": "Nucleic acids research", "date": "2011", "authors": "Younger ST, Corey DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "21427083", "url": "https://glygen.org/publication/PubMed/21427083" } ] }, { "title": "Histone demethylase JMJD2B functions as a co-factor of estrogen receptor in breast cancer proliferation and mammary gland development.", "journal": "PloS one", "date": "2011", "authors": "Kawazu M, Saso K, Tong KI, McQuire T, Goto K, Son DO, Wakeham A, Miyagishi M, Mak TW, Okada H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21445275", "url": "https://glygen.org/publication/PubMed/21445275" } ] }, { "title": "Structural insights into piRNA recognition by the human PIWI-like 1 PAZ domain.", "journal": "Proteins", "date": "2011", "authors": "Zeng L, Zhang Q, Yan K, Zhou MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5601884", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5601884" } ], "reference": [ { "type": "PubMed", "id": "21465557", "url": "https://glygen.org/publication/PubMed/21465557" } ] }, { "title": "Semiquantitative proteomic analysis of the human spliceosome via a novel two-dimensional gel electrophoresis method.", "journal": "Molecular and cellular biology", "date": "2011", "authors": "Agafonov DE, Deckert J, Wolf E, Odenwalder P, Bessonov S, Will CL, Urlaub H, Luhrmann R", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "21536652", "url": "https://glygen.org/publication/PubMed/21536652" } ] }, { "title": "Intracellular estrogen receptor-binding fragment-associated antigen 9 exerts in vivo tumor-promoting effects via its coiled-coil region.", "journal": "International journal of oncology", "date": "2011", "authors": "Maeyama Y, Otsu M, Kubo S, Yamano T, Iimura Y, Onodera M, Kondo S, Sakiyama Y, Ariga T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21573489", "url": "https://glygen.org/publication/PubMed/21573489" } ] }, { "title": "Transcriptional regulation by miRNA mimics that target sequences downstream of gene termini.", "journal": "Molecular bioSystems", "date": "2011", "authors": "Younger ST, Corey DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "21589992", "url": "https://glygen.org/publication/PubMed/21589992" } ] }, { "title": "siRNA repositioning for guide strand selection by human Dicer complexes.", "journal": "Molecular cell", "date": "2011", "authors": "Noland CL, Ma E, Doudna JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-203927", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203927" } ], "reference": [ { "type": "PubMed", "id": "21726814", "url": "https://glygen.org/publication/PubMed/21726814" } ] }, { "title": "Evidence for base-pairing between mammalian U2 and U6 small nuclear ribonucleoprotein particles.", "journal": "Genes & development", "date": "1990", "authors": "Hausner TP, Giglio LM, Weiner AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "2176635", "url": "https://glygen.org/publication/PubMed/2176635" } ] }, { "title": "Strong association between c-myb and oestrogen-receptor expression in human breast cancer.", "journal": "Oncogene", "date": "1990", "authors": "Guerin M, Sheng ZM, Andrieu N, Riou G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "2181374", "url": "https://glygen.org/publication/PubMed/2181374" } ] }, { "title": "Estrogen induces c-myc gene expression via an upstream enhancer activated by the estrogen receptor and the AP-1 transcription factor.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2011", "authors": "Wang C, Mayer JA, Mazumdar A, Fertuck K, Kim H, Brown M, Brown PH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21835891", "url": "https://glygen.org/publication/PubMed/21835891" } ] }, { "title": "Cellular reprogramming by the conjoint action of ERalpha, FOXA1, and GATA3 to a ligand-inducible growth state.", "journal": "Molecular systems biology", "date": "2011", "authors": "Kong SL, Li G, Loh SL, Sung WK, Liu ET", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21878914", "url": "https://glygen.org/publication/PubMed/21878914" } ] }, { "title": "FOXA1: master of steroid receptor function in cancer.", "journal": "The EMBO journal", "date": "2011", "authors": "Augello MA, Hickey TE, Knudsen KE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21934649", "url": "https://glygen.org/publication/PubMed/21934649" } ] }, { "title": "Gene regulation by cohesin in cancer: is the ring an unexpected party to proliferation?", "journal": "Molecular cancer research : MCR", "date": "2011", "authors": "Rhodes JM, McEwan M, Horsfield JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "21940756", "url": "https://glygen.org/publication/PubMed/21940756" } ] }, { "title": "The Cyclin K/Cdk12 complex maintains genomic stability via regulation of expression of DNA damage response genes.", "journal": "Genes & development", "date": "2011", "authors": "Blazek D, Kohoutek J, Bartholomeeusen K, Johansen E, Hulinkova P, Luo Z, Cimermancic P, Ule J, Peterlin BM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6796648", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6796648" } ], "reference": [ { "type": "PubMed", "id": "22012619", "url": "https://glygen.org/publication/PubMed/22012619" } ] }, { "title": "Pioneer transcription factors: establishing competence for gene expression.", "journal": "Genes & development", "date": "2011", "authors": "Zaret KS, Carroll JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "22056668", "url": "https://glygen.org/publication/PubMed/22056668" } ] }, { "title": "Direct evidence of nuclear Argonaute distribution during transcriptional silencing links the actin cytoskeleton to nuclear RNAi machinery in human cells.", "journal": "Nucleic acids research", "date": "2012", "authors": "Ahlenstiel CL, Lim HG, Cooper DA, Ishida T, Kelleher AD, Suzuki K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "22064859", "url": "https://glygen.org/publication/PubMed/22064859" } ] }, { "title": "Functional and structural studies of the nucleotide excision repair helicase XPD suggest a polarity for DNA translocation.", "journal": "The EMBO journal", "date": "2012", "authors": "Kuper J, Wolski SC, Michels G, Kisker C", "evidence": [ { "database": "Reactome", "id": "R-HSA-6782135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6782135" } ], "reference": [ { "type": "PubMed", "id": "22081108", "url": "https://glygen.org/publication/PubMed/22081108" } ] }, { "title": "Dicer is dispensable for asymmetric RISC loading in mammals.", "journal": "RNA (New York, N.Y.)", "date": "2012", "authors": "Betancur JG, Tomari Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-203927", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203927" } ], "reference": [ { "type": "PubMed", "id": "22106413", "url": "https://glygen.org/publication/PubMed/22106413" } ] }, { "title": "Functional mammalian spliceosomal complex E contains SMN complex proteins in addition to U1 and U2 snRNPs.", "journal": "Nucleic acids research", "date": "2012", "authors": "Makarov EM, Owen N, Bottrill A, Makarova OV", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "22110043", "url": "https://glygen.org/publication/PubMed/22110043" } ] }, { "title": "The molecular basis of CRL4DDB2/CSA ubiquitin ligase architecture, targeting, and activation.", "journal": "Cell", "date": "2011", "authors": "Fischer ES, Scrima A, Bohm K, Matsumoto S, Lingaraju GM, Faty M, Yasuda T, Cavadini S, Wakasugi M, Hanaoka F, Iwai S, Gut H, Sugasawa K, Thoma NH", "evidence": [ { "database": "Reactome", "id": "R-HSA-6781823", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6781823" } ], "reference": [ { "type": "PubMed", "id": "22118460", "url": "https://glygen.org/publication/PubMed/22118460" } ] }, { "title": "Ser7 phosphorylation of the CTD recruits the RPAP2 Ser5 phosphatase to snRNA genes.", "journal": "Molecular cell", "date": "2012", "authors": "Egloff S, Zaborowska J, Laitem C, Kiss T, Murphy S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "22137580", "url": "https://glygen.org/publication/PubMed/22137580" } ] }, { "title": "The role of Dicer protein partners in the processing of microRNA precursors.", "journal": "PloS one", "date": "2011", "authors": "Koscianska E, Starega-Roslan J, Krzyzosiak WJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-203927", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203927" } ], "reference": [ { "type": "PubMed", "id": "22163034", "url": "https://glygen.org/publication/PubMed/22163034" } ] }, { "title": "Control of the RNA polymerase II phosphorylation state in promoter regions by CTD interaction domain-containing proteins RPRD1A and RPRD1B.", "journal": "Transcription", "date": "2011", "authors": "Ni Z, Olsen JB, Guo X, Zhong G, Ruan ED, Marcon E, Young P, Guo H, Li J, Moffat J, Emili A, Greenblatt JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "22231121", "url": "https://glygen.org/publication/PubMed/22231121" } ] }, { "title": "proTRAC--a software for probabilistic piRNA cluster detection, visualization and analysis.", "journal": "BMC bioinformatics", "date": "2012", "authors": "Rosenkranz D, Zischler H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5601884", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5601884" } ], "reference": [ { "type": "PubMed", "id": "22233380", "url": "https://glygen.org/publication/PubMed/22233380" } ] }, { "title": "snRNA 3' end formation requires heterodimeric association of integrator subunits.", "journal": "Molecular and cellular biology", "date": "2012", "authors": "Albrecht TR, Wagner EJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "22252320", "url": "https://glygen.org/publication/PubMed/22252320" } ] }, { "title": "Extensive promoter-centered chromatin interactions provide a topological basis for transcription regulation.", "journal": "Cell", "date": "2012", "authors": "Li G, Ruan X, Auerbach RK, Sandhu KS, Zheng M, Wang P, Poh HM, Goh Y, Lim J, Zhang J, Sim HS, Peh SQ, Mulawadi FH, Ong CT, Orlov YL, Hong S, Zhang Z, Landt S, Raha D, Euskirchen G, Wei CL, Ge W, Wang H, Davis C, Fisher-Aylor KI, Mortazavi A, Gerstein M, Gingeras T, Wold B, Sun Y, Fullwood MJ, Cheung E, Liu E, Sung WK, Snyder M, Ruan Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "22265404", "url": "https://glygen.org/publication/PubMed/22265404" } ] }, { "title": "Dynamic protein-protein interaction wiring of the human spliceosome.", "journal": "Molecular cell", "date": "2012", "authors": "Hegele A, Kamburov A, Grossmann A, Sourlis C, Wowro S, Weimann M, Will CL, Pena V, Luhrmann R, Stelzl U", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "22365833", "url": "https://glygen.org/publication/PubMed/22365833" } ] }, { "title": "A novel TBP-TAF complex on RNA polymerase II-transcribed snRNA genes.", "journal": "Transcription", "date": "2012", "authors": "Zaborowska J, Taylor A, Roeder RG, Murphy S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "22441827", "url": "https://glygen.org/publication/PubMed/22441827" } ] }, { "title": "A role for small RNAs in DNA double-strand break repair.", "journal": "Cell", "date": "2012", "authors": "Wei W, Ba Z, Gao M, Wu Y, Ma Y, Amiard S, White CI, Rendtlew Danielsen JM, Yang YG, Qi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "22445173", "url": "https://glygen.org/publication/PubMed/22445173" } ] }, { "title": "Mutations in UVSSA cause UV-sensitive syndrome and impair RNA polymerase IIo processing in transcription-coupled nucleotide-excision repair.", "journal": "Nature genetics", "date": "2012", "authors": "Nakazawa Y, Sasaki K, Mitsutake N, Matsuse M, Shimada M, Nardo T, Takahashi Y, Ohyama K, Ito K, Mishima H, Nomura M, Kinoshita A, Ono S, Takenaka K, Masuyama R, Kudo T, Slor H, Utani A, Tateishi S, Yamashita S, Stefanini M, Lehmann AR, Yoshiura K, Ogi T", "evidence": [ { "database": "Reactome", "id": "R-HSA-6781823", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6781823" } ], "reference": [ { "type": "PubMed", "id": "22466610", "url": "https://glygen.org/publication/PubMed/22466610" } ] }, { "title": "UV-sensitive syndrome protein UVSSA recruits USP7 to regulate transcription-coupled repair.", "journal": "Nature genetics", "date": "2012", "authors": "Schwertman P, Lagarou A, Dekkers DH, Raams A, van der Hoek AC, Laffeber C, Hoeijmakers JH, Demmers JA, Fousteri M, Vermeulen W, Marteijn JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6781823", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6781823" } ], "reference": [ { "type": "PubMed", "id": "22466611", "url": "https://glygen.org/publication/PubMed/22466611" } ] }, { "title": "Mutations in UVSSA cause UV-sensitive syndrome and destabilize ERCC6 in transcription-coupled DNA repair.", "journal": "Nature genetics", "date": "2012", "authors": "Zhang X, Horibata K, Saijo M, Ishigami C, Ukai A, Kanno S, Tahara H, Neilan EG, Honma M, Nohmi T, Yasui A, Tanaka K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6781823", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6781823" } ], "reference": [ { "type": "PubMed", "id": "22466612", "url": "https://glygen.org/publication/PubMed/22466612" } ] }, { "title": "Estrogen receptor-alpha recruits P-TEFb to overcome transcriptional pausing in intron 1 of the MYB gene.", "journal": "Nucleic acids research", "date": "2012", "authors": "Mitra P, Pereira LA, Drabsch Y, Ramsay RG, Gonda TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "22492511", "url": "https://glygen.org/publication/PubMed/22492511" } ] }, { "title": "Non-overlapping progesterone receptor cistromes contribute to cell-specific transcriptional outcomes.", "journal": "PloS one", "date": "2012", "authors": "Clarke CL, Graham JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "22545144", "url": "https://glygen.org/publication/PubMed/22545144" } ] }, { "title": "Hydroxylation of 5-methylcytosine by TET2 maintains the active state of the mammalian HOXA cluster.", "journal": "Nature communications", "date": "2012", "authors": "Bocker MT, Tuorto F, Raddatz G, Musch T, Yang FC, Xu M, Lyko F, Breiling A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "22569366", "url": "https://glygen.org/publication/PubMed/22569366" } ] }, { "title": "The elements of human cyclin D1 promoter and regulation involved.", "journal": "Clinical epigenetics", "date": "2011", "authors": "Guo ZY, Hao XH, Tan FF, Pei X, Shang LM, Jiang XL, Yang F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "22704330", "url": "https://glygen.org/publication/PubMed/22704330" } ] }, { "title": "miR-7 and miR-218 epigenetically control tumor suppressor genes RASSF1A and Claudin-6 by targeting HoxB3 in breast cancer.", "journal": "Biochemical and biophysical research communications", "date": "2012", "authors": "Li Q, Zhu F, Chen P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "22705304", "url": "https://glygen.org/publication/PubMed/22705304" } ] }, { "title": "Site-specific DICER and DROSHA RNA products control the DNA-damage response.", "journal": "Nature", "date": "2012", "authors": "Francia S, Michelini F, Saxena A, Tang D, de Hoon M, Anelli V, Mione M, Carninci P, d'Adda di Fagagna F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "22722852", "url": "https://glygen.org/publication/PubMed/22722852" } ] }, { "title": "microRNAs associated with the different human Argonaute proteins.", "journal": "Nucleic acids research", "date": "2012", "authors": "Dueck A, Ziegler C, Eichner A, Berezikov E, Meister G", "evidence": [ { "database": "Reactome", "id": "R-HSA-203927", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203927" } ], "reference": [ { "type": "PubMed", "id": "22844086", "url": "https://glygen.org/publication/PubMed/22844086" } ] }, { "title": "Functional dissection of HOXD cluster genes in regulation of neuroblastoma cell proliferation and differentiation.", "journal": "PloS one", "date": "2012", "authors": "Zha Y, Ding E, Yang L, Mao L, Wang X, McCarthy BA, Huang S, Ding HF", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "22879880", "url": "https://glygen.org/publication/PubMed/22879880" } ] }, { "title": "KIAA1530 protein is recruited by Cockayne syndrome complementation group protein A (CSA) to participate in transcription-coupled repair (TCR).", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Fei J, Chen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6781823", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6781823" } ], "reference": [ { "type": "PubMed", "id": "22902626", "url": "https://glygen.org/publication/PubMed/22902626" } ] }, { "title": "CWC22 connects pre-mRNA splicing and exon junction complex assembly.", "journal": "Cell reports", "date": "2012", "authors": "Steckelberg AL, Boehm V, Gromadzka AM, Gehring NH", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "22959432", "url": "https://glygen.org/publication/PubMed/22959432" } ] }, { "title": "Argonaute proteins couple chromatin silencing to alternative splicing.", "journal": "Nature structural & molecular biology", "date": "2012", "authors": "Ameyar-Zazoua M, Rachez C, Souidi M, Robin P, Fritsch L, Young R, Morozova N, Fenouil R, Descostes N, Andrau JC, Mathieu J, Hamiche A, Ait-Si-Ali S, Muchardt C, Batsche E, Harel-Bellan A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "22961379", "url": "https://glygen.org/publication/PubMed/22961379" } ] }, { "title": "Human CWC22 escorts the helicase eIF4AIII to spliceosomes and promotes exon junction complex assembly.", "journal": "Nature structural & molecular biology", "date": "2012", "authors": "Barbosa I, Haque N, Fiorini F, Barrandon C, Tomasetto C, Blanchette M, Le Hir H", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "22961380", "url": "https://glygen.org/publication/PubMed/22961380" } ] }, { "title": "Dynamic phosphorylation patterns of RNA polymerase II CTD during transcription.", "journal": "Biochimica et biophysica acta", "date": "2013", "authors": "Heidemann M, Hintermair C, Voss K, Eick D", "evidence": [ { "database": "Reactome", "id": "R-HSA-72086", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72086" } ], "reference": [ { "type": "PubMed", "id": "22982363", "url": "https://glygen.org/publication/PubMed/22982363" } ] }, { "title": "Interaction of cyclin-dependent kinase 12/CrkRS with cyclin K1 is required for the phosphorylation of the C-terminal domain of RNA polymerase II.", "journal": "Molecular and cellular biology", "date": "2012", "authors": "Cheng SW, Kuzyk MA, Moradian A, Ichu TA, Chang VC, Tien JF, Vollett SE, Griffith M, Marra MA, Morin GB", "evidence": [ { "database": "Reactome", "id": "R-HSA-6796648", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6796648" } ], "reference": [ { "type": "PubMed", "id": "22988298", "url": "https://glygen.org/publication/PubMed/22988298" } ] }, { "title": "Selective constraint on copy number variation in human piwi-interacting RNA Loci.", "journal": "PloS one", "date": "2012", "authors": "Gould DW, Lukic S, Chen KC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5601884", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5601884" } ], "reference": [ { "type": "PubMed", "id": "23056369", "url": "https://glygen.org/publication/PubMed/23056369" } ] }, { "title": "Human RNA methyltransferase BCDIN3D regulates microRNA processing.", "journal": "Cell", "date": "2012", "authors": "Xhemalce B, Robson SC, Kouzarides T", "evidence": [ { "database": "Reactome", "id": "R-HSA-203927", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203927" } ], "reference": [ { "type": "PubMed", "id": "23063121", "url": "https://glygen.org/publication/PubMed/23063121" } ] }, { "title": "Dicer partner proteins tune the length of mature miRNAs in flies and mammals.", "journal": "Cell", "date": "2012", "authors": "Fukunaga R, Han BW, Hung JH, Xu J, Weng Z, Zamore PD", "evidence": [ { "database": "Reactome", "id": "R-HSA-203927", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203927" } ], "reference": [ { "type": "PubMed", "id": "23063653", "url": "https://glygen.org/publication/PubMed/23063653" } ] }, { "title": "Cohesin is required for activation of MYC by estradiol.", "journal": "PloS one", "date": "2012", "authors": "McEwan MV, Eccles MR, Horsfield JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23145106", "url": "https://glygen.org/publication/PubMed/23145106" } ] }, { "title": "Human TNRC6A is an Argonaute-navigator protein for microRNA-mediated gene silencing in the nucleus.", "journal": "RNA (New York, N.Y.)", "date": "2013", "authors": "Nishi K, Nishi A, Nagasawa T, Ui-Tei K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "23150874", "url": "https://glygen.org/publication/PubMed/23150874" } ] }, { "title": "Genomic study of RNA polymerase II and III SNAPc-bound promoters reveals a gene transcribed by both enzymes and a broad use of common activators.", "journal": "PLoS genetics", "date": "2012", "authors": "James Faresse N, Canella D, Praz V, Michaud J, Romascano D, Hernandez N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "23166507", "url": "https://glygen.org/publication/PubMed/23166507" } ] }, { "title": "GATA3 acts upstream of FOXA1 in mediating ESR1 binding by shaping enhancer accessibility.", "journal": "Genome research", "date": "2013", "authors": "Theodorou V, Stark R, Menon S, Carroll JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23172872", "url": "https://glygen.org/publication/PubMed/23172872" } ] }, { "title": "Cooperating transcription factors mediate the function of estrogen receptor.", "journal": "Chromosoma", "date": "2013", "authors": "Fiorito E, Katika MR, Hurtado A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23192763", "url": "https://glygen.org/publication/PubMed/23192763" } ] }, { "title": "HoxB3 promotes prostate cancer cell progression by transactivating CDCA3.", "journal": "Cancer letters", "date": "2013", "authors": "Chen J, Zhu S, Jiang N, Shang Z, Quan C, Niu Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "23219899", "url": "https://glygen.org/publication/PubMed/23219899" } ] }, { "title": "Aly and THO are required for assembly of the human TREX complex and association of TREX components with the spliced mRNA.", "journal": "Nucleic acids research", "date": "2013", "authors": "Chi B, Wang Q, Wu G, Tan M, Wang L, Shi M, Chang X, Cheng H", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "23222130", "url": "https://glygen.org/publication/PubMed/23222130" } ] }, { "title": "Human spliceosomal protein CWC22 plays a role in coupling splicing to exon junction complex deposition and nonsense-mediated decay.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2012", "authors": "Alexandrov A, Colognori D, Shu MD, Steitz JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "23236153", "url": "https://glygen.org/publication/PubMed/23236153" } ] }, { "title": "ATP-independent diffusion of double-stranded RNA binding proteins.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2013", "authors": "Koh HR, Kidwell MA, Ragunathan K, Doudna JA, Myong S", "evidence": [ { "database": "Reactome", "id": "R-HSA-203927", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203927" } ], "reference": [ { "type": "PubMed", "id": "23251028", "url": "https://glygen.org/publication/PubMed/23251028" } ] }, { "title": "Oxygen-dependent expression of cytochrome c oxidase subunit 4-2 gene expression is mediated by transcription factors RBPJ, CXXC5 and CHCHD2.", "journal": "Nucleic acids research", "date": "2013", "authors": "Aras S, Pak O, Sommer N, Finley R Jr, Huttemann M, Weissmann N, Grossman LI", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23303788", "url": "https://glygen.org/publication/PubMed/23303788" } ] }, { "title": "Rearrangements within human spliceosomes captured after exon ligation.", "journal": "RNA (New York, N.Y.)", "date": "2013", "authors": "Ilagan JO, Chalkley RJ, Burlingame AL, Jurica MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "23345524", "url": "https://glygen.org/publication/PubMed/23345524" } ] }, { "title": "Endogenous purification reveals GREB1 as a key estrogen receptor regulatory factor.", "journal": "Cell reports", "date": "2013", "authors": "Mohammed H, D'Santos C, Serandour AA, Ali HR, Brown GD, Atkins A, Rueda OM, Holmes KA, Theodorou V, Robinson JL, Zwart W, Saadi A, Ross-Innes CS, Chin SF, Menon S, Stingl J, Palmieri C, Caldas C, Carroll JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23403292", "url": "https://glygen.org/publication/PubMed/23403292" } ] }, { "title": "The lysine demethylase, KDM4B, is a key molecule in androgen receptor signalling and turnover.", "journal": "Nucleic acids research", "date": "2013", "authors": "Coffey K, Rogerson L, Ryan-Munden C, Alkharaif D, Stockley J, Heer R, Sahadevan K, O'Neill D, Jones D, Darby S, Staller P, Mantilla A, Gaughan L, Robson CN", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23435229", "url": "https://glygen.org/publication/PubMed/23435229" } ] }, { "title": "The rough endoplasmatic reticulum is a central nucleation site of siRNA-mediated RNA silencing.", "journal": "The EMBO journal", "date": "2013", "authors": "Stalder L, Heusermann W, Sokol L, Trojer D, Wirz J, Hean J, Fritzsche A, Aeschimann F, Pfanzagl V, Basselet P, Weiler J, Hintersteiner M, Morrissey DV, Meisner-Kober NC", "evidence": [ { "database": "Reactome", "id": "R-HSA-203927", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203927" } ], "reference": [ { "type": "PubMed", "id": "23511973", "url": "https://glygen.org/publication/PubMed/23511973" } ] }, { "title": "Multiple sensors ensure guide strand selection in human RNAi pathways.", "journal": "RNA (New York, N.Y.)", "date": "2013", "authors": "Noland CL, Doudna JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-203927", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203927" } ], "reference": [ { "type": "PubMed", "id": "23531496", "url": "https://glygen.org/publication/PubMed/23531496" } ] }, { "title": "Let-7c inhibits NSCLC cell proliferation by targeting HOXA1.", "journal": "Asian Pacific journal of cancer prevention : APJCP", "date": "2013", "authors": "Zhan M, Qu Q, Wang G, Liu YZ, Tan SL, Lou XY, Yu J, Zhou HH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "23534758", "url": "https://glygen.org/publication/PubMed/23534758" } ] }, { "title": "Building a super elongation complex for HIV.", "journal": "eLife", "date": "2013", "authors": "Hill CP, Sundquist WI", "evidence": [ { "database": "Reactome", "id": "R-HSA-167152", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-167152" } ], "reference": [ { "type": "PubMed", "id": "23538671", "url": "https://glygen.org/publication/PubMed/23538671" } ] }, { "title": "Substrate-specific structural rearrangements of human Dicer.", "journal": "Nature structural & molecular biology", "date": "2013", "authors": "Taylor DW, Ma E, Shigematsu H, Cianfrocco MA, Noland CL, Nagayama K, Nogales E, Doudna JA, Wang HW", "evidence": [ { "database": "Reactome", "id": "R-HSA-203927", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203927" } ], "reference": [ { "type": "PubMed", "id": "23624860", "url": "https://glygen.org/publication/PubMed/23624860" } ] }, { "title": "Identification of the transcription factor HOXB4 as a novel target of miR-23a.", "journal": "Genes, chromosomes & cancer", "date": "2013", "authors": "Koller K, Das S, Leuschner I, Korbelius M, Hoefler G, Guertl B", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "23630040", "url": "https://glygen.org/publication/PubMed/23630040" } ] }, { "title": "Differential roles of human Dicer-binding proteins TRBP and PACT in small RNA processing.", "journal": "Nucleic acids research", "date": "2013", "authors": "Lee HY, Zhou K, Smith AM, Noland CL, Doudna JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-203927", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203927" } ], "reference": [ { "type": "PubMed", "id": "23661684", "url": "https://glygen.org/publication/PubMed/23661684" } ] }, { "title": "KDM4B is a master regulator of the estrogen receptor signalling cascade.", "journal": "Nucleic acids research", "date": "2013", "authors": "Gaughan L, Stockley J, Coffey K, O'Neill D, Jones DL, Wade M, Wright J, Moore M, Tse S, Rogerson L, Robson CN", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23723241", "url": "https://glygen.org/publication/PubMed/23723241" } ] }, { "title": "Specificity factors in cytoplasmic polyadenylation.", "journal": "Wiley interdisciplinary reviews. RNA", "date": "2013", "authors": "Charlesworth A, Meijer HA, de Moor CH", "evidence": [ { "database": "Reactome", "id": "R-HSA-72203", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72203" } ], "reference": [ { "type": "PubMed", "id": "23776146", "url": "https://glygen.org/publication/PubMed/23776146" } ] }, { "title": "MicroRNA and piRNA profiles in normal human testis detected by next generation sequencing.", "journal": "PloS one", "date": "2013", "authors": "Yang Q, Hua J, Wang L, Xu B, Zhang H, Ye N, Zhang Z, Yu D, Cooke HJ, Zhang Y, Shi Q", "evidence": [ { "database": "Reactome", "id": "R-HSA-5601884", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5601884" } ], "reference": [ { "type": "PubMed", "id": "23826142", "url": "https://glygen.org/publication/PubMed/23826142" } ] }, { "title": "The double-stranded RNA binding domain of human Dicer functions as a nuclear localization signal.", "journal": "RNA (New York, N.Y.)", "date": "2013", "authors": "Doyle M, Badertscher L, Jaskiewicz L, Guttinger S, Jurado S, Hugenschmidt T, Kutay U, Filipowicz W", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "23882114", "url": "https://glygen.org/publication/PubMed/23882114" } ] }, { "title": "CXXC5 Associates with Smads to Mediate TNF-alpha Induced Apoptosis.", "journal": "Current molecular medicine", "date": "2013", "authors": "Wang X, Liao P, Fan X, Wan Y, Wang Y, Li Y, Jiang Z, Ye X, Mo X, Ocorr K, Deng Y, Wu X, Yuan W", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "23906331", "url": "https://glygen.org/publication/PubMed/23906331" } ] }, { "title": "Mammalian transcription-coupled excision repair.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2013", "authors": "Vermeulen W, Fousteri M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6781827", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6781827" } ], "reference": [ { "type": "PubMed", "id": "23906714", "url": "https://glygen.org/publication/PubMed/23906714" } ] }, { "title": "The little elongation complex functions at initiation and elongation phases of snRNA gene transcription.", "journal": "Molecular cell", "date": "2013", "authors": "Hu D, Smith ER, Garruss AS, Mohaghegh N, Varberg JM, Lin C, Jackson J, Gao X, Saraf A, Florens L, Washburn MP, Eissenberg JC, Shilatifard A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "23932780", "url": "https://glygen.org/publication/PubMed/23932780" } ] }, { "title": "Enhanced chromatin dynamics by FACT promotes transcriptional restart after UV-induced DNA damage.", "journal": "Molecular cell", "date": "2013", "authors": "Dinant C, Ampatziadis-Michailidis G, Lans H, Tresini M, Lagarou A, Grosbart M, Theil AF, van Cappellen WA, Kimura H, Bartek J, Fousteri M, Houtsmuller AB, Vermeulen W, Marteijn JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6781827", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6781827" } ], "reference": [ { "type": "PubMed", "id": "23973375", "url": "https://glygen.org/publication/PubMed/23973375" } ] }, { "title": "PIWI-interacting RNAs (piRNAs) - a mouse testis perspective.", "journal": "Biochemistry. Biokhimiia", "date": "2013", "authors": "Bortvin A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5601884", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5601884" } ], "reference": [ { "type": "PubMed", "id": "23980886", "url": "https://glygen.org/publication/PubMed/23980886" } ] }, { "title": "Ago1 Interacts with RNA polymerase II and binds to the promoters of actively transcribed genes in human cancer cells.", "journal": "PLoS genetics", "date": "2013", "authors": "Huang V, Zheng J, Qi Z, Wang J, Place RF, Yu J, Li H, Li LC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "24086155", "url": "https://glygen.org/publication/PubMed/24086155" } ] }, { "title": "Human snRNA genes use polyadenylation factors to promote efficient transcription termination.", "journal": "Nucleic acids research", "date": "2014", "authors": "O'Reilly D, Kuznetsova OV, Laitem C, Zaborowska J, Dienstbier M, Murphy S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "24097444", "url": "https://glygen.org/publication/PubMed/24097444" } ] }, { "title": "ELL, a novel TFIIH partner, is involved in transcription restart after DNA repair.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2013", "authors": "Mourgues S, Gautier V, Lagarou A, Bordier C, Mourcet A, Slingerland J, Kaddoum L, Coin F, Vermeulen W, Gonzales de Peredo A, Monsarrat B, Mari PO, Giglia-Mari G", "evidence": [ { "database": "Reactome", "id": "R-HSA-6781823", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6781823" } ], "reference": [ { "type": "PubMed", "id": "24127601", "url": "https://glygen.org/publication/PubMed/24127601" } ] }, { "title": "Increased RCAS1 expression is associated with advanced histopathological stage and poor prognosis in patients with gastric adenocarcinoma.", "journal": "Disease markers", "date": "2013", "authors": "Giaginis C, Efkarpidis T, Alexandrou P, Patsouris E, Kouraklis G, Theocharis S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24167369", "url": "https://glygen.org/publication/PubMed/24167369" } ] }, { "title": "Hox in motion: tracking HoxA cluster conformation during differentiation.", "journal": "Nucleic acids research", "date": "2014", "authors": "Rousseau M, Crutchley JL, Miura H, Suderman M, Blanchette M, Dostie J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "24174538", "url": "https://glygen.org/publication/PubMed/24174538" } ] }, { "title": "RNA catalyses nuclear pre-mRNA splicing.", "journal": "Nature", "date": "2013", "authors": "Fica SM, Tuttle N, Novak T, Li NS, Lu J, Koodathingal P, Dai Q, Staley JP, Piccirilli JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "24196718", "url": "https://glygen.org/publication/PubMed/24196718" } ] }, { "title": "CBC-ARS2 stimulates 3'-end maturation of multiple RNA families and favors cap-proximal processing.", "journal": "Nature structural & molecular biology", "date": "2013", "authors": "Hallais M, Pontvianne F, Andersen PR, Clerici M, Lener D, Benbahouche Nel H, Gostan T, Vandermoere F, Robert MC, Cusack S, Verheggen C, Jensen TH, Bertrand E", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "24270878", "url": "https://glygen.org/publication/PubMed/24270878" } ] }, { "title": "Identification of a novel component C2ORF3 in the lariat-intron complex: lack of C2ORF3 interferes with pre-mRNA splicing via intron turnover pathway.", "journal": "Genes to cells : devoted to molecular & cellular mechanisms", "date": "2014", "authors": "Yoshimoto R, Okawa K, Yoshida M, Ohno M, Kataoka N", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "24304693", "url": "https://glygen.org/publication/PubMed/24304693" } ] }, { "title": "MicroRNA-99 family members suppress Homeobox A1 expression in epithelial cells.", "journal": "PloS one", "date": "2013", "authors": "Chen D, Chen Z, Jin Y, Dragas D, Zhang L, Adjei BS, Wang A, Dai Y, Zhou X", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "24312487", "url": "https://glygen.org/publication/PubMed/24312487" } ] }, { "title": "A METTL3-METTL14 complex mediates mammalian nuclear RNA N6-adenosine methylation.", "journal": "Nature chemical biology", "date": "2014", "authors": "Liu J, Yue Y, Han D, Wang X, Fu Y, Zhang L, Jia G, Yu M, Lu Z, Deng X, Dai Q, Chen W, He C", "evidence": [ { "database": "Reactome", "id": "R-HSA-72203", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72203" } ], "reference": [ { "type": "PubMed", "id": "24316715", "url": "https://glygen.org/publication/PubMed/24316715" } ] }, { "title": "Cap-binding complex (CBC).", "journal": "The Biochemical journal", "date": "2014", "authors": "Gonatopoulos-Pournatzis T, Cowling VH", "evidence": [ { "database": "Reactome", "id": "R-HSA-167158", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-167158" } ], "reference": [ { "type": "PubMed", "id": "24354960", "url": "https://glygen.org/publication/PubMed/24354960" } ] }, { "title": "An H2A histone isotype regulates estrogen receptor target genes by mediating enhancer-promoter-3'-UTR interactions in breast cancer cells.", "journal": "Nucleic acids research", "date": "2014", "authors": "Su CH, Tzeng TY, Cheng C, Hsu MT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24371278", "url": "https://glygen.org/publication/PubMed/24371278" } ] }, { "title": "RNAi factors are present and active in human cell nuclei.", "journal": "Cell reports", "date": "2014", "authors": "Gagnon KT, Li L, Chu Y, Janowski BA, Corey DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "24388755", "url": "https://glygen.org/publication/PubMed/24388755" } ] }, { "title": "UvrD facilitates DNA repair by pulling RNA polymerase backwards.", "journal": "Nature", "date": "2014", "authors": "Epshtein V, Kamarthapu V, McGary K, Svetlov V, Ueberheide B, Proshkin S, Mironov A, Nudler E", "evidence": [ { "database": "Reactome", "id": "R-HSA-6782135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6782135" } ], "reference": [ { "type": "PubMed", "id": "24402227", "url": "https://glygen.org/publication/PubMed/24402227" } ] }, { "title": "Mammalian WTAP is a regulatory subunit of the RNA N6-methyladenosine methyltransferase.", "journal": "Cell research", "date": "2014", "authors": "Ping XL, Sun BF, Wang L, Xiao W, Yang X, Wang WJ, Adhikari S, Shi Y, Lv Y, Chen YS, Zhao X, Li A, Yang Y, Dahal U, Lou XM, Liu X, Huang J, Yuan WP, Zhu XF, Cheng T, Zhao YL, Wang X, Rendtlew Danielsen JM, Liu F, Yang YG", "evidence": [ { "database": "Reactome", "id": "R-HSA-72203", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72203" } ], "reference": [ { "type": "PubMed", "id": "24407421", "url": "https://glygen.org/publication/PubMed/24407421" } ] }, { "title": "Mass spectrometry-based relative quantification of proteins in precatalytic and catalytically active spliceosomes by metabolic labeling (SILAC), chemical labeling (iTRAQ), and label-free spectral count.", "journal": "RNA (New York, N.Y.)", "date": "2014", "authors": "Schmidt C, Gronborg M, Deckert J, Bessonov S, Conrad T, Luhrmann R, Urlaub H", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "24448447", "url": "https://glygen.org/publication/PubMed/24448447" } ] }, { "title": "ATP activates transcription initiation from promoters by RNA polymerase II in a reversible step prior to RNA synthesis.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Conaway RC, Conaway JW", "evidence": [ { "database": "Reactome", "id": "R-HSA-167172", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-167172" } ], "reference": [ { "type": "PubMed", "id": "2449431", "url": "https://glygen.org/publication/PubMed/2449431" } ] }, { "title": "Ovarian cancer-associated mutations disable catalytic activity of CDK12, a kinase that promotes homologous recombination repair and resistance to cisplatin and poly(ADP-ribose) polymerase inhibitors.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Joshi PM, Sutor SL, Huntoon CJ, Karnitz LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6796648", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6796648" } ], "reference": [ { "type": "PubMed", "id": "24554720", "url": "https://glygen.org/publication/PubMed/24554720" } ] }, { "title": "miR-100 induces epithelial-mesenchymal transition but suppresses tumorigenesis, migration and invasion.", "journal": "PLoS genetics", "date": "2014", "authors": "Chen D, Sun Y, Yuan Y, Han Z, Zhang P, Zhang J, You MJ, Teruya-Feldstein J, Wang M, Gupta S, Hung MC, Liang H, Ma L", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "24586203", "url": "https://glygen.org/publication/PubMed/24586203" } ] }, { "title": "Importin 8 regulates the transport of mature microRNAs into the cell nucleus.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Wei Y, Li L, Wang D, Zhang CY, Zen K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "24596094", "url": "https://glygen.org/publication/PubMed/24596094" } ] }, { "title": "piClust: a density based piRNA clustering algorithm.", "journal": "Computational biology and chemistry", "date": "2014", "authors": "Jung I, Park JC, Kim S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5601884", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5601884" } ], "reference": [ { "type": "PubMed", "id": "24656595", "url": "https://glygen.org/publication/PubMed/24656595" } ] }, { "title": "The structure and substrate specificity of human Cdk12/Cyclin K.", "journal": "Nature communications", "date": "2014", "authors": "Bosken CA, Farnung L, Hintermair C, Merzel Schachter M, Vogel-Bachmayr K, Blazek D, Anand K, Fisher RP, Eick D, Geyer M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6796648", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6796648" } ], "reference": [ { "type": "PubMed", "id": "24662513", "url": "https://glygen.org/publication/PubMed/24662513" } ] }, { "title": "Identification of miR-26 as a key mediator of estrogen stimulated cell proliferation by targeting CHD1, GREB1 and KPNA2.", "journal": "Breast cancer research : BCR", "date": "2014", "authors": "Tan S, Ding K, Li R, Zhang W, Li G, Kong X, Qian P, Lobie PE, Zhu T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24735615", "url": "https://glygen.org/publication/PubMed/24735615" } ] }, { "title": "A missense mutation in the splicing factor gene DHX38 is associated with early-onset retinitis pigmentosa with macular coloboma.", "journal": "Journal of medical genetics", "date": "2014", "authors": "Ajmal M, Khan MI, Neveling K, Khan YM, Azam M, Waheed NK, Hamel CP, Ben-Yosef T, De Baere E, Koenekoop RK, Collin RW, Qamar R, Cremers FP", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "24737827", "url": "https://glygen.org/publication/PubMed/24737827" } ] }, { "title": "Cohesin in cancer: chromosome segregation and beyond.", "journal": "Nature reviews. Cancer", "date": "2014", "authors": "Losada A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24854081", "url": "https://glygen.org/publication/PubMed/24854081" } ] }, { "title": "Apoptotic function of tumor-associated antigen RCAS1 in oral squamous cell carcinoma.", "journal": "Journal of translational medicine", "date": "2014", "authors": "Tanaka H, Toyoshima T, Sonoda K, Kitamura R, Sasaguri M, Kawano S, Matsubara R, Goto Y, Nakamura S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24885040", "url": "https://glygen.org/publication/PubMed/24885040" } ] }, { "title": "Structural and functional analysis of the human spliceosomal DEAD-box helicase Prp28.", "journal": "Acta crystallographica. Section D, Biological crystallography", "date": "2014", "authors": "Mohlmann S, Mathew R, Neumann P, Schmitt A, Luhrmann R, Ficner R", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "24914973", "url": "https://glygen.org/publication/PubMed/24914973" } ] }, { "title": "A functional interplay between ZNF217 and estrogen receptor alpha exists in luminal breast cancers.", "journal": "Molecular oncology", "date": "2014", "authors": "Nguyen NT, Vendrell JA, Poulard C, Gyorffy B, Goddard-Leon S, Bieche I, Corbo L, Le Romancer M, Bachelot T, Treilleux I, Cohen PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24973012", "url": "https://glygen.org/publication/PubMed/24973012" } ] }, { "title": "Perturbation of m6A writers reveals two distinct classes of mRNA methylation at internal and 5' sites.", "journal": "Cell reports", "date": "2014", "authors": "Schwartz S, Mumbach MR, Jovanovic M, Wang T, Maciag K, Bushkin GG, Mertins P, Ter-Ovanesyan D, Habib N, Cacchiarelli D, Sanjana NE, Freinkman E, Pacold ME, Satija R, Mikkelsen TS, Hacohen N, Zhang F, Carr SA, Lander ES, Regev A", "evidence": [ { "database": "Reactome", "id": "R-HSA-72203", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72203" } ], "reference": [ { "type": "PubMed", "id": "24981863", "url": "https://glygen.org/publication/PubMed/24981863" } ] }, { "title": "RPRD1A and RPRD1B are human RNA polymerase II C-terminal domain scaffolds for Ser5 dephosphorylation.", "journal": "Nature structural & molecular biology", "date": "2014", "authors": "Ni Z, Xu C, Guo X, Hunter GO, Kuznetsova OV, Tempel W, Marcon E, Zhong G, Guo H, Kuo WW, Li J, Young P, Olsen JB, Wan C, Loppnau P, El Bakkouri M, Senisterra GA, He H, Huang H, Sidhu SS, Emili A, Murphy S, Mosley AL, Arrowsmith CH, Min J, Greenblatt JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "24997600", "url": "https://glygen.org/publication/PubMed/24997600" } ] }, { "title": "Consideration of GREB1 as a potential therapeutic target for hormone-responsive or endocrine-resistant cancers.", "journal": "Expert opinion on therapeutic targets", "date": "2014", "authors": "Hodgkinson KM, Vanderhyden BC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "24998469", "url": "https://glygen.org/publication/PubMed/24998469" } ] }, { "title": "KDM6 demethylase independent loss of histone H3 lysine 27 trimethylation during early embryonic development.", "journal": "PLoS genetics", "date": "2014", "authors": "Shpargel KB, Starmer J, Yee D, Pohlers M, Magnuson T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "25101834", "url": "https://glygen.org/publication/PubMed/25101834" } ] }, { "title": "CTCF controls HOXA cluster silencing and mediates PRC2-repressive higher-order chromatin structure in NT2/D1 cells.", "journal": "Molecular and cellular biology", "date": "2014", "authors": "Xu M, Zhao GN, Lv X, Liu G, Wang LY, Hao DL, Wang J, Liu DP, Liang CC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "25135475", "url": "https://glygen.org/publication/PubMed/25135475" } ] }, { "title": "Sequential and ordered assembly of a large DNA repair complex on undamaged chromatin.", "journal": "The Journal of cell biology", "date": "2014", "authors": "Ziani S, Nagy Z, Alekseev S, Soutoglou E, Egly JM, Coin F", "evidence": [ { "database": "Reactome", "id": "R-HSA-6781823", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6781823" } ], "reference": [ { "type": "PubMed", "id": "25154395", "url": "https://glygen.org/publication/PubMed/25154395" } ] }, { "title": "In vitro reconstitution of snRNPs: a reconstituted U4/U6 snRNP participates in splicing complex formation.", "journal": "Genes & development", "date": "1989", "authors": "Pikielny CW, Bindereif A, Green MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-72165", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72165" } ], "reference": [ { "type": "PubMed", "id": "2524422", "url": "https://glygen.org/publication/PubMed/2524422" } ] }, { "title": "Serum receptor-binding cancer antigen expressed on SiSo cells (RCAS1) as a diagnostic and prognostic marker for non-small cell lung cancer.", "journal": "Tumori", "date": "2014", "authors": "Xu C, Yu LK, Zhang X", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25296600", "url": "https://glygen.org/publication/PubMed/25296600" } ] }, { "title": "Argonaute-1 binds transcriptional enhancers and controls constitutive and alternative splicing in human cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2014", "authors": "Allo M, Agirre E, Bessonov S, Bertucci P, Gomez Acuna L, Buggiano V, Bellora N, Singh B, Petrillo E, Blaustein M, Minana B, Dujardin G, Pozzi B, Pelisch F, Bechara E, Agafonov DE, Srebrow A, Luhrmann R, Valcarcel J, Eyras E, Kornblihtt AR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "25313066", "url": "https://glygen.org/publication/PubMed/25313066" } ] }, { "title": "Global identification of target recognition and cleavage by the Microprocessor in human ES cells.", "journal": "Nucleic acids research", "date": "2014", "authors": "Seong Y, Lim DH, Kim A, Seo JH, Lee YS, Song H, Kwon YS", "evidence": [ { "database": "Reactome", "id": "R-HSA-203927", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203927" } ], "reference": [ { "type": "PubMed", "id": "25326327", "url": "https://glygen.org/publication/PubMed/25326327" } ] }, { "title": "EBAG9 modulates host immune defense against tumor formation and metastasis by regulating cytotoxic activity of T lymphocytes.", "journal": "Oncogenesis", "date": "2014", "authors": "Miyazaki T, Ikeda K, Horie-Inoue K, Kondo T, Takahashi S, Inoue S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25365482", "url": "https://glygen.org/publication/PubMed/25365482" } ] }, { "title": "Expression, purification, and identification of associated proteins of the full-length hCDK12/CyclinK complex.", "journal": "The Journal of biological chemistry", "date": "2015", "authors": "Bartkowiak B, Greenleaf AL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6796648", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6796648" } ], "reference": [ { "type": "PubMed", "id": "25429106", "url": "https://glygen.org/publication/PubMed/25429106" } ] }, { "title": "CXXC5 regulates differentiation of C2C12 myoblasts into myocytes.", "journal": "Journal of muscle research and cell motility", "date": "2014", "authors": "Li G, Ye X, Peng X, Deng Y, Yuan W, Li Y, Mo X, Wang X, Wan Y, Liu X, Chen T, Jiang Z, Fan X, Wu X, Wang Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25433557", "url": "https://glygen.org/publication/PubMed/25433557" } ] }, { "title": "Transcription-coupled nucleotide excision repair factors promote R-loop-induced genome instability.", "journal": "Molecular cell", "date": "2014", "authors": "Sollier J, Stork CT, Garcia-Rubio ML, Paulsen RD, Aguilera A, Cimprich KA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6781823", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6781823" } ], "reference": [ { "type": "PubMed", "id": "25435140", "url": "https://glygen.org/publication/PubMed/25435140" } ] }, { "title": "Cohesin modulates transcription of estrogen-responsive genes.", "journal": "Biochimica et biophysica acta", "date": "2015", "authors": "Antony J, Dasgupta T, Rhodes JM, McEwan MV, Print CG, O'Sullivan JM, Horsfield JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25542856", "url": "https://glygen.org/publication/PubMed/25542856" } ] }, { "title": "Crystal structure of human U1 snRNP, a small nuclear ribonucleoprotein particle, reveals the mechanism of 5' splice site recognition.", "journal": "eLife", "date": "2015", "authors": "Kondo Y, Oubridge C, van Roon AM, Nagai K", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "25555158", "url": "https://glygen.org/publication/PubMed/25555158" } ] }, { "title": "Characterization of human cyclin-dependent kinase 12 (CDK12) and CDK13 complexes in C-terminal domain phosphorylation, gene transcription, and RNA processing.", "journal": "Molecular and cellular biology", "date": "2015", "authors": "Liang K, Gao X, Gilmore JM, Florens L, Washburn MP, Smith E, Shilatifard A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6796648", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6796648" } ], "reference": [ { "type": "PubMed", "id": "25561469", "url": "https://glygen.org/publication/PubMed/25561469" } ] }, { "title": "In vivo, Argonaute-bound microRNAs exist predominantly in a reservoir of low molecular weight complexes not associated with mRNA.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2015", "authors": "La Rocca G, Olejniczak SH, Gonzalez AJ, Briskin D, Vidigal JA, Spraggon L, DeMatteo RG, Radler MR, Lindsten T, Ventura A, Tuschl T, Leslie CS, Thompson CB", "evidence": [ { "database": "Reactome", "id": "R-HSA-203927", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203927" } ], "reference": [ { "type": "PubMed", "id": "25568082", "url": "https://glygen.org/publication/PubMed/25568082" } ] }, { "title": "Mammalian pre-mRNA branch site selection by U2 snRNP involves base pairing.", "journal": "Genes & development", "date": "1989", "authors": "Wu J, Manley JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "2558966", "url": "https://glygen.org/publication/PubMed/2558966" } ] }, { "title": "Alternative lengthening of telomeres renders cancer cells hypersensitive to ATR inhibitors.", "journal": "Science (New York, N.Y.)", "date": "2015", "authors": "Flynn RL, Cox KE, Jeitany M, Wakimoto H, Bryll AR, Ganem NJ, Bersani F, Pineda JR, Suva ML, Benes CH, Haber DA, Boussin FD, Zou L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9670095", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9670095" } ], "reference": [ { "type": "PubMed", "id": "25593184", "url": "https://glygen.org/publication/PubMed/25593184" } ] }, { "title": "CXXC5 is a negative-feedback regulator of the Wnt/beta-catenin pathway involved in osteoblast differentiation.", "journal": "Cell death and differentiation", "date": "2015", "authors": "Kim HY, Yoon JY, Yun JH, Cho KW, Lee SH, Rhee YM, Jung HS, Lim HJ, Lee H, Choi J, Heo JN, Lee W, No KT, Min D, Choi KY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25633194", "url": "https://glygen.org/publication/PubMed/25633194" } ] }, { "title": "Two Faces of Cathepsin D: Physiological Guardian Angel and Pathological Demon.", "journal": "Biology and medicine (Aligarh)", "date": "2014", "authors": "Khalkhali-Ellis Z, Hendrix MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25663755", "url": "https://glygen.org/publication/PubMed/25663755" } ] }, { "title": "Expression of RCAS1 correlates with urothelial bladder cancer malignancy.", "journal": "International journal of molecular sciences", "date": "2015", "authors": "Jozwicki W, Brozyna AA, Siekiera J, Slominski AT", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25674852", "url": "https://glygen.org/publication/PubMed/25674852" } ] }, { "title": "The Integrator complex controls the termination of transcription at diverse classes of gene targets.", "journal": "Cell research", "date": "2015", "authors": "Skaar JR, Ferris AL, Wu X, Saraf A, Khanna KK, Florens L, Washburn MP, Hughes SH, Pagano M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "25675981", "url": "https://glygen.org/publication/PubMed/25675981" } ] }, { "title": "Differential expression of human HOX-2 genes along the anterior-posterior axis in embryonic central nervous system.", "journal": "Differentiation; research in biological diversity", "date": "1989", "authors": "Giampaolo A, Acampora D, Zappavigna V, Pannese M, D'Esposito M, Care A, Faiella A, Stornaiuolo A, Russo G, Simeone A, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "2570724", "url": "https://glygen.org/publication/PubMed/2570724" } ] }, { "title": "Ovarian carcinoma CDK12 mutations misregulate expression of DNA repair genes via deficient formation and function of the Cdk12/CycK complex.", "journal": "Nucleic acids research", "date": "2015", "authors": "Ekumi KM, Paculova H, Lenasi T, Pospichalova V, Bosken CA, Rybarikova J, Bryja V, Geyer M, Blazek D, Barboric M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6796648", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6796648" } ], "reference": [ { "type": "PubMed", "id": "25712099", "url": "https://glygen.org/publication/PubMed/25712099" } ] }, { "title": "Structure of a biologically active estrogen receptor-coactivator complex on DNA.", "journal": "Molecular cell", "date": "2015", "authors": "Yi P, Wang Z, Feng Q, Pintilie GD, Foulds CE, Lanz RB, Ludtke SJ, Schmid MF, Chiu W, O'Malley BW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "25728767", "url": "https://glygen.org/publication/PubMed/25728767" } ] }, { "title": "DICER-ARGONAUTE2 complex in continuous fluorogenic assays of RNA interference enzymes.", "journal": "PloS one", "date": "2015", "authors": "Bernard MA, Wang L, Tachado SD", "evidence": [ { "database": "Reactome", "id": "R-HSA-203927", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203927" } ], "reference": [ { "type": "PubMed", "id": "25793518", "url": "https://glygen.org/publication/PubMed/25793518" } ] }, { "title": "Structure, function and evolution of topologically associating domains (TADs) at HOX loci.", "journal": "FEBS letters", "date": "2015", "authors": "Lonfat N, Duboule D", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "25913784", "url": "https://glygen.org/publication/PubMed/25913784" } ] }, { "title": "Genetic Inactivation of ATRX Leads to a Decrease in the Amount of Telomeric Cohesin and Level of Telomere Transcription in Human Glioma Cells.", "journal": "Molecular and cellular biology", "date": "2015", "authors": "Eid R, Demattei MV, Episkopou H, Auge-Gouillou C, Decottignies A, Grandin N, Charbonneau M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9670095", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9670095" } ], "reference": [ { "type": "PubMed", "id": "26055325", "url": "https://glygen.org/publication/PubMed/26055325" } ] }, { "title": "The Dishevelled-binding protein CXXC5 negatively regulates cutaneous wound healing.", "journal": "The Journal of experimental medicine", "date": "2015", "authors": "Lee SH, Kim MY, Kim HY, Lee YM, Kim H, Nam KA, Roh MR, Min do S, Chung KY, Choi KY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "26056233", "url": "https://glygen.org/publication/PubMed/26056233" } ] }, { "title": "Progesterone receptor modulates ERalpha action in breast cancer.", "journal": "Nature", "date": "2015", "authors": "Mohammed H, Russell IA, Stark R, Rueda OM, Hickey TE, Tarulli GA, Serandour AA, Birrell SN, Bruna A, Saadi A, Menon S, Hadfield J, Pugh M, Raj GV, Brown GD, D'Santos C, Robinson JL, Silva G, Launchbury R, Perou CM, Stingl J, Caldas C, Tilley WD, Carroll JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "26153859", "url": "https://glygen.org/publication/PubMed/26153859" } ] }, { "title": "MiR-26b/KPNA2 axis inhibits epithelial ovarian carcinoma proliferation and metastasis through downregulating OCT4.", "journal": "Oncotarget", "date": "2015", "authors": "Lin J, Zhang L, Huang H, Huang Y, Huang L, Wang J, Huang S, He L, Zhou Y, Jia W, Yun J, Luo R, Zheng M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "26204489", "url": "https://glygen.org/publication/PubMed/26204489" } ] }, { "title": "Stable tri-snRNP integration is accompanied by a major structural rearrangement of the spliceosome that is dependent on Prp8 interaction with the 5' splice site.", "journal": "RNA (New York, N.Y.)", "date": "2015", "authors": "Boesler C, Rigo N, Agafonov DE, Kastner B, Urlaub H, Will CL, Luhrmann R", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "26385511", "url": "https://glygen.org/publication/PubMed/26385511" } ] }, { "title": "Mammalian splicing factor SF1 interacts with SURP domains of U2 snRNP-associated proteins.", "journal": "Nucleic acids research", "date": "2015", "authors": "Crisci A, Raleff F, Bagdiul I, Raabe M, Urlaub H, Rain JC, Kramer A", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "26420826", "url": "https://glygen.org/publication/PubMed/26420826" } ] }, { "title": "CXXC5 plays a role as a transcription activator for myelin genes on oligodendrocyte differentiation.", "journal": "Glia", "date": "2016", "authors": "Kim MY, Kim HY, Hong J, Kim D, Lee H, Cheong E, Lee Y, Roth J, Kim DG, Min do S, Choi KY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "26462610", "url": "https://glygen.org/publication/PubMed/26462610" } ] }, { "title": "Trefoil factor family peptides--friends or foes?", "journal": "Biomolecular concepts", "date": "2015", "authors": "Busch M, Dunker N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "26479350", "url": "https://glygen.org/publication/PubMed/26479350" } ] }, { "title": "RNA polymerase II-associated factor 1 regulates the release and phosphorylation of paused RNA polymerase II.", "journal": "Science (New York, N.Y.)", "date": "2015", "authors": "Yu M, Yang W, Ni T, Tang Z, Nakadai T, Zhu J, Roeder RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-112382", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-112382" } ], "reference": [ { "type": "PubMed", "id": "26659056", "url": "https://glygen.org/publication/PubMed/26659056" } ] }, { "title": "Noncanonical registers and base pairs in human 5' splice-site selection.", "journal": "Nucleic acids research", "date": "2016", "authors": "Tan J, Ho JX, Zhong Z, Luo S, Chen G, Roca X", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "26969736", "url": "https://glygen.org/publication/PubMed/26969736" } ] }, { "title": "Steroid Receptors Reprogram FoxA1 Occupancy through Dynamic Chromatin Transitions.", "journal": "Cell", "date": "2016", "authors": "Swinstead EE, Miranda TB, Paakinaho V, Baek S, Goldstein I, Hawkins M, Karpova TS, Ball D, Mazza D, Lavis LD, Grimm JB, Morisaki T, Grontved L, Presman DM, Hager GL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "27062924", "url": "https://glygen.org/publication/PubMed/27062924" } ] }, { "title": "A spliceosome intermediate with loosely associated tri-snRNP accumulates in the absence of Prp28 ATPase activity.", "journal": "Nature communications", "date": "2016", "authors": "Boesler C, Rigo N, Anokhina MM, Tauchert MJ, Agafonov DE, Kastner B, Urlaub H, Ficner R, Will CL, Luhrmann R", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "27377154", "url": "https://glygen.org/publication/PubMed/27377154" } ] }, { "title": "Cryo-EM structure of the spliceosome immediately after branching.", "journal": "Nature", "date": "2016", "authors": "Galej WP, Wilkinson ME, Fica SM, Oubridge C, Newman AJ, Nagai K", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "27459055", "url": "https://glygen.org/publication/PubMed/27459055" } ] }, { "title": "U6atac snRNA stem-loop interacts with U12 p65 RNA binding protein and is functionally interchangeable with the U12 apical stem-loop III.", "journal": "Scientific reports", "date": "2016", "authors": "Singh J, Sikand K, Conrad H, Will CL, Komar AA, Shukla GC", "evidence": [ { "database": "Reactome", "id": "R-HSA-72165", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72165" } ], "reference": [ { "type": "PubMed", "id": "27510544", "url": "https://glygen.org/publication/PubMed/27510544" } ] }, { "title": "Stoichiometries of U2AF35, U2AF65 and U2 snRNP reveal new early spliceosome assembly pathways.", "journal": "Nucleic acids research", "date": "2017", "authors": "Chen L, Weinmeister R, Kralovicova J, Eperon LP, Vorechovsky I, Hudson AJ, Eperon IC", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "27683217", "url": "https://glygen.org/publication/PubMed/27683217" } ] }, { "title": "Estradiol-Estrogen Receptor alpha Mediates the Expression of the CXXC5 Gene through the Estrogen Response Element-Dependent Signaling Pathway.", "journal": "Scientific reports", "date": "2016", "authors": "Yasar P, Ayaz G, Muyan M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "27886276", "url": "https://glygen.org/publication/PubMed/27886276" } ] }, { "title": "Human cactin interacts with DHX8 and SRRM2 to assure efficient pre-mRNA splicing and sister chromatid cohesion.", "journal": "Journal of cell science", "date": "2017", "authors": "Zanini IM, Soneson C, Lorenzi LE, Azzalin CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "28062851", "url": "https://glygen.org/publication/PubMed/28062851" } ] }, { "title": "Cryo-EM structure of a human spliceosome activated for step 2 of splicing.", "journal": "Nature", "date": "2017", "authors": "Bertram K, Agafonov DE, Liu WT, Dybkov O, Will CL, Hartmuth K, Urlaub H, Kastner B, Stark H, Luhrmann R", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "28076346", "url": "https://glygen.org/publication/PubMed/28076346" } ] }, { "title": "Anti-termination of transcription within the long terminal repeat of HIV-1 by tat gene product.", "journal": "Nature", "date": "1987", "authors": "Kao SY, Calman AF, Luciw PA, Peterlin BM", "evidence": [ { "database": "Reactome", "id": "R-HSA-167242", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-167242" } ], "reference": [ { "type": "PubMed", "id": "2825027", "url": "https://glygen.org/publication/PubMed/2825027" } ] }, { "title": "Mutually Exclusive CBC-Containing Complexes Contribute to RNA Fate.", "journal": "Cell reports", "date": "2017", "authors": "Giacometti S, Benbahouche NEH, Domanski M, Robert MC, Meola N, Lubas M, Bukenborg J, Andersen JS, Schulze WM, Verheggen C, Kudla G, Jensen TH, Bertrand E", "evidence": [ { "database": "Reactome", "id": "R-HSA-72086", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72086" } ], "reference": [ { "type": "PubMed", "id": "28297668", "url": "https://glygen.org/publication/PubMed/28297668" } ] }, { "title": "An Atomic Structure of the Human Spliceosome.", "journal": "Cell", "date": "2017", "authors": "Zhang X, Yan C, Hang J, Finci LI, Lei J, Shi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "28502770", "url": "https://glygen.org/publication/PubMed/28502770" } ] }, { "title": "Membrane and Nuclear Estrogen Receptor Alpha Actions: From Tissue Specificity to Medical Implications.", "journal": "Physiological reviews", "date": "2017", "authors": "Arnal JF, Lenfant F, Metivier R, Flouriot G, Henrion D, Adlanmerini M, Fontaine C, Gourdy P, Chambon P, Katzenellenbogen B, Katzenellenbogen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "28539435", "url": "https://glygen.org/publication/PubMed/28539435" } ] }, { "title": "Cryo-EM Structure of a Pre-catalytic Human Spliceosome Primed for Activation.", "journal": "Cell", "date": "2017", "authors": "Bertram K, Agafonov DE, Dybkov O, Haselbach D, Leelaram MN, Will CL, Urlaub H, Kastner B, Luhrmann R, Stark H", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "28781166", "url": "https://glygen.org/publication/PubMed/28781166" } ] }, { "title": "Estrogen-responsive element of the human pS2 gene is an imperfectly palindromic sequence.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1989", "authors": "Berry M, Nunez AM, Chambon P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "2919170", "url": "https://glygen.org/publication/PubMed/2919170" } ] }, { "title": "Structure of a human catalytic step I spliceosome.", "journal": "Science (New York, N.Y.)", "date": "2018", "authors": "Zhan X, Yan C, Zhang X, Lei J, Shi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "29301961", "url": "https://glygen.org/publication/PubMed/29301961" } ] }, { "title": "Structure of the human activated spliceosome in three conformational states.", "journal": "Cell research", "date": "2018", "authors": "Zhang X, Yan C, Zhan X, Li L, Lei J, Shi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "29360106", "url": "https://glygen.org/publication/PubMed/29360106" } ] }, { "title": "Structure and Conformational Dynamics of the Human Spliceosomal B(act) Complex.", "journal": "Cell", "date": "2018", "authors": "Haselbach D, Komarov I, Agafonov DE, Hartmuth K, Graf B, Dybkov O, Urlaub H, Kastner B, Luhrmann R, Stark H", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "29361316", "url": "https://glygen.org/publication/PubMed/29361316" } ] }, { "title": "Cap trimethylation of U snRNA is cytoplasmic and dependent on U snRNP protein binding.", "journal": "Cell", "date": "1986", "authors": "Mattaj IW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "2944599", "url": "https://glygen.org/publication/PubMed/2944599" } ] }, { "title": "Spliceosome assembly involves the binding and release of U4 small nuclear ribonucleoprotein.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1988", "authors": "Lamond AI, Konarska MM, Grabowski PJ, Sharp PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "2963332", "url": "https://glygen.org/publication/PubMed/2963332" } ] }, { "title": "Structures of the human pre-catalytic spliceosome and its precursor spliceosome.", "journal": "Cell research", "date": "2018", "authors": "Zhan X, Yan C, Zhang X, Lei J, Shi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "30315277", "url": "https://glygen.org/publication/PubMed/30315277" } ] }, { "title": "Transcriptional regulation of c-myc oncogene expression by estrogen in hormone-responsive human breast cancer cells.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Dubik D, Shiu RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "3045126", "url": "https://glygen.org/publication/PubMed/3045126" } ] }, { "title": "A human postcatalytic spliceosome structure reveals essential roles of metazoan factors for exon ligation.", "journal": "Science (New York, N.Y.)", "date": "2019", "authors": "Fica SM, Oubridge C, Wilkinson ME, Newman AJ, Nagai K", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "30705154", "url": "https://glygen.org/publication/PubMed/30705154" } ] }, { "title": "Structures of the human spliceosomes before and after release of the ligated exon.", "journal": "Cell research", "date": "2019", "authors": "Zhang X, Zhan X, Yan C, Zhang W, Liu D, Lei J, Shi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "30728453", "url": "https://glygen.org/publication/PubMed/30728453" } ] }, { "title": "Structural Insights into Nuclear pre-mRNA Splicing in Higher Eukaryotes.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2019", "authors": "Kastner B, Will CL, Stark H, Luhrmann R", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "30765414", "url": "https://glygen.org/publication/PubMed/30765414" } ] }, { "title": "Mechanism of 5' splice site transfer for human spliceosome activation.", "journal": "Science (New York, N.Y.)", "date": "2019", "authors": "Charenton C, Wilkinson ME, Nagai K", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "30975767", "url": "https://glygen.org/publication/PubMed/30975767" } ] }, { "title": "Structural and functional characterisation of human RNA helicase DHX8 provides insights into the mechanism of RNA-stimulated ADP release.", "journal": "The Biochemical journal", "date": "2019", "authors": "Felisberto-Rodrigues C, Thomas JC, McAndrew C, Le Bihan YV, Burke R, Workman P, van Montfort RLM", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "31409651", "url": "https://glygen.org/publication/PubMed/31409651" } ] }, { "title": "Structural basis for DEAH-helicase activation by G-patch proteins.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2020", "authors": "Studer MK, Ivanovic L, Weber ME, Marti S, Jonas S", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "32179686", "url": "https://glygen.org/publication/PubMed/32179686" } ] }, { "title": "Structural and functional insights into CWC27/CWC22 heterodimer linking the exon junction complex to spliceosomes.", "journal": "Nucleic acids research", "date": "2020", "authors": "Busetto V, Barbosa I, Basquin J, Marquenet E, Hocq R, Hennion M, Paternina JA, Namane A, Conti E, Bensaude O, Le Hir H", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "32329775", "url": "https://glygen.org/publication/PubMed/32329775" } ] }, { "title": "Molecular architecture of the human 17S U2 snRNP.", "journal": "Nature", "date": "2020", "authors": "Zhang Z, Will CL, Bertram K, Dybkov O, Hartmuth K, Agafonov DE, Hofele R, Urlaub H, Kastner B, Luhrmann R, Stark H", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "32494006", "url": "https://glygen.org/publication/PubMed/32494006" } ] }, { "title": "A transcriptional arrest mechanism involved in controlling constitutive levels of mouse c-myb mRNA.", "journal": "Oncogene", "date": "1988", "authors": "Watson RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "3281094", "url": "https://glygen.org/publication/PubMed/3281094" } ] }, { "title": "Mechanism of protein-guided folding of the active site U2/U6 RNA during spliceosome activation.", "journal": "Science (New York, N.Y.)", "date": "2020", "authors": "Townsend C, Leelaram MN, Agafonov DE, Dybkov O, Will CL, Bertram K, Urlaub H, Kastner B, Stark H, Luhrmann R", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "33243851", "url": "https://glygen.org/publication/PubMed/33243851" } ] }, { "title": "Structure of a transcribing RNA polymerase II-U1 snRNP complex.", "journal": "Science (New York, N.Y.)", "date": "2021", "authors": "Zhang S, Aibara S, Vos SM, Agafonov DE, Luhrmann R, Cramer P", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "33446560", "url": "https://glygen.org/publication/PubMed/33446560" } ] }, { "title": "Structural basis of intron selection by U2 snRNP in the presence of covalent inhibitors.", "journal": "Nature communications", "date": "2021", "authors": "Cretu C, Gee P, Liu X, Agrawal A, Nguyen TV, Ghosh AK, Cook A, Jurica M, Larsen NA, Pena V", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "34301950", "url": "https://glygen.org/publication/PubMed/34301950" } ] }, { "title": "Structural basis of branch site recognition by the human spliceosome.", "journal": "Science (New York, N.Y.)", "date": "2022", "authors": "Tholen J, Razew M, Weis F, Galej WP", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "34822310", "url": "https://glygen.org/publication/PubMed/34822310" } ] }, { "title": "Differential expression of c-myb mRNA in murine B lymphomas by a block to transcription elongation.", "journal": "Science (New York, N.Y.)", "date": "1987", "authors": "Bender TP, Thompson CB, Kuehl WM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "3498214", "url": "https://glygen.org/publication/PubMed/3498214" } ] }, { "title": "Retinitis pigmentosa-linked mutation in DHX38 modulates its splicing activity.", "journal": "PloS one", "date": "2022", "authors": "Obuca M, Cvackova Z, Kubovciak J, Kolar M, Stanek D", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "35385551", "url": "https://glygen.org/publication/PubMed/35385551" } ] }, { "title": "Stimulation of c-myc oncogene expression associated with estrogen-induced proliferation of human breast cancer cells.", "journal": "Cancer research", "date": "1987", "authors": "Dubik D, Dembinski TC, Shiu RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "3677090", "url": "https://glygen.org/publication/PubMed/3677090" } ] }, { "title": "A compensatory base change in U1 snRNA suppresses a 5' splice site mutation.", "journal": "Cell", "date": "1986", "authors": "Zhuang Y, Weiner AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "3757028", "url": "https://glygen.org/publication/PubMed/3757028" } ] }, { "title": "A unique cap(m7GpppXm)-dependent influenza virion endonuclease cleaves capped RNAs to generate the primers that initiate viral RNA transcription.", "journal": "Cell", "date": "1981", "authors": "Plotch SJ, Bouloy M, Ulmanen I, Krug RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-168325", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168325" } ], "reference": [ { "type": "PubMed", "id": "6261960", "url": "https://glygen.org/publication/PubMed/6261960" } ] }, { "title": "Mechanism of RNA polymerase II--specific initiation of transcription in vitro: ATP requirement and uncapped runoff transcripts.", "journal": "Cell", "date": "1982", "authors": "Bunick D, Zandomeni R, Ackerman S, Weinmann R", "evidence": [ { "database": "Reactome", "id": "R-HSA-167161", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-167161" } ], "reference": [ { "type": "PubMed", "id": "7151173", "url": "https://glygen.org/publication/PubMed/7151173" } ] }, { "title": "Retinoic acid induces three newly cloned HOXA1 transcripts in MCF7 breast cancer cells.", "journal": "Biochemical and biophysical research communications", "date": "1995", "authors": "Chariot A, Moreau L, Senterre G, Sobel ME, Castronovo V", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "7488013", "url": "https://glygen.org/publication/PubMed/7488013" } ] }, { "title": "Up-regulation of HOXC6, HOXD1, and HOXD8 homeobox gene expression in human neuroblastoma cells following chemical induction of differentiation.", "journal": "Tumour biology : the journal of the International Society for Oncodevelopmental Biology and Medicine", "date": "1996", "authors": "Manohar CF, Salwen HR, Furtado MR, Cohn SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "7501971", "url": "https://glygen.org/publication/PubMed/7501971" } ] }, { "title": "Transforming p21ras mutants and c-Ets-2 activate the cyclin D1 promoter through distinguishable regions.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Albanese C, Johnson J, Watanabe G, Eklund N, Vu D, Arnold A, Pestell RG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "7559524", "url": "https://glygen.org/publication/PubMed/7559524" } ] }, { "title": "Recycling of the general transcription factors during RNA polymerase II transcription.", "journal": "Genes & development", "date": "1995", "authors": "Zawel L, Kumar KP, Reinberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-73776", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-73776" } ], "reference": [ { "type": "PubMed", "id": "7601352", "url": "https://glygen.org/publication/PubMed/7601352" } ] }, { "title": "Inhibition of transcription elongation by the VHL tumor suppressor protein.", "journal": "Science (New York, N.Y.)", "date": "1995", "authors": "Duan DR, Pause A, Burgess WH, Aso T, Chen DY, Garrett KP, Conaway RC, Conaway JW, Linehan WM, Klausner RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-674695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-674695" } ], "reference": [ { "type": "PubMed", "id": "7660122", "url": "https://glygen.org/publication/PubMed/7660122" } ] }, { "title": "Elongin (SIII): a multisubunit regulator of elongation by RNA polymerase II.", "journal": "Science (New York, N.Y.)", "date": "1995", "authors": "Aso T, Lane WS, Conaway JW, Conaway RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-674695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-674695" } ], "reference": [ { "type": "PubMed", "id": "7660129", "url": "https://glygen.org/publication/PubMed/7660129" } ] }, { "title": "Binding of the von Hippel-Lindau tumor suppressor protein to Elongin B and C.", "journal": "Science (New York, N.Y.)", "date": "1995", "authors": "Kibel A, Iliopoulos O, DeCaprio JA, Kaelin WG Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-674695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-674695" } ], "reference": [ { "type": "PubMed", "id": "7660130", "url": "https://glygen.org/publication/PubMed/7660130" } ] }, { "title": "RPA involvement in the damage-recognition and incision steps of nucleotide excision repair.", "journal": "Nature", "date": "1995", "authors": "He Z, Henricksen LA, Wold MS, Ingles CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6782135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6782135" } ], "reference": [ { "type": "PubMed", "id": "7700386", "url": "https://glygen.org/publication/PubMed/7700386" } ] }, { "title": "A TBP-TAF complex required for transcription of human snRNA genes by RNA polymerase II and III.", "journal": "Nature", "date": "1995", "authors": "Henry RW, Sadowski CL, Kobayashi R, Hernandez N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "7715707", "url": "https://glygen.org/publication/PubMed/7715707" } ] }, { "title": "Differential activation of the influenza virus polymerase via template RNA binding.", "journal": "Journal of virology", "date": "1995", "authors": "Cianci C, Tiley L, Krystal M", "evidence": [ { "database": "Reactome", "id": "R-HSA-168325", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168325" } ], "reference": [ { "type": "PubMed", "id": "7769657", "url": "https://glygen.org/publication/PubMed/7769657" } ] }, { "title": "A retinoic acid-triggered cascade of HOXB1 gene activation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Ogura T, Evans RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "7831296", "url": "https://glygen.org/publication/PubMed/7831296" } ] }, { "title": "Lentivirus Tat proteins specifically associate with a cellular protein kinase, TAK, that hyperphosphorylates the carboxyl-terminal domain of the large subunit of RNA polymerase II: candidate for a Tat cofactor.", "journal": "Journal of virology", "date": "1995", "authors": "Herrmann CH, Rice AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-167152", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-167152" } ], "reference": [ { "type": "PubMed", "id": "7853496", "url": "https://glygen.org/publication/PubMed/7853496" } ] }, { "title": "The 87-kD A gamma-globin enhancer-binding protein is a product of the HOXB2(HOX2H) locus.", "journal": "Blood", "date": "1994", "authors": "Sengupta PK, Lavelle DE, DeSimone J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "7906964", "url": "https://glygen.org/publication/PubMed/7906964" } ] }, { "title": "Regulation of the human HOXD4 gene by retinoids.", "journal": "Mechanisms of development", "date": "1993", "authors": "Moroni MC, Vigano MA, Mavilio F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "7908827", "url": "https://glygen.org/publication/PubMed/7908827" } ] }, { "title": "Characterization of the proximal estrogen-responsive element of human cathepsin D gene.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "1994", "authors": "Augereau P, Miralles F, Cavailles V, Gaudelet C, Parker M, Rochefort H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "7935485", "url": "https://glygen.org/publication/PubMed/7935485" } ] }, { "title": "Interaction of proteins with transcriptionally active estrogen receptors.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Cavailles V, Dauvois S, Danielian PS, Parker MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "7937828", "url": "https://glygen.org/publication/PubMed/7937828" } ] }, { "title": "Transcript cleavage by RNA polymerase II arrested by a cyclobutane pyrimidine dimer in the DNA template.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Donahue BA, Yin S, Taylor JS, Reines D, Hanawalt PC", "evidence": [ { "database": "Reactome", "id": "R-HSA-6781823", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6781823" } ], "reference": [ { "type": "PubMed", "id": "8078911", "url": "https://glygen.org/publication/PubMed/8078911" } ] }, { "title": "Transcription factors IIE and IIH and ATP hydrolysis direct promoter clearance by RNA polymerase II.", "journal": "Cell", "date": "1994", "authors": "Goodrich JA, Tjian R", "evidence": [ { "database": "Reactome", "id": "R-HSA-167161", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-167161" } ], "reference": [ { "type": "PubMed", "id": "8156590", "url": "https://glygen.org/publication/PubMed/8156590" } ] }, { "title": "Estrogen receptor-Sp1 complexes mediate estrogen-induced cathepsin D gene expression in MCF-7 human breast cancer cells.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Krishnan V, Wang X, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "8195246", "url": "https://glygen.org/publication/PubMed/8195246" } ] }, { "title": "Estrogen receptor-associated proteins: possible mediators of hormone-induced transcription.", "journal": "Science (New York, N.Y.)", "date": "1994", "authors": "Halachmi S, Marden E, Martin G, MacKay H, Abbondanza C, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "8197458", "url": "https://glygen.org/publication/PubMed/8197458" } ] }, { "title": "Common and unique transcription factor requirements of human U1 and U6 snRNA genes.", "journal": "The EMBO journal", "date": "1993", "authors": "Bernues J, Simmen KA, Lewis JD, Gunderson SI, Polycarpou-Schwarz M, Moncollin V, Egly JM, Mattaj IW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "8253082", "url": "https://glygen.org/publication/PubMed/8253082" } ] }, { "title": "TBP, a universal eukaryotic transcription factor?", "journal": "Genes & development", "date": "1993", "authors": "Hernandez N", "evidence": [ { "database": "Reactome", "id": "R-HSA-73779", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-73779" } ], "reference": [ { "type": "PubMed", "id": "8330735", "url": "https://glygen.org/publication/PubMed/8330735" } ] }, { "title": "Targeting TBP to a non-TATA box cis-regulatory element: a TBP-containing complex activates transcription from snRNA promoters through the PSE.", "journal": "Genes & development", "date": "1993", "authors": "Sadowski CL, Henry RW, Lobo SM, Hernandez N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "8339931", "url": "https://glygen.org/publication/PubMed/8339931" } ] }, { "title": "hnRNP proteins and the biogenesis of mRNA.", "journal": "Annual review of biochemistry", "date": "1993", "authors": "Dreyfuss G, Matunis MJ, Pinol-Roma S, Burd CG", "evidence": [ { "database": "Reactome", "id": "R-HSA-72203", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72203" } ], "reference": [ { "type": "PubMed", "id": "8352591", "url": "https://glygen.org/publication/PubMed/8352591" } ] }, { "title": "Potentiation of RNA polymerase II transcription by Gal4-VP16 during but not after DNA replication and chromatin assembly.", "journal": "Genes & development", "date": "1993", "authors": "Kamakaka RT, Bulger M, Kadonaga JT", "evidence": [ { "database": "Reactome", "id": "R-HSA-674695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-674695" } ], "reference": [ { "type": "PubMed", "id": "8370526", "url": "https://glygen.org/publication/PubMed/8370526" } ] }, { "title": "Cathepsin D gene is controlled by a mixed promoter, and estrogens stimulate only TATA-dependent transcription in breast cancer cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Cavailles V, Augereau P, Rochefort H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "8419924", "url": "https://glygen.org/publication/PubMed/8419924" } ] }, { "title": "DNA repair helicase: a component of BTF2 (TFIIH) basic transcription factor.", "journal": "Science (New York, N.Y.)", "date": "1993", "authors": "Schaeffer L, Roy R, Humbert S, Moncollin V, Vermeulen W, Hoeijmakers JH, Chambon P, Egly JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-167162", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-167162" } ], "reference": [ { "type": "PubMed", "id": "8465201", "url": "https://glygen.org/publication/PubMed/8465201" } ] }, { "title": "DNA topology and a minimal set of basal factors for transcription by RNA polymerase II.", "journal": "Cell", "date": "1993", "authors": "Parvin JD, Sharp PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-167161", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-167161" } ], "reference": [ { "type": "PubMed", "id": "8490964", "url": "https://glygen.org/publication/PubMed/8490964" } ] }, { "title": "Evidence that sequence-independent binding of highly conserved U2 snRNP proteins upstream of the branch site is required for assembly of spliceosomal complex A.", "journal": "Genes & development", "date": "1996", "authors": "Gozani O, Feld R, Reed R", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "8566756", "url": "https://glygen.org/publication/PubMed/8566756" } ] }, { "title": "A human RNA helicase-like protein, HRH1, facilitates nuclear export of spliced mRNA by releasing the RNA from the spliceosome.", "journal": "Genes & development", "date": "1996", "authors": "Ohno M, Shimura Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "8608946", "url": "https://glygen.org/publication/PubMed/8608946" } ] }, { "title": "The Oct-1 POU-specific domain can stimulate small nuclear RNA gene transcription by stabilizing the basal transcription complex SNAPc.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Mittal V, Cleary MA, Herr W, Hernandez N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "8628262", "url": "https://glygen.org/publication/PubMed/8628262" } ] }, { "title": "The transcription factors Sp1 and Oct-1 interact physically to regulate human U2 snRNA gene expression.", "journal": "Nucleic acids research", "date": "1996", "authors": "Strom AC, Forsberg M, Lillhager P, Westin G", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "8668525", "url": "https://glygen.org/publication/PubMed/8668525" } ] }, { "title": "In vitro and transgenic analysis of a human HOXD4 retinoid-responsive enhancer.", "journal": "Development (Cambridge, England)", "date": "1996", "authors": "Morrison A, Moroni MC, Ariza-McNaughton L, Krumlauf R, Mavilio F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "8674428", "url": "https://glygen.org/publication/PubMed/8674428" } ] }, { "title": "Functional interaction between a RARE and an AP-2 binding site in the regulation of the human HOX A4 gene promoter.", "journal": "Nucleic acids research", "date": "1996", "authors": "Doerksen LF, Bhattacharya A, Kannan P, Pratt D, Tainsky MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "8759021", "url": "https://glygen.org/publication/PubMed/8759021" } ] }, { "title": "RNA splicing: unexpected spliceosome diversity.", "journal": "Current biology : CB", "date": "1996", "authors": "Kreivi JP, Lamond AI", "evidence": [ { "database": "Reactome", "id": "R-HSA-72165", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72165" } ], "reference": [ { "type": "PubMed", "id": "8835860", "url": "https://glygen.org/publication/PubMed/8835860" } ] }, { "title": "p300 is a component of an estrogen receptor coactivator complex.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Hanstein B, Eckner R, DiRenzo J, Halachmi S, Liu H, Searcy B, Kurokawa R, Brown M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "8876171", "url": "https://glygen.org/publication/PubMed/8876171" } ] }, { "title": "UV-induced ubiquitination of RNA polymerase II: a novel modification deficient in Cockayne syndrome cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Bregman DB, Halaban R, van Gool AJ, Henning KA, Friedberg EC, Warren SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6781823", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6781823" } ], "reference": [ { "type": "PubMed", "id": "8876179", "url": "https://glygen.org/publication/PubMed/8876179" } ] }, { "title": "The general transcription factors of RNA polymerase II.", "journal": "Genes & development", "date": "1996", "authors": "Orphanides G, Lagrange T, Reinberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-73779", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-73779" } ], "reference": [ { "type": "PubMed", "id": "8946909", "url": "https://glygen.org/publication/PubMed/8946909" } ] }, { "title": "Staf, a promiscuous activator for enhanced transcription by RNA polymerases II and III.", "journal": "The EMBO journal", "date": "1997", "authors": "Schaub M, Myslinski E, Schuster C, Krol A, Carbon P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "9009278", "url": "https://glygen.org/publication/PubMed/9009278" } ] }, { "title": "Association of U2 snRNP with the spliceosomal complex E.", "journal": "Nucleic acids research", "date": "1997", "authors": "Hong W, Bennett M, Xiao Y, Feld Kramer R, Wang C, Reed R", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "9016565", "url": "https://glygen.org/publication/PubMed/9016565" } ] }, { "title": "p53 activates Fanconi anemia group C gene expression.", "journal": "Human molecular genetics", "date": "1997", "authors": "Liebetrau W, Budde A, Savoia A, Grummt F, Hoehn H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6796648", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6796648" } ], "reference": [ { "type": "PubMed", "id": "9063748", "url": "https://glygen.org/publication/PubMed/9063748" } ] }, { "title": "Differential in vivo activation of the class II and class III snRNA genes by the POU-specific domain of Oct-1.", "journal": "Nucleic acids research", "date": "1997", "authors": "Murphy S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "9153304", "url": "https://glygen.org/publication/PubMed/9153304" } ] }, { "title": "Characterization of a trimeric complex containing Oct-1, SNAPc, and DNA.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Ford E, Hernandez N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "9188510", "url": "https://glygen.org/publication/PubMed/9188510" } ] }, { "title": "Identification of a functional imperfect estrogen-responsive element in the 5'-promoter region of the human cathepsin D gene.", "journal": "Biochemistry", "date": "1997", "authors": "Wang F, Porter W, Xing W, Archer TK, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "9201922", "url": "https://glygen.org/publication/PubMed/9201922" } ] }, { "title": "A novel class of RanGTP binding proteins.", "journal": "The Journal of cell biology", "date": "1997", "authors": "Gorlich D, Dabrowski M, Bischoff FR, Kutay U, Bork P, Hartmann E, Prehn S, Izaurralde E", "evidence": [ { "database": "Reactome", "id": "R-HSA-5578749", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749" } ], "reference": [ { "type": "PubMed", "id": "9214382", "url": "https://glygen.org/publication/PubMed/9214382" } ] }, { "title": "Functional dissection of a transcriptionally active, target-specific Hox-Pbx complex.", "journal": "The EMBO journal", "date": "1997", "authors": "Di Rocco G, Mavilio F, Zappavigna V", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "9218805", "url": "https://glygen.org/publication/PubMed/9218805" } ] }, { "title": "U2AF65 recruits a novel human DEAD box protein required for the U2 snRNP-branchpoint interaction.", "journal": "Genes & development", "date": "1997", "authors": "Fleckner J, Zhang M, Valcarcel J, Green MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "9242493", "url": "https://glygen.org/publication/PubMed/9242493" } ] }, { "title": "A role for TFIIH in controlling the activity of early RNA polymerase II elongation complexes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Dvir A, Conaway RC, Conaway JW", "evidence": [ { "database": "Reactome", "id": "R-HSA-167162", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-167162" } ], "reference": [ { "type": "PubMed", "id": "9256425", "url": "https://glygen.org/publication/PubMed/9256425" } ] }, { "title": "Multiple interdependent sequence elements control splicing of a fibroblast growth factor receptor 2 alternative exon.", "journal": "Molecular and cellular biology", "date": "1997", "authors": "Del Gatto F, Plet A, Gesnel MC, Fort C, Breathnach R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803529", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803529" } ], "reference": [ { "type": "PubMed", "id": "9271388", "url": "https://glygen.org/publication/PubMed/9271388" } ] }, { "title": "HOXD4 and regulation of the group 4 paralog genes.", "journal": "Development (Cambridge, England)", "date": "1997", "authors": "Morrison A, Ariza-McNaughton L, Gould A, Featherstone M, Krumlauf R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "9272954", "url": "https://glygen.org/publication/PubMed/9272954" } ] }, { "title": "Cockayne syndrome group B protein enhances elongation by RNA polymerase II.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Selby CP, Sancar A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6781823", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6781823" } ], "reference": [ { "type": "PubMed", "id": "9326587", "url": "https://glygen.org/publication/PubMed/9326587" } ] }, { "title": "Molecular basis of agonism and antagonism in the oestrogen receptor.", "journal": "Nature", "date": "1997", "authors": "Brzozowski AM, Pike AC, Dauter Z, Hubbard RE, Bonn T, Engstrom O, Ohman L, Greene GL, Gustafsson JA, Carlquist M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "9338790", "url": "https://glygen.org/publication/PubMed/9338790" } ] }, { "title": "Promoter escape by RNA polymerase II. Formation of an escape-competent transcriptional intermediate is a prerequisite for exit of polymerase from the promoter.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Dvir A, Tan S, Conaway JW, Conaway RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-73776", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-73776" } ], "reference": [ { "type": "PubMed", "id": "9353262", "url": "https://glygen.org/publication/PubMed/9353262" } ] }, { "title": "Nucleosome positioning and transcription-associated chromatin alterations on the human estrogen-responsive pS2 promoter.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Sewack GF, Hansen U", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "9388265", "url": "https://glygen.org/publication/PubMed/9388265" } ] }, { "title": "Three transitions in the RNA polymerase II transcription complex during initiation.", "journal": "The EMBO journal", "date": "1997", "authors": "Holstege FC, Fiedler U, Timmers HT", "evidence": [ { "database": "Reactome", "id": "R-HSA-167161", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-167161" } ], "reference": [ { "type": "PubMed", "id": "9405375", "url": "https://glygen.org/publication/PubMed/9405375" } ] }, { "title": "5'-Capping enzymes are targeted to pre-mRNA by binding to the phosphorylated carboxy-terminal domain of RNA polymerase II.", "journal": "Genes & development", "date": "1997", "authors": "McCracken S, Fong N, Rosonina E, Yankulov K, Brothers G, Siderovski D, Hessel A, Foster S, Shuman S, Bentley DL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "9407024", "url": "https://glygen.org/publication/PubMed/9407024" } ] }, { "title": "Purification and cDNA cloning of the AdoMet-binding subunit of the human mRNA (N6-adenosine)-methyltransferase.", "journal": "RNA (New York, N.Y.)", "date": "1997", "authors": "Bokar JA, Shambaugh ME, Polayes D, Matera AG, Rottman FM", "evidence": [ { "database": "Reactome", "id": "R-HSA-72203", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72203" } ], "reference": [ { "type": "PubMed", "id": "9409616", "url": "https://glygen.org/publication/PubMed/9409616" } ] }, { "title": "DSIF, a novel transcription elongation factor that regulates RNA polymerase II processivity, is composed of human Spt4 and Spt5 homologs.", "journal": "Genes & development", "date": "1998", "authors": "Wada T, Takagi T, Yamaguchi Y, Ferdous A, Imai T, Hirose S, Sugimoto S, Yano K, Hartzog GA, Winston F, Buratowski S, Handa H", "evidence": [ { "database": "Reactome", "id": "R-HSA-674695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-674695" } ], "reference": [ { "type": "PubMed", "id": "9450929", "url": "https://glygen.org/publication/PubMed/9450929" } ] }, { "title": "The novel homeoprotein Prep1 modulates Pbx-Hox protein cooperativity.", "journal": "The EMBO journal", "date": "1998", "authors": "Berthelsen J, Zappavigna V, Ferretti E, Mavilio F, Blasi F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5617472", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472" } ], "reference": [ { "type": "PubMed", "id": "9482740", "url": "https://glygen.org/publication/PubMed/9482740" } ] }, { "title": "FACT, a factor that facilitates transcript elongation through nucleosomes.", "journal": "Cell", "date": "1998", "authors": "Orphanides G, LeRoy G, Chang CH, Luse DS, Reinberg D", "evidence": [ { "database": "Reactome", "id": "R-HSA-674695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-674695" } ], "reference": [ { "type": "PubMed", "id": "9489704", "url": "https://glygen.org/publication/PubMed/9489704" } ] }, { "title": "A cooperative interaction between U2AF65 and mBBP/SF1 facilitates branchpoint region recognition.", "journal": "Genes & development", "date": "1998", "authors": "Berglund JA, Abovich N, Rosbash M", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "9512519", "url": "https://glygen.org/publication/PubMed/9512519" } ] }, { "title": "Isolation and characterization of a human cDNA for mRNA 5'-capping enzyme.", "journal": "Nucleic acids research", "date": "1998", "authors": "Yamada-Okabe T, Doi R, Shimmi O, Arisawa M, Yamada-Okabe H", "evidence": [ { "database": "Reactome", "id": "R-HSA-72086", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72086" } ], "reference": [ { "type": "PubMed", "id": "9512541", "url": "https://glygen.org/publication/PubMed/9512541" } ] }, { "title": "Human homologs of yeast prp16 and prp17 reveal conservation of the mechanism for catalytic step II of pre-mRNA splicing.", "journal": "The EMBO journal", "date": "1998", "authors": "Zhou Z, Reed R", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "9524131", "url": "https://glygen.org/publication/PubMed/9524131" } ] }, { "title": "Analysis of the interaction of the novel RNA polymerase II (pol II) subunit hsRPB4 with its partner hsRPB7 and with pol II.", "journal": "Mol. Cell. Biol.", "date": "1998", "authors": "Khazak V, Estojak J, Cho H, Majors J, Sonoda G, Testa JR, Golemis EA", "evidence": [ { "database": "UniProtKB", "id": "O15514", "url": "https://www.uniprot.org/uniprot/O15514" } ], "reference": [ { "type": "PubMed", "id": "9528765", "url": "https://glygen.org/publication/PubMed/9528765" } ] }, { "title": "The human U5-200kD DEXH-box protein unwinds U4/U6 RNA duplices in vitro.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Laggerbauer B, Achsel T, Luhrmann R", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "9539711", "url": "https://glygen.org/publication/PubMed/9539711" } ] }, { "title": "Functional and physical interactions between the estrogen receptor Sp1 and nuclear aryl hydrocarbon receptor complexes.", "journal": "Nucleic acids research", "date": "1998", "authors": "Wang F, Hoivik D, Pollenz R, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "9611253", "url": "https://glygen.org/publication/PubMed/9611253" } ] }, { "title": "c-Myc or cyclin D1 mimics estrogen effects on cyclin E-Cdk2 activation and cell cycle reentry.", "journal": "Molecular and cellular biology", "date": "1998", "authors": "Prall OW, Rogan EM, Musgrove EA, Watts CK, Sutherland RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "9671459", "url": "https://glygen.org/publication/PubMed/9671459" } ] }, { "title": "A potential role for U2AF-SAP 155 interactions in recruiting U2 snRNP to the branch site.", "journal": "Molecular and cellular biology", "date": "1998", "authors": "Gozani O, Potashkin J, Reed R", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "9671485", "url": "https://glygen.org/publication/PubMed/9671485" } ] }, { "title": "Solution structure of the DNA- and RPA-binding domain of the human repair factor XPA.", "journal": "Nature structural biology", "date": "1998", "authors": "Ikegami T, Kuraoka I, Saijo M, Kodo N, Kyogoku Y, Morikawa K, Tanaka K, Shirakawa M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6782135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6782135" } ], "reference": [ { "type": "PubMed", "id": "9699634", "url": "https://glygen.org/publication/PubMed/9699634" } ] }, { "title": "The mammalian homologue of Prp16p is overexpressed in a cell line tolerant to Leflunomide, a new immunoregulatory drug effective against rheumatoid arthritis.", "journal": "RNA (New York, N.Y.)", "date": "1998", "authors": "Ortlepp D, Laggerbauer B, Mullner S, Achsel T, Kirschbaum B, Luhrmann R", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "9701291", "url": "https://glygen.org/publication/PubMed/9701291" } ] }, { "title": "ZNF76 and ZNF143 are two human homologs of the transcriptional activator Staf.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Myslinski E, Krol A, Carbon P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "9705341", "url": "https://glygen.org/publication/PubMed/9705341" } ] }, { "title": "DNA-binding polarity of human replication protein A positions nucleases in nucleotide excision repair.", "journal": "Genes & development", "date": "1998", "authors": "de Laat WL, Appeldoorn E, Sugasawa K, Weterings E, Jaspers NG, Hoeijmakers JH", "evidence": [ { "database": "Reactome", "id": "R-HSA-6782135", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6782135" } ], "reference": [ { "type": "PubMed", "id": "9716411", "url": "https://glygen.org/publication/PubMed/9716411" } ] }, { "title": "Mass spectrometry and EST-database searching allows characterization of the multi-protein spliceosome complex.", "journal": "Nature genetics", "date": "1998", "authors": "Neubauer G, King A, Rappsilber J, Calvio C, Watson M, Ajuh P, Sleeman J, Lamond A, Mann M", "evidence": [ { "database": "Reactome", "id": "R-HSA-72163", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163" } ], "reference": [ { "type": "PubMed", "id": "9731529", "url": "https://glygen.org/publication/PubMed/9731529" } ] }, { "title": "Upstream stimulatory factors mediate estrogen receptor activation of the cathepsin D promoter.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "1998", "authors": "Xing W, Archer TK", "evidence": [ { "database": "Reactome", "id": "R-HSA-9018519", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519" } ], "reference": [ { "type": "PubMed", "id": "9731700", "url": "https://glygen.org/publication/PubMed/9731700" } ] }, { "title": "RNA-dependent activation of primer RNA production by influenza virus polymerase: different regions of the same protein subunit constitute the two required RNA-binding sites.", "journal": "The EMBO journal", "date": "1998", "authors": "Li ML, Ramirez BC, Krug RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-168325", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168325" } ], "reference": [ { "type": "PubMed", "id": "9755184", "url": "https://glygen.org/publication/PubMed/9755184" } ] }, { "title": "FCP1, the RAP74-interacting subunit of a human protein phosphatase that dephosphorylates the carboxyl-terminal domain of RNA polymerase IIO.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Archambault J, Pan G, Dahmus GK, Cartier M, Marshall N, Zhang S, Dahmus ME, Greenblatt J", "evidence": [ { "database": "Reactome", "id": "R-HSA-113418", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-113418" } ], "reference": [ { "type": "PubMed", "id": "9765293", "url": "https://glygen.org/publication/PubMed/9765293" } ] }, { "title": "Cloning and characterization of three human cDNAs encoding mRNA (guanine-7-)-methyltransferase, an mRNA cap methylase.", "journal": "Biochemical and biophysical research communications", "date": "1998", "authors": "Tsukamoto T, Shibagaki Y, Niikura Y, Mizumoto K", "evidence": [ { "database": "Reactome", "id": "R-HSA-72086", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72086" } ], "reference": [ { "type": "PubMed", "id": "9790902", "url": "https://glygen.org/publication/PubMed/9790902" } ] }, { "title": "The Oct-1 POU domain activates snRNA gene transcription by contacting a region in the SNAPc largest subunit that bears sequence similarities to the Oct-1 coactivator OBF-1.", "journal": "Genes & development", "date": "1998", "authors": "Ford E, Strubin M, Hernandez N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807505", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505" } ], "reference": [ { "type": "PubMed", "id": "9832505", "url": "https://glygen.org/publication/PubMed/9832505" } ] }, { "title": "Immunoaffinity purification and functional characterization of human transcription factor IIH and RNA polymerase II from clonal cell lines that conditionally express epitope-tagged subunits of the multiprotein complexes.", "journal": "The Journal of biological chemistry", "date": "1998-12-18", "authors": "Kershnar E, Wu S Y, Chiang C M", "evidence": [ { "database": "UniProtKB", "id": "O15514", "url": "https://www.uniprot.org/uniprot/O15514" } ], "reference": [ { "type": "PubMed", "id": "9852112", "url": "https://glygen.org/publication/PubMed/9852112" } ] }, { "title": "Evidence that P-TEFb alleviates the negative effect of DSIF on RNA polymerase II-dependent transcription in vitro.", "journal": "The EMBO journal", "date": "1998", "authors": "Wada T, Takagi T, Yamaguchi Y, Watanabe D, Handa H", "evidence": [ { "database": "Reactome", "id": "R-HSA-167158", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-167158" } ], "reference": [ { "type": "PubMed", "id": "9857195", "url": "https://glygen.org/publication/PubMed/9857195" } ] }, { "title": "hnRNP A1 recruited to an exon in vivo can function as an exon splicing silencer.", "journal": "Molecular and cellular biology", "date": "1999", "authors": "Del Gatto-Konczak F, Olive M, Gesnel MC, Breathnach R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6803529", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803529" } ], "reference": [ { "type": "PubMed", "id": "9858549", "url": "https://glygen.org/publication/PubMed/9858549" } ] }, { "title": "Efficient PCNA complex formation is dependent upon both transcription coupled repair and genome overall repair.", "journal": "Mutation research", "date": "1998", "authors": "Balajee AS, May A, Dianova I, Bohr VA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6782210", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6782210" } ], "reference": [ { "type": "PubMed", "id": "9875289", "url": "https://glygen.org/publication/PubMed/9875289" } ] } ], "pathway": [ { "id": "hsa:5433", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:5433", "resource": "KEGG Pathway" }, { "id": "R-HSA-112382", "name": "Formation of RNA Pol II elongation complex", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-112382", "resource": "Reactome", "description": "Formation of RNA Pol II elongation complex" }, { "id": "R-HSA-113418", "name": "Formation of the Early Elongation Complex", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-113418", "resource": "Reactome", "description": "Formation of the Early Elongation Complex" }, { "id": "R-HSA-167152", "name": "Formation of HIV elongation complex in the absence of HIV Tat", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-167152", "resource": "Reactome", "description": "Formation of HIV elongation complex in the absence of HIV Tat" }, { "id": "R-HSA-167158", "name": "Formation of the HIV-1 Early Elongation Complex", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-167158", "resource": "Reactome", "description": "Formation of the HIV-1 Early Elongation Complex" }, { "id": "R-HSA-167160", "name": "RNA Pol II CTD phosphorylation and interaction with CE during HIV infection", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-167160", "resource": "Reactome", "description": "RNA Pol II CTD phosphorylation and interaction with CE during HIV infection" }, { "id": "R-HSA-167161", "name": "HIV Transcription Initiation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-167161", "resource": "Reactome", "description": "HIV Transcription Initiation" }, { "id": "R-HSA-167162", "name": "RNA Polymerase II HIV Promoter Escape", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-167162", "resource": "Reactome", "description": "RNA Polymerase II HIV Promoter Escape" }, { "id": "R-HSA-167172", "name": "Transcription of the HIV genome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-167172", "resource": "Reactome", "description": "Transcription of the HIV genome" }, { "id": "R-HSA-167200", "name": "Formation of HIV-1 elongation complex containing HIV-1 Tat", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-167200", "resource": "Reactome", "description": "Formation of HIV-1 elongation complex containing HIV-1 Tat" }, { "id": "R-HSA-167238", "name": "Pausing and recovery of Tat-mediated HIV elongation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-167238", "resource": "Reactome", "description": "Pausing and recovery of Tat-mediated HIV elongation" }, { "id": "R-HSA-167242", "name": "Abortive elongation of HIV-1 transcript in the absence of Tat", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-167242", "resource": "Reactome", "description": "Abortive elongation of HIV-1 transcript in the absence of Tat" }, { "id": "R-HSA-167243", "name": "Tat-mediated HIV elongation arrest and recovery", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-167243", "resource": "Reactome", "description": "Tat-mediated HIV elongation arrest and recovery" }, { "id": "R-HSA-167246", "name": "Tat-mediated elongation of the HIV-1 transcript", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-167246", "resource": "Reactome", "description": "Tat-mediated elongation of the HIV-1 transcript" }, { "id": "R-HSA-167287", "name": "HIV elongation arrest and recovery", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-167287", "resource": "Reactome", "description": "HIV elongation arrest and recovery" }, { "id": "R-HSA-167290", "name": "Pausing and recovery of HIV elongation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-167290", "resource": "Reactome", "description": "Pausing and recovery of HIV elongation" }, { "id": "R-HSA-168325", "name": "Viral Messenger RNA Synthesis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168325", "resource": "Reactome", "description": "Viral Messenger RNA Synthesis" }, { "id": "R-HSA-203927", "name": "MicroRNA (miRNA) biogenesis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-203927", "resource": "Reactome", "description": "MicroRNA (miRNA) biogenesis" }, { "id": "R-HSA-5578749", "name": "Transcriptional regulation by small RNAs", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5578749", "resource": "Reactome", "description": "Transcriptional regulation by small RNAs" }, { "id": "R-HSA-5601884", "name": "PIWI-interacting RNA (piRNA) biogenesis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5601884", "resource": "Reactome", "description": "PIWI-interacting RNA (piRNA) biogenesis" }, { "id": "R-HSA-5617472", "name": "Activation of anterior HOX genes in hindbrain development during early embryogenesis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5617472", "resource": "Reactome", "description": "Activation of anterior HOX genes in hindbrain development during early embryogenesis" }, { "id": "R-HSA-674695", "name": "RNA Polymerase II Pre-transcription Events", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-674695", "resource": "Reactome", "description": "RNA Polymerase II Pre-transcription Events" }, { "id": "R-HSA-6781823", "name": "Formation of TC-NER Pre-Incision Complex", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6781823", "resource": "Reactome", "description": "Formation of TC-NER Pre-Incision Complex" }, { "id": "R-HSA-6781827", "name": "Transcription-Coupled Nucleotide Excision Repair (TC-NER)", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6781827", "resource": "Reactome", "description": "Transcription-Coupled Nucleotide Excision Repair (TC-NER)" }, { "id": "R-HSA-6782135", "name": "Dual incision in TC-NER", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6782135", "resource": "Reactome", "description": "Dual incision in TC-NER" }, { "id": "R-HSA-6782210", "name": "Gap-filling DNA repair synthesis and ligation in TC-NER", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6782210", "resource": "Reactome", "description": "Gap-filling DNA repair synthesis and ligation in TC-NER" }, { "id": "R-HSA-6796648", "name": "TP53 Regulates Transcription of DNA Repair Genes", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6796648", "resource": "Reactome", "description": "TP53 Regulates Transcription of DNA Repair Genes" }, { "id": "R-HSA-6803529", "name": "FGFR2 alternative splicing", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6803529", "resource": "Reactome", "description": "FGFR2 alternative splicing" }, { "id": "R-HSA-6807505", "name": "RNA polymerase II transcribes snRNA genes", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807505", "resource": "Reactome", "description": "RNA polymerase II transcribes snRNA genes" }, { "id": "R-HSA-72086", "name": "mRNA Capping", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72086", "resource": "Reactome", "description": "mRNA Capping" }, { "id": "R-HSA-72163", "name": "mRNA Splicing - Major Pathway", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72163", "resource": "Reactome", "description": "mRNA Splicing - Major Pathway" }, { "id": "R-HSA-72165", "name": "mRNA Splicing - Minor Pathway", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72165", "resource": "Reactome", "description": "mRNA Splicing - Minor Pathway" }, { "id": "R-HSA-72203", "name": "Processing of Capped Intron-Containing Pre-mRNA", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-72203", "resource": "Reactome", "description": "Processing of Capped Intron-Containing Pre-mRNA" }, { "id": "R-HSA-73776", "name": "RNA Polymerase II Promoter Escape", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-73776", "resource": "Reactome", "description": "RNA Polymerase II Promoter Escape" }, { "id": "R-HSA-73779", "name": "RNA Polymerase II Transcription Pre-Initiation And Promoter Opening", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-73779", "resource": "Reactome", "description": "RNA Polymerase II Transcription Pre-Initiation And Promoter Opening" }, { "id": "R-HSA-75953", "name": "RNA Polymerase II Transcription Initiation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75953", "resource": "Reactome", "description": "RNA Polymerase II Transcription Initiation" }, { "id": "R-HSA-75955", "name": "RNA Polymerase II Transcription Elongation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75955", "resource": "Reactome", "description": "RNA Polymerase II Transcription Elongation" }, { "id": "R-HSA-76042", "name": "RNA Polymerase II Transcription Initiation And Promoter Clearance", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-76042", "resource": "Reactome", "description": "RNA Polymerase II Transcription Initiation And Promoter Clearance" }, { "id": "R-HSA-77075", "name": "RNA Pol II CTD phosphorylation and interaction with CE", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-77075", "resource": "Reactome", "description": "RNA Pol II CTD phosphorylation and interaction with CE" }, { "id": "R-HSA-8851708", "name": "Signaling by FGFR2 IIIa TM", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8851708", "resource": "Reactome", "description": "Signaling by FGFR2 IIIa TM" }, { "id": "R-HSA-9018519", "name": "Estrogen-dependent gene expression", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9018519", "resource": "Reactome", "description": "Estrogen-dependent gene expression" }, { "id": "R-HSA-9670095", "name": "Inhibition of DNA recombination at telomere", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9670095", "resource": "Reactome", "description": "Inhibition of DNA recombination at telomere" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A8I6A2X2-1", "protein_name": "RNA polymerase II subunit D", "gene_name": "Polr2d", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MAAGGSDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEVFMKTNYTARFSRFKNRETIATVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKRSFQY", "length": 141 }, "evidence": [ { "id": "O15514", "url": "https://omabrowser.org/oma/group/O15514/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q9D7M8-1", "protein_name": "DNA-directed RNA polymerase II subunit RPB4", "gene_name": "Polr2d", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAAGGSDPRAGDVEEDASQLIFPKEFETAETLLNSEVHMLLEHRKQQNESAEDEQELSEVFMKTLNYTARFSRFKNRETIASVRSLLLQKKLHKFELACLANLCPETAEESKALIPSLEGRFEDEELQQILDDIQTKRSFQY", "length": 142 }, "evidence": [ { "id": "45919379", "url": "http://www.informatics.jax.org/homology/45919379", "database": "MGI" }, { "id": "O15514", "url": "https://omabrowser.org/oma/group/O15514/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9VEA5-1", "protein_name": "DNA-directed RNA polymerase II subunit Rpb4", "gene_name": "Rpb4", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MSFMNPVDMVDEDAADLQFPKEFENAETLLISEVHMLLDHRKRQNESADEEQEFSEVFMKTYAYTDSFRKFKNKETIMSARSLLMQKKLHKFELAALGNLCPEAPEEAKALIPSLEGRFEDEELRQILDDIGTKRSLQY", "length": 139 }, "evidence": [ { "id": "O15514", "url": "https://omabrowser.org/oma/group/O15514/", "database": "OMA" } ], "common_name": "Fruit fly" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 6, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "O15514", "url": "https://www.uniprot.org/uniprot/O15514" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "O15514", "url": "https://www.uniprot.org/uniprot/O15514" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "O15514", "url": "https://www.uniprot.org/uniprot/O15514" } ], "pmid": "" }, { "name": "nuclear speck", "id": "GO:0016607", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016607", "evidence": [ { "database": "UniProtKB", "id": "O15514", "url": "https://www.uniprot.org/uniprot/O15514" } ], "pmid": "" }, { "name": "DNA-directed RNA polymerase complex", "id": "GO:0000428", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000428", "evidence": [ { "database": "UniProtKB", "id": "O15514", "url": "https://www.uniprot.org/uniprot/O15514" } ], "pmid": "" }, { "name": "RNA polymerase II, core complex", "id": "GO:0005665", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005665", "evidence": [ { "database": "UniProtKB", "id": "O15514", "url": "https://www.uniprot.org/uniprot/O15514" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "nucleotide binding", "id": "GO:0000166", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000166", "evidence": [ { "database": "UniProtKB", "id": "O15514", "url": "https://www.uniprot.org/uniprot/O15514" } ], "pmid": "" }, { "name": "translation initiation factor binding", "id": "GO:0031369", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031369", "evidence": [ { "database": "UniProtKB", "id": "O15514", "url": "https://www.uniprot.org/uniprot/O15514" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 5, "go_terms": [ { "name": "nucleic acid metabolic process", "id": "GO:0090304", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090304", "evidence": [ { "database": "UniProtKB", "id": "O15514", "url": "https://www.uniprot.org/uniprot/O15514" } ], "pmid": "" }, { "name": "transcription by RNA polymerase II", "id": "GO:0006366", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006366", "evidence": [ { "database": "UniProtKB", "id": "O15514", "url": "https://www.uniprot.org/uniprot/O15514" } ], "pmid": "" }, { "name": "DNA-templated transcription initiation", "id": "GO:0006352", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006352", "evidence": [ { "database": "UniProtKB", "id": "O15514", "url": "https://www.uniprot.org/uniprot/O15514" } ], "pmid": "" }, { "name": "transcription initiation at RNA polymerase II promoter", "id": "GO:0006367", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006367", "evidence": [ { "database": "UniProtKB", "id": "O15514", "url": "https://www.uniprot.org/uniprot/O15514" } ], "pmid": "" }, { "name": "recruitment of 3'-end processing factors to RNA polymerase II holoenzyme complex", "id": "GO:0034402", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034402", "evidence": [ { "database": "UniProtKB", "id": "O15514", "url": "https://www.uniprot.org/uniprot/O15514" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 48, "end_pos": 50, "annotation": "n_glycosylation_sequon" }, { "start_pos": 66, "end_pos": 68, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 48, "end_pos": 50 }, { "start_pos": 66, "end_pos": 68 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 517 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }