{ "uniprot_canonical_ac": "O15455-1", "uniprot_ac": "O15455", "uniprot_id": "TLR3_HUMAN", "mass": { "chemical_mass": 103829.0, "monoisotopic_mass": 103829.0 }, "refseq": { "ac": "NP_003256", "name": "toll-like receptor 3 precursor", "summary": "The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This receptor is most abundantly expressed in placenta and pancreas, and is restricted to the dendritic subpopulation of the leukocytes. It recognizes dsRNA associated with viral infection, and induces the activation of NF-kappaB and the production of type I interferons. It thus plays a role in host defense against multiple viruses. [provided by RefSeq, Jul 2021].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003256" }, "gene_names": [ { "name": "TLR3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O15455", "id": "O15455" }, { "name": "CD283; IIAE2; IMD83", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003256", "id": "NP_003256" }, { "name": "TLR3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003256", "id": "NP_003256" }, { "name": "hCG_1787812", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O15455", "id": "O15455" } ], "protein_names": [ { "name": "Toll-like receptor 3", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O15455" }, { "name": "toll-like receptor 3 precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003256", "id": "NP_003256" } ], "function": [ { "annotation": "Analysis of associations between the TLR3 SNPs rs3775291 and rs3775290 and COVID-19 in a cohort of professionals of Belem-PA, Brazil. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_003256", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003256" }, { "database": "PubMed", "id": "38173795", "url": "https://glygen.org/publication/PubMed/38173795" } ] }, { "annotation": "Glioma-derived ANXA1 suppresses the immune response to TLR3 ligands by promoting an anti-inflammatory tumor microenvironment.", "evidence": [ { "database": "RefSeq", "id": "NP_003256", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003256" }, { "database": "PubMed", "id": "38049523", "url": "https://glygen.org/publication/PubMed/38049523" } ] }, { "annotation": "Key component of innate and adaptive immunity. TLRs (Toll-like receptors) control host immune response against pathogens through recognition of molecular patterns specific to microorganisms. TLR3 is a nucleotide-sensing TLR which is activated by double-stranded RNA, a sign of viral infection. Acts via the adapter TRIF/TICAM1, leading to NF-kappa-B activation, IRF3 nuclear translocation, cytokine secretion and the inflammatory response.", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455#function" }, { "database": "PubMed", "id": "16858407", "url": "https://glygen.org/publication/PubMed/16858407" }, { "database": "PubMed", "id": "12539043", "url": "https://glygen.org/publication/PubMed/12539043" }, { "database": "PubMed", "id": "22611194", "url": "https://glygen.org/publication/PubMed/22611194" }, { "database": "PubMed", "id": "16043704", "url": "https://glygen.org/publication/PubMed/16043704" }, { "database": "PubMed", "id": "16720699", "url": "https://glygen.org/publication/PubMed/16720699" }, { "database": "PubMed", "id": "12471095", "url": "https://glygen.org/publication/PubMed/12471095" }, { "database": "PubMed", "id": "18172197", "url": "https://glygen.org/publication/PubMed/18172197" }, { "database": "PubMed", "id": "16144834", "url": "https://glygen.org/publication/PubMed/16144834" }, { "database": "PubMed", "id": "17178723", "url": "https://glygen.org/publication/PubMed/17178723" } ] }, { "annotation": "TLR3 Gene Polymorphism in HCV Infection in the Kazakh Population of Western Kazakhstan. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_003256", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003256" }, { "database": "PubMed", "id": "38019252", "url": "https://glygen.org/publication/PubMed/38019252" } ] }, { "annotation": "The Functional Mechanisms of Toll-Like Receptor 3 and Its Implications in Digestive System Tumors. Review article", "evidence": [ { "database": "RefSeq", "id": "NP_003256", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003256" }, { "database": "PubMed", "id": "38062829", "url": "https://glygen.org/publication/PubMed/38062829" } ] }, { "annotation": "The effect of TLR3 priming conditions on MSC immunosuppressive properties. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_003256", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003256" }, { "database": "PubMed", "id": "38031182", "url": "https://glygen.org/publication/PubMed/38031182" } ] }, { "annotation": "The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This receptor is most abundantly expressed in placenta and pancreas, and is restricted to the dendritic subpopulation of the leukocytes. It recognizes dsRNA associated with viral infection, and induces the activation of NF-kappaB and the production of type I interferons. It thus plays a role in host defense against multiple viruses. [provided by RefSeq, Jul 2021].", "evidence": [ { "database": "RefSeq", "id": "NP_003256", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003256" } ] } ], "disease": [ { "disease_id": "MONDO:0800187", "recommended_name": { "id": "MONDO:0800187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0800187", "name": "immunodeficiency 83, susceptibility to viral infections", "description": "An inherited susceptibility or predisposition to developing viral infections." }, "synonyms": [ { "id": "MONDO:0800187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0800187", "name": "IMD83", "description": "" }, { "id": "MIM:613002", "resource": "MIM", "url": "https://www.omim.org/entry/613002", "name": "Immunodeficiency 83, susceptibility to viral infections", "description": "Immunodeficiency 83, susceptibility to viral infections" } ], "evidence": [ { "id": "613002", "database": "MIM", "url": "https://www.omim.org/entry/613002" } ] } ], "snv": [ { "evidence": [ { "id": "rs753545423", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs753545423" }, { "id": "rs753545423", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs753545423" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 638, "end_pos": 638, "sequence_org": "T", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->NLP); o-glyco-site-loss (T->P).", "chr_id": "4", "chr_pos": "186083598", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T638", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs140176180", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs140176180" }, { "id": "rs140176180", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs140176180" }, { "id": "rs140176180", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs140176180" }, { "id": "rs140176180", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs140176180#frequency_tab" }, { "id": "rs140176180", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs140176180" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 116, "end_pos": 116, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DKT->NKT).", "chr_id": "4", "chr_pos": "186076965", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "0.000599", "site_lbl": "D116", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1174917852", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1174917852" }, { "id": "rs1174917852", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1174917852#frequency_tab" }, { "id": "rs1174917852", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1174917852" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 126, "end_pos": 126, "sequence_org": "T", "sequence_mut": "A", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->NLA).", "chr_id": "4", "chr_pos": "186076995", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T126", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1408892039", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1408892039" }, { "id": "rs1408892039", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1408892039" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 126, "end_pos": 126, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->NLI).", "chr_id": "4", "chr_pos": "186076996", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T126", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1229034193", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1229034193" }, { "id": "rs1229034193", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1229034193#frequency_tab" }, { "id": "rs1229034193", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1229034193" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 142, "end_pos": 142, "sequence_org": "P", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NNP->NNT).", "chr_id": "4", "chr_pos": "186077043", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P142", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O15455", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O15455" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 182, "end_pos": 182, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "K", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NNK->NNT).", "chr_id": "4", "chr_pos": "186078943", "ref_nt": "A", "alt_nt": "C", "minor_allelic_frequency": "", "site_lbl": "K182", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1219003162", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1219003162" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 196, "end_pos": 196, "sequence_org": "N", "sequence_mut": "null", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NSS->nullSS).", "chr_id": "4", "chr_pos": "186078983", "ref_nt": "l", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N196", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O15455", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O15455" }, { "id": "rs1579730792", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1579730792" }, { "id": "rs1579730792", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1579730792" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 236, "end_pos": 236, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (SLT->NLT).", "chr_id": "4", "chr_pos": "186082393", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "S236", "disease": [ { "disease_id": "DOID:1319", "recommended_name": { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain cancer", "description": "A central nervous system cancer that is characterized by the growth of abnormal cells in the tissues of the brain." }, "synonyms": [ { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "BT - Brain tumour", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "adult brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "adult malignant brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain neoplasm, adult", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant brain tumour", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant primary brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant primary brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant tumor of Brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant tumor of adult brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "neoplasm of brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary malignant neoplasm of brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "tumor of the Brain", "description": "" } ] }, { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] }, { "evidence": [ { "id": "rs1168654238", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1168654238" }, { "id": "rs1168654238", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1168654238#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 247, "end_pos": 247, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTS->KTS).", "chr_id": "4", "chr_pos": "186082427", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N247", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O15455", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O15455" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 247, "end_pos": 247, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "N", "sequence_mut": "S", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NTS->STS).", "chr_id": "4", "chr_pos": "186082426", "ref_nt": "A", "alt_nt": "G", "minor_allelic_frequency": "", "site_lbl": "N247", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs2099303697", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2099303697" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 252, "end_pos": 252, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLS->SLS).", "chr_id": "4", "chr_pos": "186082441", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N252", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs748736365", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748736365" }, { "id": "rs748736365", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748736365" }, { "id": "rs748736365", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs748736365" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 265, "end_pos": 265, "sequence_org": "N", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->ITT).", "chr_id": "4", "chr_pos": "186082480", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N265", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs748736365", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748736365" }, { "id": "rs748736365", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748736365" }, { "id": "rs748736365", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs748736365" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 265, "end_pos": 265, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NTT->STT).", "chr_id": "4", "chr_pos": "186082480", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N265", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs770716910", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770716910" }, { "id": "rs770716910", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs770716910" }, { "id": "rs770716910", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs770716910" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 275, "end_pos": 275, "sequence_org": "N", "sequence_mut": "D", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->DLT).", "chr_id": "4", "chr_pos": "186082509", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N275", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1188065402", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1188065402" }, { "id": "rs1188065402", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1188065402" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 27, "end_pos": 27, "sequence_org": "K", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (KCT->NCT).", "chr_id": "4", "chr_pos": "186076700", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "K27", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O15455", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O15455" }, { "id": "rs112077022", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs112077022" }, { "id": "rs112077022", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs112077022" }, { "id": "rs112077022", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs112077022" }, { "id": "rs112077022", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs112077022#frequency_tab" }, { "id": "rs112077022", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs112077022" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 280, "end_pos": 280, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "D", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (DLS->NLS).", "chr_id": "4", "chr_pos": "186082524", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "D280", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] }, { "evidence": [ { "id": "rs763113132", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763113132" }, { "id": "rs763113132", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs763113132" }, { "id": "rs763113132", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs763113132" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 287, "end_pos": 287, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NLN->NLS).", "chr_id": "4", "chr_pos": "186082546", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N287", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1350538207", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1350538207" }, { "id": "rs1350538207", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1350538207" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 293, "end_pos": 293, "sequence_org": "S", "sequence_mut": "*", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDS->ND*).", "chr_id": "4", "chr_pos": "186084658", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S293", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs778689164", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778689164" }, { "id": "rs778689164", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778689164" }, { "id": "rs778689164", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs778689164#frequency_tab" }, { "id": "rs778689164", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs778689164" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 310, "end_pos": 310, "sequence_org": "I", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NNI->NNT).", "chr_id": "4", "chr_pos": "186082615", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "I310", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1411156074", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1411156074" }, { "id": "rs1411156074", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1411156074#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 325, "end_pos": 325, "sequence_org": "R", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NVR->NVT).", "chr_id": "4", "chr_pos": "186082660", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "R325", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs759819677", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs759819677" }, { "id": "rs759819677", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs759819677" }, { "id": "rs759819677", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs759819677#frequency_tab" }, { "id": "rs759819677", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs759819677" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 337, "end_pos": 337, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SIS->NIS).", "chr_id": "4", "chr_pos": "186082696", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S337", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs772994120", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772994120" }, { "id": "rs772994120", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs772994120" }, { "id": "rs772994120", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs772994120" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 367, "end_pos": 367, "sequence_org": "I", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NDI->NDT).", "chr_id": "4", "chr_pos": "186082786", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "I367", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O15455", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O15455" } ], "glycoeffect": [], "start_pos": 412, "end_pos": 412, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "L", "sequence_mut": "F", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "4", "chr_pos": "186082920", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "L412", "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] }, { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] }, { "disease_id": "DOID:2531", "recommended_name": { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "hematologic cancer", "description": "An organ system cancer located in the hematological system that is characterized by uncontrolled cellular proliferation in blood, bone marrow and lymph nodes." }, "synonyms": [ { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "Hematologic malignancy", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "Hematologic neoplasm", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "Hematological tumors", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "blood cancer", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "hematopoietic and lymphoid system tumor", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "hematopoietic cancer", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "hematopoietic neoplasm", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "hematopoietic tumors", "description": "" }, { "id": "DOID:2531", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:2531", "name": "malignant hematopoietic neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1388869607", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1388869607" }, { "id": "rs1388869607", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1388869607" }, { "id": "rs1388869607", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1388869607#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 413, "end_pos": 413, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->TLT).", "chr_id": "4", "chr_pos": "186082924", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N413", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1561372201", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1561372201" }, { "id": "rs1561372201", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1561372201" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 415, "end_pos": 415, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->NLI).", "chr_id": "4", "chr_pos": "186082930", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T415", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O15455", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O15455" }, { "id": "rs1253689203", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1253689203" }, { "id": "rs1253689203", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1253689203" }, { "id": "rs1253689203", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1253689203" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 509, "end_pos": 509, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "A", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NLT->NLA).", "chr_id": "4", "chr_pos": "186083211", "ref_nt": "A", "alt_nt": "G", "minor_allelic_frequency": "", "site_lbl": "T509", "disease": [ { "disease_id": "DOID:1319", "recommended_name": { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain cancer", "description": "A central nervous system cancer that is characterized by the growth of abnormal cells in the tissues of the brain." }, "synonyms": [ { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "BT - Brain tumour", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "adult brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "adult malignant brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "brain neoplasm, adult", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant brain tumour", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant primary brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant primary brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant tumor of Brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "malignant tumor of adult brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "neoplasm of brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary brain neoplasm", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary brain tumor", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "primary malignant neoplasm of brain", "description": "" }, { "id": "DOID:1319", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1319", "name": "tumor of the Brain", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] }, { "evidence": [ { "id": "O15455", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O15455" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 509, "end_pos": 509, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "I", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NLT->NLI).", "chr_id": "4", "chr_pos": "186083212", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "T509", "disease": [ { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs760328773", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs760328773" }, { "id": "rs760328773", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs760328773" }, { "id": "rs760328773", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs760328773" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 512, "end_pos": 512, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DLS->NLS).", "chr_id": "4", "chr_pos": "186083220", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D512", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs758255171", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758255171" }, { "id": "rs758255171", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs758255171" }, { "id": "rs758255171", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs758255171" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 522, "end_pos": 522, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NIN->NIS).", "chr_id": "4", "chr_pos": "186083251", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N522", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs751015522", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751015522" }, { "id": "rs751015522", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751015522" }, { "id": "rs751015522", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs751015522" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 54, "end_pos": 54, "sequence_org": "T", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->NIK).", "chr_id": "4", "chr_pos": "186076780", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T54", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs751015522", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751015522" }, { "id": "rs751015522", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs751015522" }, { "id": "rs751015522", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs751015522" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 54, "end_pos": 54, "sequence_org": "T", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIT->NIR).", "chr_id": "4", "chr_pos": "186076780", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T54", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs376119293", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs376119293" }, { "id": "rs376119293", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs376119293#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 57, "end_pos": 57, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->KLT).", "chr_id": "4", "chr_pos": "186076790", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N57", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs143307508", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs143307508" }, { "id": "rs143307508", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs143307508" }, { "id": "rs143307508", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs143307508" }, { "id": "rs143307508", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs143307508#frequency_tab" }, { "id": "rs143307508", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs143307508" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 59, "end_pos": 59, "sequence_org": "T", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->NLN).", "chr_id": "4", "chr_pos": "186076795", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "T59", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1413951633", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1413951633" }, { "id": "rs1413951633", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1413951633#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 636, "end_pos": 636, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NLT->KLT).", "chr_id": "4", "chr_pos": "186083594", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N636", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs2099303904", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs2099303904" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 662, "end_pos": 662, "sequence_org": "N", "sequence_mut": "H", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->HET).", "chr_id": "4", "chr_pos": "186083670", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N662", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs149490656", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149490656" }, { "id": "rs149490656", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs149490656" }, { "id": "rs149490656", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs149490656#frequency_tab" }, { "id": "rs149490656", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs149490656" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 662, "end_pos": 662, "sequence_org": "N", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->KET).", "chr_id": "4", "chr_pos": "186083672", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N662", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1579732085", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1579732085" }, { "id": "rs1579732085", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1579732085" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 664, "end_pos": 664, "sequence_org": "T", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NET->NEP).", "chr_id": "4", "chr_pos": "186083676", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T664", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs774142858", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774142858" }, { "id": "rs774142858", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs774142858" }, { "id": "rs774142858", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs774142858" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 70, "end_pos": 70, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->SFT).", "chr_id": "4", "chr_pos": "186076828", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N70", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs760739824", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs760739824" }, { "id": "rs760739824", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs760739824" }, { "id": "rs760739824", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs760739824" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 72, "end_pos": 72, "sequence_org": "T", "sequence_mut": "I", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NFT->NFI).", "chr_id": "4", "chr_pos": "186076834", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T72", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1241355268", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1241355268" }, { "id": "rs1241355268", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1241355268" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 87, "end_pos": 87, "sequence_org": "I", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NTI->NTT).", "chr_id": "4", "chr_pos": "186076879", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "I87", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [ { "start_pos": 122, "end_pos": 122, "sequence_org": "C", "sequence_mut": "A", "comment": "Reduced response to ds-RNA.", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" }, { "database": "PubMed", "id": "16144834", "url": "https://glygen.org/publication/PubMed/16144834" } ] }, { "start_pos": 196, "end_pos": 196, "sequence_org": "N", "sequence_mut": "G", "comment": "Reduced expression levels; when associated with R-247.", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" }, { "database": "PubMed", "id": "16144834", "url": "https://glygen.org/publication/PubMed/16144834" } ] }, { "start_pos": 247, "end_pos": 247, "sequence_org": "N", "sequence_mut": "R", "comment": "Reduced response to ds-RNA. Reduced expression levels; when associated with G-196.", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" }, { "database": "PubMed", "id": "16144834", "url": "https://glygen.org/publication/PubMed/16144834" } ] }, { "start_pos": 539, "end_pos": 539, "sequence_org": "H", "sequence_mut": "A", "comment": "No effect.", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" }, { "database": "PubMed", "id": "16720699", "url": "https://glygen.org/publication/PubMed/16720699" } ] }, { "start_pos": 539, "end_pos": 539, "sequence_org": "H", "sequence_mut": "E", "comment": "Loss of RNA binding. Constitutive activation of NF-kappa-B.", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" }, { "database": "PubMed", "id": "16720699", "url": "https://glygen.org/publication/PubMed/16720699" } ] }, { "start_pos": 541, "end_pos": 541, "sequence_org": "N", "sequence_mut": "A", "comment": "Loss of RNA binding. Abolishes activation of NF-kappa-B.", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" }, { "database": "PubMed", "id": "16720699", "url": "https://glygen.org/publication/PubMed/16720699" } ] }, { "start_pos": 759, "end_pos": 759, "sequence_org": "Y", "sequence_mut": "F", "comment": "Reduced activation of NF-kappa-B in response to ds-RNA. Reduced induction of IL-8 in response to ds-RNA. Loss of interaction with WDFY1.", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" }, { "database": "PubMed", "id": "25736436", "url": "https://glygen.org/publication/PubMed/25736436" }, { "database": "PubMed", "id": "17178723", "url": "https://glygen.org/publication/PubMed/17178723" } ] }, { "start_pos": 812, "end_pos": 812, "sequence_org": "K", "sequence_mut": "R", "comment": "Loss of ubiquitination by ZNRF1.", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" }, { "database": "PubMed", "id": "37158982", "url": "https://glygen.org/publication/PubMed/37158982" } ] }, { "start_pos": 831, "end_pos": 831, "sequence_org": "K", "sequence_mut": "R", "comment": "Loss of ubiquitination by TRIM3.", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" }, { "database": "PubMed", "id": "32878999", "url": "https://glygen.org/publication/PubMed/32878999" } ] }, { "start_pos": 858, "end_pos": 858, "sequence_org": "Y", "sequence_mut": "F", "comment": "Loss of interaction with WDFY1.", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" }, { "database": "PubMed", "id": "25736436", "url": "https://glygen.org/publication/PubMed/25736436" } ] }, { "start_pos": 95, "end_pos": 95, "sequence_org": "C", "sequence_mut": "A", "comment": "Reduced response to ds-RNA.", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" }, { "database": "PubMed", "id": "16144834", "url": "https://glygen.org/publication/PubMed/16144834" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "67.79", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000164342", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164342" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "73.92", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000164342", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164342" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "70.99", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000164342", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164342" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "49.96", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000164342", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164342" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "75.58", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000164342", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164342" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "86.48", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000164342", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164342" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "47.76", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000164342", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164342" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "77.42", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000164342", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164342" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "68.02", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000164342", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164342" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "54.78", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000164342", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164342" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "73.97", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000164342", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164342" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "67.16", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000164342", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164342" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "68.07", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000164342", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164342" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O15455", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15455" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O15455", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15455" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O15455", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15455" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O15455", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15455" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O15455", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15455" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O15455", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15455" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O15455", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15455" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O15455", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15455" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O15455", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15455" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O15455", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15455" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O15455", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15455" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O15455", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15455" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "common_name": "Human" } ], "gene": [ { "name": "TLR3", "url": "https://www.uniprot.org/uniprot/O15455", "locus": { "chromosome": "4", "start_pos": 20944, "end_pos": 5001, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "LRG_117", "url": "https://www.ensembl.org/id/LRG_117" } ] } } ], "crossref": [ { "id": "ENSG00000164342", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000164342", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "O15455", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O15455", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "CHEMBL1075113", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL1075113", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "TLR3", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=TLR3", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "7098", "url": "https://www.ncbi.nlm.nih.gov/gene/7098", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "11849", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=11849", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O15455", "url": "https://www.ebi.ac.uk/intact/interactors/id:O15455*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000157", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000157", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000483", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000483", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR001611", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001611", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR003591", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003591", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017241", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017241", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR026906", "url": "https://www.ebi.ac.uk/interpro/entry/IPR026906", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR032675", "url": "https://www.ebi.ac.uk/interpro/entry/IPR032675", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR035897", "url": "https://www.ebi.ac.uk/interpro/entry/IPR035897", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR041015", "url": "https://www.ebi.ac.uk/interpro/entry/IPR041015", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:7098", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:7098", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "603029", "url": "http://www.omim.org/entry/603029", "database": "MIM", "categories": [ "Other" ] }, { "id": "613002", "url": "http://www.omim.org/entry/613002", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O15455", "url": "https://www.nextprot.org/entry/NX_O15455", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "O15455", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O15455", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "PYIYFWG", "url": "https://omabrowser.org/oma/group/PYIYFWG/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "3428126at2759", "url": "http://www.orthodb.org/?query=3428126at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR22650", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR22650", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR22650:SF4", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR22650:SF4", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24365", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24365", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24365:SF524", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24365:SF524", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24373", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24373", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24373:SF275", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24373:SF275", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR24373:SF357", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR24373:SF357", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1ZIW", "url": "https://www.rcsb.org/structure/1ZIW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2A0Z", "url": "https://www.rcsb.org/structure/2A0Z", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2MK9", "url": "https://www.rcsb.org/structure/2MK9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2MKA", "url": "https://www.rcsb.org/structure/2MKA", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3ULU", "url": "https://www.rcsb.org/structure/3ULU", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3ULV", "url": "https://www.rcsb.org/structure/3ULV", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5GS0", "url": "https://www.rcsb.org/structure/5GS0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7C76", "url": "https://www.rcsb.org/structure/7C76", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7WV3", "url": "https://www.rcsb.org/structure/7WV3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7WV4", "url": "https://www.rcsb.org/structure/7WV4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7WV5", "url": "https://www.rcsb.org/structure/7WV5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7WVE", "url": "https://www.rcsb.org/structure/7WVE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7WVF", "url": "https://www.rcsb.org/structure/7WVF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7WVJ", "url": "https://www.rcsb.org/structure/7WVJ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8AR1", "url": "https://www.rcsb.org/structure/8AR1", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00560", "url": "http://pfam.xfam.org/family/PF00560", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF01582", "url": "http://pfam.xfam.org/family/PF01582", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF13306", "url": "http://pfam.xfam.org/family/PF13306", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF13516", "url": "http://pfam.xfam.org/family/PF13516", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF13855", "url": "http://pfam.xfam.org/family/PF13855", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF17968", "url": "http://pfam.xfam.org/family/PF17968", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O15455", "url": "https://pharos.nih.gov/targets/O15455", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O15455", "url": "http://purl.obolibrary.org/obo/PR_O15455", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-1679131", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1679131", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-168164", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168164", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-168927", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168927", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-1810476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1810476", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5602410", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5602410", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5602415", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5602415", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5602566", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5602566", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5602571", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5602571", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9013957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013957", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9013973", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013973", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9014325", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9014325", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9833110", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833110", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_003256", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003256", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A8V8TLN9", "url": "https://www.uniprot.org/uniprot/A0A8V8TLN9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TLN9-1", "url": "https://www.uniprot.org/uniprot/A0A8V8TLN9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TN43", "url": "https://www.uniprot.org/uniprot/A0A8V8TN43", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A8V8TN43-1", "url": "https://www.uniprot.org/uniprot/A0A8V8TN43-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D6RA51", "url": "https://www.uniprot.org/uniprot/D6RA51", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D6RA51-1", "url": "https://www.uniprot.org/uniprot/D6RA51-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O15455-1", "url": "https://www.uniprot.org/uniprot/O15455-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O15455-2", "url": "https://www.uniprot.org/uniprot/O15455-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MRQTLPCIYFWGGLLPFGMLCASSTTKCTVSHEVADCSHLKLTQVPDDLPTNITVLNLTHNQLRRLPAANFTRYSQLTSLDVGFNTISKLEPELCQKLPMLKVLNLQHNELSQLSDKTFAFCTNLTELHLMSNSIQKIKNNPFVKQKNLITLDLSHNGLSSTKLGTQVQLENLQELLLSNNKIQALKSEELDIFANSSLKKLELSSNQIKEFSPGCFHAIGRLFGLFLNNVQLGPSLTEKLCLELANTSIRNLSLSNSQLSTTSNTTFLGLKWTNLTMLDLSYNNLNVVGNDSFAWLPQLEYFFLEYNNIQHLFSHSLHGLFNVRYLNLKRSFTKQSISLASLPKIDDFSFQWLKCLEHLNMEDNDIPGIKSNMFTGLINLKYLSLSNSFTSLRTLTNETFVSLAHSPLHILNLTKNKISKIESDAFSWLGHLEVLDLGLNEIGQELTGQEWRGLENIFEIYLSYNKYLQLTRNSFALVPSLQRLMLRRVALKNVDSSPSPFQPLRNLTILDLSNNNIANINDDMLEGLEKLEILDLQHNNLARLWKHANPGGPIYFLKGLSHLHILNLESNGFDEIPVEVFKDLFELKIIDLGLNNLNTLPASVFNNQVSLKSLNLQKNLITSVEKKVFGPAFRNLTELDMRFNPFDCTCESIAWFVNWINETHTNIPELSSHYLCNTPPHYHGFPVRLFDTSSCKDSAPFELFFMINTSILLIFIFIVLLIHFEGWRISFYWNVSVHRVLGFKEIDRQTEQFEYAAYIIHAYKDKDWVWEHFSSMEKEDQSLKFCLEERDFEAGVFELEAIVNSIKRSRKIIFVITHHLLKDPLCKRFKVHHAVQQAIEQNLDSIILVFLEEIPDYKLNHALCLRRGMFKSHCILNWPVQKERIGAFRHKLQVALGSKNSVH", "length": 904, "header": "sp|O15455-1|TLR3_HUMAN Isoform 1 of Toll-like receptor 3 OS=Homo sapiens OX=9606 GN=TLR3 PE=1 SV=1 CANONICAL=O15455-1" }, "isoforms": [ { "isoform_ac": "A0A8V8TLN9-1", "url": "", "sequence": { "sequence": "MRQTLPCIYFWGGLLPFGMLCASSTTKCTVSHEVADCSHLKLTQVPDDLPTNITVLNLTHNQLRRLPAANFTRYSQLTSLDVGFNTISKLEPELCQKLPMLKVLNLQHNELSQLSDKTFAFCTNLTELHLMSNSIQKIKNNPFVKQKNLITLDLSHNGLSSTKLGTQVQLENLQELLLSNNKIQALKSEELDIFANSSLKKLELSSNQIKEFSPGCFHAIGRLFGLFLNNVQLGPSLTEKLCLELANTSIRNLSLSNSQLSTTSNTTFLGLKWTNLTMLDLSYNNLNVIQGTSCSSTSY", "length": 299, "header": "tr|A0A8V8TLN9-1|A0A8V8TLN9_HUMAN Computationally mapped isoform of Toll like receptor 3 OS=Homo sapiens OX=9606 GN=TLR3 PE=1 SV=1 CANONICAL=O15455-1" }, "locus": { "chromosome": "4", "start_pos": 186084677, "end_pos": 186076620, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000698351.1", "url": "https://www.ensembl.org/id/ENST00000698351.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000513674.1", "url": "https://www.ensembl.org/id/ENSP00000513674.1" } ] } }, { "isoform_ac": "A0A8V8TN43-1", "url": "", "sequence": { "sequence": "MRQTLPCIYFWGGLLPFGMLCASSTTKCTVSHEVADCSHLKLTQVPDDLPTNITVLNLTHNQLRRLPAANFTRI", "length": 74, "header": "tr|A0A8V8TN43-1|TLR3_HUMAN Computationally mapped isoform of Toll-like receptor 3 OS=Homo sapiens OX=9606 GN=TLR3 PE=1 SV=1 CANONICAL=O15455-1" }, "locus": { "chromosome": "4", "start_pos": 186078843, "end_pos": 186076620, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000698352.1", "url": "https://www.ensembl.org/id/ENST00000698352.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000513675.1", "url": "https://www.ensembl.org/id/ENSP00000513675.1" } ] } }, { "isoform_ac": "D6RA51-1", "url": "", "sequence": { "sequence": "MRQTLPCIYFWGGLLPFGMLCASSTTKCTVSHEVADCSHLKLTQVPDDLPTNITVLNLTHNQLRRLPAANFTRYSQLTSLDVGFNTISKLEPELCQKLPMLKVLNLQHNELSQLSDKTFAFCTNLTELHLMSNSIQKIKNNPFVKQKNLITLDLSHNGLSSTKLGTQVQLENLQELLLSNNKIQALKSEELDIFANSSLKKLELSSNQIKEFSPGCFHAIGRLFGLFLNNVQLGPSLTEKLCLELANTSIRNLSLSNSQLSTTSNTTFLGLKWTNLTMLDLSYNNLNVWLKCLEHLNMEDNDIPGIKSNMFTGLINLKYLSLSNSFTSLRTLTNETFVSLAHSPLHILNLT", "length": 351, "header": "tr|D6RA51-1|D6RA51_HUMAN Computationally mapped isoform of Toll-like receptor 3, isoform CRA_b OS=Homo sapiens OX=9606 GN=TLR3 PE=1 SV=1 CANONICAL=O15455-1" }, "locus": { "chromosome": "4", "start_pos": 186082931, "end_pos": 186076620, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000513189.1", "url": "https://www.ensembl.org/id/ENST00000513189.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000423386.1", "url": "https://www.ensembl.org/id/ENSP00000423386.1" } ] } }, { "isoform_ac": "O15455-1", "url": "", "sequence": { "sequence": "MRQTLPCIYFWGGLLPFGMLCASSTTKCTVSHEVADCSHLKLTQVPDDLPTNITVLNLTHNQLRRLPAANFTRYSQLTSLDVGFNTISKLEPELCQKLPMLKVLNLQHNELSQLSDKTFAFCTNLTELHLMSNSIQKIKNNPFVKQKNLITLDLSHNGLSSTKLGTQVQLENLQELLLSNNKIQALKSEELDIFANSSLKKLELSSNQIKEFSPGCFHAIGRLFGLFLNNVQLGPSLTEKLCLELANTSIRNLSLSNSQLSTTSNTTFLGLKWTNLTMLDLSYNNLNVVGNDSFAWLPQLEYFFLEYNNIQHLFSHSLHGLFNVRYLNLKRSFTKQSISLASLPKIDDFSFQWLKCLEHLNMEDNDIPGIKSNMFTGLINLKYLSLSNSFTSLRTLTNETFVSLAHSPLHILNLTKNKISKIESDAFSWLGHLEVLDLGLNEIGQELTGQEWRGLENIFEIYLSYNKYLQLTRNSFALVPSLQRLMLRRVALKNVDSSPSPFQPLRNLTILDLSNNNIANINDDMLEGLEKLEILDLQHNNLARLWKHANPGGPIYFLKGLSHLHILNLESNGFDEIPVEVFKDLFELKIIDLGLNNLNTLPASVFNNQVSLKSLNLQKNLITSVEKKVFGPAFRNLTELDMRFNPFDCTCESIAWFVNWINETHTNIPELSSHYLCNTPPHYHGFPVRLFDTSSCKDSAPFELFFMINTSILLIFIFIVLLIHFEGWRISFYWNVSVHRVLGFKEIDRQTEQFEYAAYIIHAYKDKDWVWEHFSSMEKEDQSLKFCLEERDFEAGVFELEAIVNSIKRSRKIIFVITHHLLKDPLCKRFKVHHAVQQAIEQNLDSIILVFLEEIPDYKLNHALCLRRGMFKSHCILNWPVQKERIGAFRHKLQVALGSKNSVH", "length": 904, "header": "sp|O15455-1|TLR3_HUMAN Isoform 1 of Toll-like receptor 3 OS=Homo sapiens OX=9606 GN=TLR3 PE=1 SV=1 CANONICAL=O15455-1" }, "locus": { "chromosome": "4", "start_pos": 186084870, "end_pos": 186076620, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000296795.8", "url": "https://www.ensembl.org/id/ENST00000296795.8" }, { "database": "Ensembl Peptide", "id": "ENSP00000296795.3", "url": "https://www.ensembl.org/id/ENSP00000296795.3" } ] } }, { "isoform_ac": "O15455-2", "url": "", "sequence": { "sequence": "MLDLSYNNLNVVGNDSFAWLPQLEYFFLEYNNIQHLFSHSLHGLFNVRYLNLKRSFTKQSISLASLPKIDDFSFQWLKCLEHLNMEDNDIPGIKSNMFTGLINLKYLSLSNSFTSLRTLTNETFVSLAHSPLHILNLTKNKISKIESDAFSWLGHLEVLDLGLNEIGQELTGQEWRGLENIFEIYLSYNKYLQLTRNSFALVPSLQRLMLRRVALKNVDSSPSPFQPLRNLTILDLSNNNIANINDDMLEGLEKLEILDLQHNNLARLWKHANPGGPIYFLKGLSHLHILNLESNGFDEIPVEVFKDLFELKIIDLGLNNLNTLPASVFNNQVSLKSLNLQKNLITSVEKKVFGPAFRNLTELDMRFNPFDCTCESIAWFVNWINETHTNIPELSSHYLCNTPPHYHGFPVRLFDTSSCKDSAPFELFFMINTSILLIFIFIVLLIHFEGWRISFYWNVSVHRVLGFKEIDRQTEQFEYAAYIIHAYKDKDWVWEHFSSMEKEDQSLKFCLEERDFEAGVFELEAIVNSIKRSRKIIFVITHHLLKDPLCKRFKVHHAVQQAIEQNLDSIILVFLEEIPDYKLNHALCLRRGMFKSHCILNWPVQKERIGAFRHKLQVALGSKNSVH", "length": 627, "header": "sp|O15455-2|TLR3_HUMAN Isoform 2 of Toll-like receptor 3 OS=Homo sapiens OX=9606 GN=TLR3 PE=1 SV=1 CANONICAL=O15455-1" }, "locus": { "chromosome": "4", "start_pos": 186084870, "end_pos": 186082518, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000508051.2", "url": "https://www.ensembl.org/id/ENST00000508051.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000513677.1", "url": "https://www.ensembl.org/id/ENSP00000513677.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 124, "start_aa": "Asn", "end_pos": 124, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn124", "evidence": [ { "id": "O15455", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15455#ptm_processing" }, { "id": "15961631", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15961631" }, { "id": "22579623", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22579623" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 140, "start_aa": "Asn", "end_pos": 140, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn140", "evidence": [ { "id": "3ULU", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3ULU" }, { "id": "3ULV", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3ULV" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 196, "start_aa": "Asn", "end_pos": 196, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn196", "evidence": [ { "id": "O15455", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15455#ptm_processing" }, { "id": "16043704", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16043704" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 247, "start_aa": "Asn", "end_pos": 247, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn247", "evidence": [ { "id": "O15455", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15455#ptm_processing" }, { "id": "22579623", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22579623" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 252, "start_aa": "Asn", "end_pos": 252, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn252", "evidence": [ { "id": "O15455", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15455#ptm_processing" }, { "id": "16043704", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16043704" }, { "id": "15961631", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15961631" }, { "id": "22579623", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22579623" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 265, "start_aa": "Asn", "end_pos": 265, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn265", "evidence": [ { "id": "O15455", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15455#ptm_processing" }, { "id": "16043704", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16043704" }, { "id": "22579623", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22579623" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 275, "start_aa": "Asn", "end_pos": 275, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn275", "evidence": [ { "id": "O15455", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15455#ptm_processing" }, { "id": "16043704", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16043704" }, { "id": "15961631", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15961631" }, { "id": "22579623", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22579623" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 291, "start_aa": "Asn", "end_pos": 291, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn291", "evidence": [ { "id": "O15455", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15455#ptm_processing" }, { "id": "16043704", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16043704" }, { "id": "15961631", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15961631" }, { "id": "22579623", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22579623" }, { "id": "1ZIW", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/1ZIW" }, { "id": "3ULU", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3ULU" }, { "id": "3ULV", "database": "RCSB PDB", "url": "https://www.rcsb.org/sequence/3ULV" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 398, "start_aa": "Asn", "end_pos": 398, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn398", "evidence": [ { "id": "O15455", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15455#ptm_processing" }, { "id": "16043704", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16043704" }, { "id": "15961631", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15961631" }, { "id": "22579623", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22579623" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 413, "start_aa": "Asn", "end_pos": 413, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn413", "evidence": [ { "id": "O15455", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15455#ptm_processing" }, { "id": "16043704", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16043704" }, { "id": "15961631", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15961631" }, { "id": "22579623", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22579623" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 507, "start_aa": "Asn", "end_pos": 507, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn507", "evidence": [ { "id": "O15455", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15455#ptm_processing" }, { "id": "16043704", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16043704" }, { "id": "15961631", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/15961631" }, { "id": "22579623", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22579623" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 52, "start_aa": "Asn", "end_pos": 52, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn52", "evidence": [ { "id": "O15455", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15455#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "16043704", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16043704" }, { "id": "22579623", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22579623" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 57, "start_aa": "Asn", "end_pos": 57, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn57", "evidence": [ { "id": "O15455", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15455#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 636, "start_aa": "Asn", "end_pos": 636, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn636", "evidence": [ { "id": "O15455", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15455#ptm_processing" }, { "id": "16043704", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16043704" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 638, "start_aa": "Thr", "end_pos": 638, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr638", "evidence": [ { "id": "O15455", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O15455" }, { "id": "35289036", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35289036" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 662, "start_aa": "Asn", "end_pos": 662, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn662", "evidence": [ { "id": "O15455", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15455#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 70, "start_aa": "Asn", "end_pos": 70, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn70", "evidence": [ { "id": "O15455", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15455#ptm_processing" }, { "id": "16043704", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16043704" }, { "id": "22579623", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22579623" } ] } ], "phosphorylation": [ { "start_pos": 205, "end_pos": 205, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O15455", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15455" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" } ], "site_lbl": "Ser205" }, { "start_pos": 206, "end_pos": 206, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O15455", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15455" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" } ], "site_lbl": "Ser206" }, { "start_pos": 759, "end_pos": 759, "kinase_uniprot_canonical_ac": "P12931-1", "kinase_gene_name": "SRC", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O15455", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15455" }, { "database": "PubMed", "id": "24526685", "url": "https://glygen.org/publication/PubMed/24526685" } ], "site_lbl": "Tyr759" }, { "start_pos": 759, "end_pos": 759, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" }, { "database": "PubMed", "id": "17178723", "url": "https://glygen.org/publication/PubMed/17178723" }, { "database": "phospho.ELM", "id": "O15455", "url": "http://phospho.elm.eu.org/byAccession/O15455.html" }, { "database": "iPTMnet", "id": "O15455", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15455" }, { "database": "PubMed", "id": "12509442", "url": "https://glygen.org/publication/PubMed/12509442" }, { "database": "PubMed", "id": "27226571", "url": "https://glygen.org/publication/PubMed/27226571" }, { "database": "PubMed", "id": "29383749", "url": "https://glygen.org/publication/PubMed/29383749" }, { "database": "PubMed", "id": "29636491", "url": "https://glygen.org/publication/PubMed/29636491" } ], "site_lbl": "Tyr759" }, { "start_pos": 818, "end_pos": 818, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O15455", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15455" }, { "database": "PubMed", "id": "20058876", "url": "https://glygen.org/publication/PubMed/20058876" } ], "site_lbl": "Thr818" }, { "start_pos": 858, "end_pos": 858, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" }, { "database": "PubMed", "id": "17178723", "url": "https://glygen.org/publication/PubMed/17178723" }, { "database": "iPTMnet", "id": "O15455", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15455" } ], "site_lbl": "Tyr858" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported", "glycoprotein_predicted", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "TAK1 mitogen-activated protein kinase kinase kinase is activated by autophosphorylation within its activation loop.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Kishimoto K, Matsumoto K, Ninomiya-Tsuji J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9014325", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9014325" } ], "reference": [ { "type": "PubMed", "id": "10702308", "url": "https://glygen.org/publication/PubMed/10702308" } ] }, { "title": "Activation of NF-kappa B by the dsRNA-dependent protein kinase, PKR involves the I kappa B kinase complex.", "journal": "Oncogene", "date": "2000", "authors": "Gil J, Alcami J, Esteban M", "evidence": [ { "database": "Reactome", "id": "R-HSA-1810476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1810476" } ], "reference": [ { "type": "PubMed", "id": "10723127", "url": "https://glygen.org/publication/PubMed/10723127" } ] }, { "title": "Activation of the IkappaB kinase complex by TRAF6 requires a dimeric ubiquitin-conjugating enzyme complex and a unique polyubiquitin chain.", "journal": "Cell", "date": "2000", "authors": "Deng L, Wang C, Spencer E, Yang L, Braun A, You J, Slaughter C, Pickart C, Chen ZJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9014325", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9014325" } ], "reference": [ { "type": "PubMed", "id": "11057907", "url": "https://glygen.org/publication/PubMed/11057907" } ] }, { "title": "Recognition of double-stranded RNA and activation of NF-kappaB by Toll-like receptor 3.", "journal": "Nature", "date": "2001", "authors": "Alexopoulou L, Holt AC, Medzhitov R, Flavell RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-168164", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168164" } ], "reference": [ { "type": "PubMed", "id": "11607032", "url": "https://glygen.org/publication/PubMed/11607032" } ] }, { "title": "Tipping the balance between necrosis and apoptosis in human and murine cells treated with interferon and dsRNA.", "journal": "Cell death and differentiation", "date": "2002", "authors": "Kalai M, Van Loo G, Vanden Berghe T, Meeus A, Burm W, Saelens X, Vandenabeele P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013957" } ], "reference": [ { "type": "PubMed", "id": "12181749", "url": "https://glygen.org/publication/PubMed/12181749" } ] }, { "title": "IKKalpha, IKKbeta, and NEMO/IKKgamma are each required for the NF-kappa B-mediated inflammatory response program.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Li X, Massa PE, Hanidu A, Peet GW, Aro P, Savitt A, Mische S, Li J, Marcu KB", "evidence": [ { "database": "Reactome", "id": "R-HSA-1810476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1810476" } ], "reference": [ { "type": "PubMed", "id": "12221085", "url": "https://glygen.org/publication/PubMed/12221085" } ] }, { "title": "Interleukin-1 (IL-1) receptor-associated kinase-dependent IL-1-induced signaling complexes phosphorylate TAK1 and TAB2 at the plasma membrane and activate TAK1 in the cytosol.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Jiang Z, Ninomiya-Tsuji J, Qian Y, Matsumoto K, Li X", "evidence": [ { "database": "Reactome", "id": "R-HSA-9014325", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9014325" } ], "reference": [ { "type": "PubMed", "id": "12242293", "url": "https://glygen.org/publication/PubMed/12242293" } ] }, { "title": "Cutting edge: a novel Toll/IL-1 receptor domain-containing adapter that preferentially activates the IFN-beta promoter in the Toll-like receptor signaling.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2002", "authors": "Yamamoto M, Sato S, Mori K, Hoshino K, Takeuchi O, Takeda K, Akira S", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "reference": [ { "type": "PubMed", "id": "12471095", "url": "https://glygen.org/publication/PubMed/12471095" } ] }, { "title": "Double-stranded RNA signaling by Toll-like receptor 3 requires specific tyrosine residues in its cytoplasmic domain.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Sarkar SN, Smith HL, Rowe TM, Sen GC", "evidence": [ { "database": "iPTMnet", "id": "O15455", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15455" } ], "reference": [ { "type": "PubMed", "id": "12509442", "url": "https://glygen.org/publication/PubMed/12509442" } ] }, { "title": "TICAM-1, an adaptor molecule that participates in Toll-like receptor 3-mediated interferon-beta induction.", "journal": "Nature immunology", "date": "2003", "authors": "Oshiumi H, Matsumoto M, Funami K, Akazawa T, Seya T", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" }, { "database": "Reactome", "id": "R-HSA-168164", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168164" } ], "reference": [ { "type": "PubMed", "id": "12539043", "url": "https://glygen.org/publication/PubMed/12539043" } ] }, { "title": "Poly(I-C)-induced Toll-like receptor 3 (TLR3)-mediated activation of NFkappa B and MAP kinase is through an interleukin-1 receptor-associated kinase (IRAK)-independent pathway employing the signaling components TLR3-TRAF6-TAK1-TAB2-PKR .", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Jiang Z, Zamanian-Daryoush M, Nie H, Silva AM, Williams BR, Li X", "evidence": [ { "database": "Reactome", "id": "R-HSA-9014325", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9014325" } ], "reference": [ { "type": "PubMed", "id": "12609980", "url": "https://glygen.org/publication/PubMed/12609980" } ] }, { "title": "Insights into the regulatory mechanism for caspase-8 activation.", "journal": "Molecular cell", "date": "2003", "authors": "Donepudi M, Mac Sweeney A, Briand C, Grutter MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013957" } ], "reference": [ { "type": "PubMed", "id": "12620240", "url": "https://glygen.org/publication/PubMed/12620240" } ] }, { "title": "IKKepsilon and TBK1 are essential components of the IRF3 signaling pathway.", "journal": "Nature immunology", "date": "2003", "authors": "Fitzgerald KA, McWhirter SM, Faia KL, Rowe DC, Latz E, Golenbock DT, Coyle AJ, Liao SM, Maniatis T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013973", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013973" } ], "reference": [ { "type": "PubMed", "id": "12692549", "url": "https://glygen.org/publication/PubMed/12692549" } ] }, { "title": "Caspase-activation pathways in apoptosis and immunity.", "journal": "Immunological reviews", "date": "2003", "authors": "Creagh EM, Conroy H, Martin SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013957" } ], "reference": [ { "type": "PubMed", "id": "12752666", "url": "https://glygen.org/publication/PubMed/12752666" } ] }, { "title": "Role of adaptor TRIF in the MyD88-independent toll-like receptor signaling pathway.", "journal": "Science (New York, N.Y.)", "date": "2003", "authors": "Yamamoto M, Sato S, Hemmi H, Hoshino K, Kaisho T, Sanjo H, Takeuchi O, Sugiyama M, Okabe M, Takeda K, Akira S", "evidence": [ { "database": "Reactome", "id": "R-HSA-168164", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168164" } ], "reference": [ { "type": "PubMed", "id": "12855817", "url": "https://glygen.org/publication/PubMed/12855817" } ] }, { "title": "LPS-TLR4 signaling to IRF-3/7 and NF-kappaB involves the toll adapters TRAM and TRIF.", "journal": "The Journal of experimental medicine", "date": "2003", "authors": "Fitzgerald KA, Rowe DC, Barnes BJ, Caffrey DR, Visintin A, Latz E, Monks B, Pitha PM, Golenbock DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-168164", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168164" } ], "reference": [ { "type": "PubMed", "id": "14517278", "url": "https://glygen.org/publication/PubMed/14517278" } ] }, { "title": "X-ray crystal structure of IRF-3 and its functional implications.", "journal": "Nature structural biology", "date": "2003", "authors": "Takahasi K, Suzuki NN, Horiuchi M, Mori M, Suhara W, Okabe Y, Fukuhara Y, Terasawa H, Akira S, Fujita T, Inagaki F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013973", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013973" } ], "reference": [ { "type": "PubMed", "id": "14555995", "url": "https://glygen.org/publication/PubMed/14555995" } ] }, { "title": "Identification of Ser-386 of interferon regulatory factor 3 as critical target for inducible phosphorylation that determines activation.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Mori M, Yoneyama M, Ito T, Takahashi K, Inagaki F, Fujita T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013973", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013973" } ], "reference": [ { "type": "PubMed", "id": "14703513", "url": "https://glygen.org/publication/PubMed/14703513" } ] }, { "title": "TLR9 signals after translocating from the ER to CpG DNA in the lysosome.", "journal": "Nature immunology", "date": "2004", "authors": "Latz E, Schoenemeyer A, Visintin A, Fitzgerald KA, Monks BG, Knetter CF, Lien E, Nilsen NJ, Espevik T, Golenbock DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-1679131", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1679131" } ], "reference": [ { "type": "PubMed", "id": "14716310", "url": "https://glygen.org/publication/PubMed/14716310" } ] }, { "title": "Mechanisms of the TRIF-induced interferon-stimulated response element and NF-kappaB activation and apoptosis pathways.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Han KJ, Su X, Xu LG, Bin LH, Zhang J, Shu HB", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013957" } ], "reference": [ { "type": "PubMed", "id": "14739303", "url": "https://glygen.org/publication/PubMed/14739303" } ] }, { "title": "Innate antiviral responses by means of TLR7-mediated recognition of single-stranded RNA.", "journal": "Science (New York, N.Y.)", "date": "2004", "authors": "Diebold SS, Kaisho T, Hemmi H, Akira S, Reis e Sousa C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833110", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833110" } ], "reference": [ { "type": "PubMed", "id": "14976261", "url": "https://glygen.org/publication/PubMed/14976261" } ] }, { "title": "RIP1 is an essential mediator of Toll-like receptor 3-induced NF-kappa B activation.", "journal": "Nature immunology", "date": "2004", "authors": "Meylan E, Burns K, Hofmann K, Blancheteau V, Martinon F, Kelliher M, Tschopp J", "evidence": [ { "database": "Reactome", "id": "R-HSA-168927", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168927" } ], "reference": [ { "type": "PubMed", "id": "15064760", "url": "https://glygen.org/publication/PubMed/15064760" } ] }, { "title": "The two NF-kappaB activation pathways and their role in innate and adaptive immunity.", "journal": "Trends in immunology", "date": "2004", "authors": "Bonizzi G, Karin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-1810476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1810476" } ], "reference": [ { "type": "PubMed", "id": "15145317", "url": "https://glygen.org/publication/PubMed/15145317" } ] }, { "title": "The roles of two IkappaB kinase-related kinases in lipopolysaccharide and double stranded RNA signaling and viral infection.", "journal": "The Journal of experimental medicine", "date": "2004", "authors": "Hemmi H, Takeuchi O, Sato S, Yamamoto M, Kaisho T, Sanjo H, Kawai T, Hoshino K, Takeda K, Akira S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013973", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013973" } ], "reference": [ { "type": "PubMed", "id": "15210742", "url": "https://glygen.org/publication/PubMed/15210742" } ] }, { "title": "The cytoplasmic 'linker region' in Toll-like receptor 3 controls receptor localization and signaling.", "journal": "International immunology", "date": "2004", "authors": "Funami K, Matsumoto M, Oshiumi H, Akazawa T, Yamamoto A, Seya T", "evidence": [ { "database": "Reactome", "id": "R-HSA-1679131", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1679131" } ], "reference": [ { "type": "PubMed", "id": "15226270", "url": "https://glygen.org/publication/PubMed/15226270" } ] }, { "title": "TAB2 and TAB3 activate the NF-kappaB pathway through binding to polyubiquitin chains.", "journal": "Molecular cell", "date": "2004", "authors": "Kanayama A, Seth RB, Sun L, Ea CK, Hong M, Shaito A, Chiu YH, Deng L, Chen ZJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9014325", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9014325" } ], "reference": [ { "type": "PubMed", "id": "15327770", "url": "https://glygen.org/publication/PubMed/15327770" } ] }, { "title": "Signal peptide prediction based on analysis of experimentally verified cleavage sites.", "journal": "Protein Sci.", "date": "2004", "authors": "Zhang Z, Henzel WJ", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "reference": [ { "type": "PubMed", "id": "15340161", "url": "https://glygen.org/publication/PubMed/15340161" } ] }, { "title": "Apoptosis induced by the toll-like receptor adaptor TRIF is dependent on its receptor interacting protein homotypic interaction motif.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2005", "authors": "Kaiser WJ, Offermann MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013957" } ], "reference": [ { "type": "PubMed", "id": "15814722", "url": "https://glygen.org/publication/PubMed/15814722" } ] }, { "title": "Crystal structure of human toll-like receptor 3 (TLR3) ectodomain.", "journal": "Science (New York, N.Y.)", "date": "2005", "authors": "Choe J, Kelker MS, Wilson IA", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455#ptm_processing" }, { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "reference": [ { "type": "PubMed", "id": "15961631", "url": "https://glygen.org/publication/PubMed/15961631" } ] }, { "title": "The molecular structure of the Toll-like receptor 3 ligand-binding domain.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Bell JK, Botos I, Hall PR, Askins J, Shiloach J, Segal DM, Davies DR", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455#ptm_processing" }, { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "reference": [ { "type": "PubMed", "id": "16043704", "url": "https://glygen.org/publication/PubMed/16043704" } ] }, { "title": "Ubiquitin signalling in the NF-kappaB pathway.", "journal": "Nature cell biology", "date": "2005", "authors": "Chen ZJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1810476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1810476" } ], "reference": [ { "type": "PubMed", "id": "16056267", "url": "https://glygen.org/publication/PubMed/16056267" } ] }, { "title": "Rip1 mediates the Trif-dependent toll-like receptor 3- and 4-induced NF-{kappa}B activation but does not contribute to interferon regulatory factor 3 activation.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Cusson-Hermance N, Khurana S, Lee TH, Fitzgerald KA, Kelliher MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1810476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1810476" } ], "reference": [ { "type": "PubMed", "id": "16115877", "url": "https://glygen.org/publication/PubMed/16115877" } ] }, { "title": "Recognition of double-stranded RNA by human toll-like receptor 3 and downstream receptor signaling requires multimerization and an acidic pH.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "de Bouteiller O, Merck E, Hasan UA, Hubac S, Benguigui B, Trinchieri G, Bates EE, Caux C", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "reference": [ { "type": "PubMed", "id": "16144834", "url": "https://glygen.org/publication/PubMed/16144834" } ] }, { "title": "Essential function for the kinase TAK1 in innate and adaptive immune responses.", "journal": "Nature immunology", "date": "2005", "authors": "Sato S, Sanjo H, Takeda K, Ninomiya-Tsuji J, Yamamoto M, Kawai T, Matsumoto K, Takeuchi O, Akira S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9014325", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9014325" } ], "reference": [ { "type": "PubMed", "id": "16186825", "url": "https://glygen.org/publication/PubMed/16186825" } ] }, { "title": "TAK1, but not TAB1 or TAB2, plays an essential role in multiple signaling pathways in vivo.", "journal": "Genes & development", "date": "2005", "authors": "Shim JH, Xiao C, Paschal AE, Bailey ST, Rao P, Hayden MS, Lee KY, Bussey C, Steckel M, Tanaka N, Yamada G, Akira S, Matsumoto K, Ghosh S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9014325", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9014325" } ], "reference": [ { "type": "PubMed", "id": "16260493", "url": "https://glygen.org/publication/PubMed/16260493" } ] }, { "title": "Critical role of TRAF3 in the Toll-like receptor-dependent and -independent antiviral response.", "journal": "Nature", "date": "2006", "authors": "Oganesyan G, Saha SK, Guo B, He JQ, Shahangian A, Zarnegar B, Perry A, Cheng G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013973", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013973" } ], "reference": [ { "type": "PubMed", "id": "16306936", "url": "https://glygen.org/publication/PubMed/16306936" } ] }, { "title": "Specificity in Toll-like receptor signalling through distinct effector functions of TRAF3 and TRAF6.", "journal": "Nature", "date": "2006", "authors": "Hacker H, Redecke V, Blagoev B, Kratchmarova I, Hsu LC, Wang GG, Kamps MP, Raz E, Wagner H, Hacker G, Mann M, Karin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013973", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013973" } ], "reference": [ { "type": "PubMed", "id": "16306937", "url": "https://glygen.org/publication/PubMed/16306937" } ] }, { "title": "The Unc93b1 mutation 3d disrupts exogenous antigen presentation and signaling via Toll-like receptors 3, 7 and 9.", "journal": "Nature immunology", "date": "2006", "authors": "Tabeta K, Hoebe K, Janssen EM, Du X, Georgel P, Crozat K, Mudd S, Mann N, Sovath S, Goode J, Shamel L, Herskovits AA, Portnoy DA, Cooke M, Tarantino LM, Wiltshire T, Steinberg BE, Grinstein S, Beutler B", "evidence": [ { "database": "Reactome", "id": "R-HSA-1679131", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1679131" } ], "reference": [ { "type": "PubMed", "id": "16415873", "url": "https://glygen.org/publication/PubMed/16415873" } ] }, { "title": "Sensing of Lys 63-linked polyubiquitination by NEMO is a key event in NF-kappaB activation [corrected].", "journal": "Nature cell biology", "date": "2006", "authors": "Wu CJ, Conze DB, Li T, Srinivasula SM, Ashwell JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-168927", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168927" } ], "reference": [ { "type": "PubMed", "id": "16547522", "url": "https://glygen.org/publication/PubMed/16547522" } ] }, { "title": "Activation of IKK by TNFalpha requires site-specific ubiquitination of RIP1 and polyubiquitin binding by NEMO.", "journal": "Molecular cell", "date": "2006", "authors": "Ea CK, Deng L, Xia ZP, Pineda G, Chen ZJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-168927", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168927" } ], "reference": [ { "type": "PubMed", "id": "16603398", "url": "https://glygen.org/publication/PubMed/16603398" } ] }, { "title": "The dsRNA binding site of human Toll-like receptor 3.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Bell JK, Askins J, Hall PR, Davies DR, Segal DM", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "reference": [ { "type": "PubMed", "id": "16720699", "url": "https://glygen.org/publication/PubMed/16720699" } ] }, { "title": "Conserved features in the extracellular domain of human toll-like receptor 8 are essential for pH-dependent signaling.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Gibbard RJ, Morley PJ, Gay NJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1679131", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1679131" } ], "reference": [ { "type": "PubMed", "id": "16857668", "url": "https://glygen.org/publication/PubMed/16857668" } ] }, { "title": "Toll-like receptor 3 associates with c-Src tyrosine kinase on endosomes to initiate antiviral signaling.", "journal": "The EMBO journal", "date": "2006-07-26", "authors": "Johnsen Ingvild Bjellmo, Nguyen Thuy Thanh, Ringdal Monika, Tryggestad Anne Merete, Bakke Oddmund, Lien Egil, Espevik Terje, Anthonsen Marit W", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "reference": [ { "type": "PubMed", "id": "16858407", "url": "https://glygen.org/publication/PubMed/16858407" } ] }, { "title": "The human adaptor SARM negatively regulates adaptor protein TRIF-dependent Toll-like receptor signaling.", "journal": "Nature immunology", "date": "2006", "authors": "Carty M, Goodbody R, Schroder M, Stack J, Moynagh PN, Bowie AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-168164", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168164" } ], "reference": [ { "type": "PubMed", "id": "16964262", "url": "https://glygen.org/publication/PubMed/16964262" } ] }, { "title": "Herpes simplex virus encephalitis in human UNC-93B deficiency.", "journal": "Science (New York, N.Y.)", "date": "2006", "authors": "Casrouge A, Zhang SY, Eidenschenk C, Jouanguy E, Puel A, Yang K, Alcais A, Picard C, Mahfoufi N, Nicolas N, Lorenzo L, Plancoulaine S, Senechal B, Geissmann F, Tabeta K, Hoebe K, Du X, Miller RL, Heron B, Mignot C, de Villemeur TB, Lebon P, Dulac O, Rozenberg F, Beutler B, Tardieu M, Abel L, Casanova JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-1679131", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1679131" } ], "reference": [ { "type": "PubMed", "id": "16973841", "url": "https://glygen.org/publication/PubMed/16973841" } ] }, { "title": "Regulation and function of IKK and IKK-related kinases.", "journal": "Science's STKE : signal transduction knowledge environment", "date": "2006", "authors": "Hacker H, Karin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-1810476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1810476" } ], "reference": [ { "type": "PubMed", "id": "17047224", "url": "https://glygen.org/publication/PubMed/17047224" } ] }, { "title": "The innate immune facet of brain: human neurons express TLR-3 and sense viral dsRNA.", "journal": "J. Mol. Neurosci.", "date": "2006", "authors": "Lafon Monique, Megret Fran\u00e7oise, Lafage Mireille, Prehaud Christophe", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "reference": [ { "type": "PubMed", "id": "17085778", "url": "https://glygen.org/publication/PubMed/17085778" } ] }, { "title": "Site-specific Lys-63-linked tumor necrosis factor receptor-associated factor 6 auto-ubiquitination is a critical determinant of I kappa B kinase activation.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Lamothe B, Besse A, Campos AD, Webster WK, Wu H, Darnay BG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9014325", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9014325" } ], "reference": [ { "type": "PubMed", "id": "17135271", "url": "https://glygen.org/publication/PubMed/17135271" } ] }, { "title": "SHP-2 phosphatase negatively regulates the TRIF adaptor protein-dependent type I interferon and proinflammatory cytokine production.", "journal": "Immunity", "date": "2006", "authors": "An H, Zhao W, Hou J, Zhang Y, Xie Y, Zheng Y, Xu H, Qian C, Zhou J, Yu Y, Liu S, Feng G, Cao X", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013973", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013973" } ], "reference": [ { "type": "PubMed", "id": "17157040", "url": "https://glygen.org/publication/PubMed/17157040" } ] }, { "title": "Two tyrosine residues of Toll-like receptor 3 trigger different steps of NF-kappa B activation.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Sarkar SN, Elco CP, Peters KL, Chattopadhyay S, Sen GC", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" }, { "database": "iPTMnet", "id": "O15455", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15455" } ], "reference": [ { "type": "PubMed", "id": "17178723", "url": "https://glygen.org/publication/PubMed/17178723" } ] }, { "title": "Heat shock protein gp96 is a master chaperone for toll-like receptors and is important in the innate function of macrophages.", "journal": "Immunity", "date": "2007", "authors": "Yang Y, Liu B, Dai J, Srivastava PK, Zammit DJ, Lefrancois L, Li Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-1679131", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1679131" } ], "reference": [ { "type": "PubMed", "id": "17275357", "url": "https://glygen.org/publication/PubMed/17275357" } ] }, { "title": "Modulation of the interferon antiviral response by the TBK1/IKKi adaptor protein TANK.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Guo B, Cheng G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013973", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013973" } ], "reference": [ { "type": "PubMed", "id": "17327220", "url": "https://glygen.org/publication/PubMed/17327220" } ] }, { "title": "The interaction between the ER membrane protein UNC93B and TLR3, 7, and 9 is crucial for TLR signaling.", "journal": "The Journal of cell biology", "date": "2007", "authors": "Brinkmann MM, Spooner E, Hoebe K, Beutler B, Ploegh HL, Kim YM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1679131", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1679131" } ], "reference": [ { "type": "PubMed", "id": "17452530", "url": "https://glygen.org/publication/PubMed/17452530" } ] }, { "title": "Ubiquitin-mediated activation of TAK1 and IKK.", "journal": "Oncogene", "date": "2007", "authors": "Adhikari A, Xu M, Chen ZJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9014325", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9014325" } ], "reference": [ { "type": "PubMed", "id": "17496917", "url": "https://glygen.org/publication/PubMed/17496917" } ] }, { "title": "Interferon regulatory factor 3 is regulated by a dual phosphorylation-dependent switch.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Panne D, McWhirter SM, Maniatis T, Harrison SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013973", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013973" } ], "reference": [ { "type": "PubMed", "id": "17526488", "url": "https://glygen.org/publication/PubMed/17526488" } ] }, { "title": "TLR3 deficiency in patients with herpes simplex encephalitis.", "journal": "Science (New York, N.Y.)", "date": "2007", "authors": "Zhang SY, Jouanguy E, Ugolini S, Smahi A, Elain G, Romero P, Segal D, Sancho-Shimizu V, Lorenzo L, Puel A, Picard C, Chapgier A, Plancoulaine S, Titeux M, Cognet C, von Bernuth H, Ku CL, Casrouge A, Zhang XX, Barreiro L, Leonard J, Hamilton C, Lebon P, Heron B, Vallee L, Quintana-Murci L, Hovnanian A, Rozenberg F, Vivier E, Geissmann F, Tardieu M, Abel L, Casanova JL", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" }, { "database": "Reactome", "id": "R-HSA-5602410", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5602410" } ], "reference": [ { "type": "PubMed", "id": "17872438", "url": "https://glygen.org/publication/PubMed/17872438" } ] }, { "title": "Assessing the function of human UNC-93B in Toll-like receptor signaling and major histocompatibility complex II response.", "journal": "Human immunology", "date": "2007", "authors": "Koehn J, Huesken D, Jaritz M, Rot A, Zurini M, Dwertmann A, Beutler B, Korthauer U", "evidence": [ { "database": "Reactome", "id": "R-HSA-1679131", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1679131" } ], "reference": [ { "type": "PubMed", "id": "18082565", "url": "https://glygen.org/publication/PubMed/18082565" } ] }, { "title": "Cathepsins are required for Toll-like receptor 9 responses.", "journal": "Biochemical and biophysical research communications", "date": "2008", "authors": "Matsumoto F, Saitoh S, Fukui R, Kobayashi T, Tanimura N, Konno K, Kusumoto Y, Akashi-Takamura S, Miyake K", "evidence": [ { "database": "Reactome", "id": "R-HSA-1679131", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1679131" } ], "reference": [ { "type": "PubMed", "id": "18166152", "url": "https://glygen.org/publication/PubMed/18166152" } ] }, { "title": "The TLR3 signaling complex forms by cooperative receptor dimerization.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008-01-08", "authors": "Leonard Joshua N, Ghirlando Rodolfo, Askins Janine, Bell Jessica K, Margulies David H, Davies David R, Segal David M", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "reference": [ { "type": "PubMed", "id": "18172197", "url": "https://glygen.org/publication/PubMed/18172197" } ] }, { "title": "UNC93B1 delivers nucleotide-sensing toll-like receptors to endolysosomes.", "journal": "Nature", "date": "2008", "authors": "Kim YM, Brinkmann MM, Paquet ME, Ploegh HL", "evidence": [ { "database": "Reactome", "id": "R-HSA-1679131", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1679131" } ], "reference": [ { "type": "PubMed", "id": "18305481", "url": "https://glygen.org/publication/PubMed/18305481" } ] }, { "title": "Structural basis of toll-like receptor 3 signaling with double-stranded RNA.", "journal": "Science (New York, N.Y.)", "date": "2008", "authors": "Liu L, Botos I, Wang Y, Leonard JN, Shiloach J, Segal DM, Davies DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-168164", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168164" } ], "reference": [ { "type": "PubMed", "id": "18420935", "url": "https://glygen.org/publication/PubMed/18420935" } ] }, { "title": "Motif-specific sampling of phosphoproteomes.", "journal": "Journal of proteome research", "date": "2008", "authors": "Ruse CI, McClatchy DB, Lu B, Cociorva D, Motoyama A, Park SK, Yates JR 3rd", "evidence": [ { "database": "iPTMnet", "id": "O15455-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15455-1" } ], "reference": [ { "type": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" } ] }, { "title": "Endoplasmic reticulum HSP90b1 (gp96, grp94) optimizes B-cell function via chaperoning integrin and TLR but not immunoglobulin.", "journal": "Blood", "date": "2008", "authors": "Liu B, Li Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-1679131", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1679131" } ], "reference": [ { "type": "PubMed", "id": "18509083", "url": "https://glygen.org/publication/PubMed/18509083" } ] }, { "title": "Toll-like receptor 3 and geographic atrophy in age-related macular degeneration.", "journal": "N. Engl. J. Med.", "date": "2008", "authors": "Yang Zhenglin, Stratton Charity, Francis Peter J, Kleinman Mark E, Tan Perciliz L, Gibbs Daniel, Tong Zongzhong, Chen Haoyu, Constantine Ryan, Yang Xian, Chen Yuhong, Zeng Jiexi, Davey Lisa, Ma Xiang, Hau Vincent S, Wang Chi, Harmon Jennifer, Buehler Jeanette, Pearson Erik, Patel Shrena, Kaminoh Yuuki, Watkins Scott, Luo Ling, Zabriskie Norman A, Bernstein Paul S, Cho Wongil, Schwager Andrea, Hinton David R, Klein Michael L, Hamon Sara C, Simmons Emily, Yu Beifeng, Campochiaro Betsy, Sunness Janet S, Campochiaro Peter, Jorde Lynn, Parmigiani Giovanni, Zack Donald J, Katsanis Nicholas, Ambati Jayakrishna, Zhang Kang", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "reference": [ { "type": "PubMed", "id": "18753640", "url": "https://glygen.org/publication/PubMed/18753640" } ] }, { "title": "Natural selection in the TLR-related genes in the course of primate evolution.", "journal": "Immunogenetics", "date": "2008", "authors": "Nakajima Toshiaki, Ohtani Hitoshi, Satta Yoko, Uno Yasuhiro, Akari Hirofumi, Ishida Takafumi, Kimura Akinori", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "reference": [ { "type": "PubMed", "id": "18810425", "url": "https://glygen.org/publication/PubMed/18810425" } ] }, { "title": "The ectodomain of Toll-like receptor 9 is cleaved to generate a functional receptor.", "journal": "Nature", "date": "2008", "authors": "Ewald SE, Lee BL, Lau L, Wickliffe KE, Shi GP, Chapman HA, Barton GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1679131", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1679131" } ], "reference": [ { "type": "PubMed", "id": "18820679", "url": "https://glygen.org/publication/PubMed/18820679" } ] }, { "title": "Proteolytic cleavage in an endolysosomal compartment is required for activation of Toll-like receptor 9.", "journal": "Nature immunology", "date": "2008", "authors": "Park B, Brinkmann MM, Spooner E, Lee CC, Kim YM, Ploegh HL", "evidence": [ { "database": "Reactome", "id": "R-HSA-1679131", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1679131" } ], "reference": [ { "type": "PubMed", "id": "18931679", "url": "https://glygen.org/publication/PubMed/18931679" } ] }, { "title": "Receptor-interacting protein homotypic interaction motif-dependent control of NF-kappa B activation via the DNA-dependent activator of IFN regulatory factors.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2008", "authors": "Kaiser WJ, Upton JW, Mocarski ES", "evidence": [ { "database": "Reactome", "id": "R-HSA-1810476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1810476" } ], "reference": [ { "type": "PubMed", "id": "18941233", "url": "https://glygen.org/publication/PubMed/18941233" } ] }, { "title": "TLR9 traffics through the Golgi complex to localize to endolysosomes and respond to CpG DNA.", "journal": "Immunology and cell biology", "date": "2009", "authors": "Chockalingam A, Brooks JC, Cameron JL, Blum LK, Leifer CA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1679131", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1679131" } ], "reference": [ { "type": "PubMed", "id": "19079358", "url": "https://glygen.org/publication/PubMed/19079358" } ] }, { "title": "TRAF6 autoubiquitination-independent activation of the NFkappaB and MAPK pathways in response to IL-1 and RANKL.", "journal": "PloS one", "date": "2008", "authors": "Walsh MC, Kim GK, Maurizio PL, Molnar EE, Choi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9014325", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9014325" } ], "reference": [ { "type": "PubMed", "id": "19112497", "url": "https://glygen.org/publication/PubMed/19112497" } ] }, { "title": "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.", "journal": "Journal of proteome research", "date": "2009", "authors": "Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455#ptm_processing" }, { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "reference": [ { "type": "PubMed", "id": "19159218", "url": "https://glygen.org/publication/PubMed/19159218" } ] }, { "title": "Structural and biochemical studies on procaspase-8: new insights on initiator caspase activation.", "journal": "Structure (London, England : 1993)", "date": "2009", "authors": "Keller N, Mares J, Zerbe O, Grutter MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013957" } ], "reference": [ { "type": "PubMed", "id": "19278658", "url": "https://glygen.org/publication/PubMed/19278658" } ] }, { "title": "Unc93B1 biases Toll-like receptor responses to nucleic acid in dendritic cells toward DNA- but against RNA-sensing.", "journal": "The Journal of experimental medicine", "date": "2009", "authors": "Fukui R, Saitoh S, Matsumoto F, Kozuka-Hata H, Oyama M, Tabeta K, Beutler B, Miyake K", "evidence": [ { "database": "Reactome", "id": "R-HSA-1679131", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1679131" } ], "reference": [ { "type": "PubMed", "id": "19451267", "url": "https://glygen.org/publication/PubMed/19451267" } ] }, { "title": "DAI/ZBP1 recruits RIP1 and RIP3 through RIP homotypic interaction motifs to activate NF-kappaB.", "journal": "EMBO reports", "date": "2009", "authors": "Rebsamen M, Heinz LX, Meylan E, Michallet MC, Schroder K, Hofmann K, Vazquez J, Benedict CA, Tschopp J", "evidence": [ { "database": "Reactome", "id": "R-HSA-1810476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1810476" } ], "reference": [ { "type": "PubMed", "id": "19590578", "url": "https://glygen.org/publication/PubMed/19590578" } ] }, { "title": "NEMO-binding domains of both IKKalpha and IKKbeta regulate IkappaB kinase complex assembly and classical NF-kappaB activation.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Solt LA, Madge LA, May MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1810476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1810476" } ], "reference": [ { "type": "PubMed", "id": "19666475", "url": "https://glygen.org/publication/PubMed/19666475" } ] }, { "title": "Direct activation of protein kinases by unanchored polyubiquitin chains.", "journal": "Nature", "date": "2009", "authors": "Xia ZP, Sun L, Chen X, Pineda G, Jiang X, Adhikari A, Zeng W, Chen ZJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9014325", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9014325" } ], "reference": [ { "type": "PubMed", "id": "19675569", "url": "https://glygen.org/publication/PubMed/19675569" } ] }, { "title": "Different modes of ubiquitination of the adaptor TRAF3 selectively activate the expression of type I interferons and proinflammatory cytokines.", "journal": "Nature immunology", "date": "2010", "authors": "Tseng PH, Matsuzawa A, Zhang W, Mino T, Vignali DA, Karin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013973", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013973" } ], "reference": [ { "type": "PubMed", "id": "19898473", "url": "https://glygen.org/publication/PubMed/19898473" } ] }, { "title": "gp96, an endoplasmic reticulum master chaperone for integrins and Toll-like receptors, selectively regulates early T and B lymphopoiesis.", "journal": "Blood", "date": "2010", "authors": "Staron M, Yang Y, Liu B, Li J, Shen Y, Zuniga-Pflucker JC, Aguila HL, Goldschneider I, Li Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-1679131", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1679131" } ], "reference": [ { "type": "PubMed", "id": "19965672", "url": "https://glygen.org/publication/PubMed/19965672" } ] }, { "title": "Direct binding of TRAF2 and TRAF6 to TICAM-1/TRIF adaptor participates in activation of the Toll-like receptor 3/4 pathway.", "journal": "Molecular immunology", "date": "2010", "authors": "Sasai M, Tatematsu M, Oshiumi H, Funami K, Matsumoto M, Hatakeyama S, Seya T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9014325", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9014325" } ], "reference": [ { "type": "PubMed", "id": "20047764", "url": "https://glygen.org/publication/PubMed/20047764" } ] }, { "title": "Exploring the human leukocyte phosphoproteome using a microfluidic reversed-phase-TiO2-reversed-phase high-performance liquid chromatography phosphochip coupled to a quadrupole time-of-flight mass spectrometer.", "journal": "Analytical chemistry", "date": "2010", "authors": "Raijmakers R, Kraiczek K, de Jong AP, Mohammed S, Heck AJ", "evidence": [ { "database": "iPTMnet", "id": "O15455-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15455-1" } ], "reference": [ { "type": "PubMed", "id": "20058876", "url": "https://glygen.org/publication/PubMed/20058876" } ] }, { "title": "Inducible dimerization and inducible cleavage reveal a requirement for both processes in caspase-8 activation.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Oberst A, Pop C, Tremblay AG, Blais V, Denault JB, Salvesen GS, Green DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013957" } ], "reference": [ { "type": "PubMed", "id": "20308068", "url": "https://glygen.org/publication/PubMed/20308068" } ] }, { "title": "Respiratory syncytial virus-mediated NF-kappa B p65 phosphorylation at serine 536 is dependent on RIG-I, TRAF6, and IKK beta.", "journal": "Journal of virology", "date": "2010", "authors": "Yoboua F, Martel A, Duval A, Mukawera E, Grandvaux N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833110", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833110" } ], "reference": [ { "type": "PubMed", "id": "20410276", "url": "https://glygen.org/publication/PubMed/20410276" } ] }, { "title": "Aspartate-glutamate-alanine-histidine box motif (DEAH)/RNA helicase A helicases sense microbial DNA in human plasmacytoid dendritic cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Kim T, Pazhoor S, Bao M, Zhang Z, Hanabuchi S, Facchinetti V, Bover L, Plumas J, Chaperot L, Qin J, Liu YJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1810476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1810476" } ], "reference": [ { "type": "PubMed", "id": "20696886", "url": "https://glygen.org/publication/PubMed/20696886" } ] }, { "title": "Human TRAF3 adaptor molecule deficiency leads to impaired Toll-like receptor 3 response and susceptibility to herpes simplex encephalitis.", "journal": "Immunity", "date": "2010", "authors": "Perez de Diego R, Sancho-Shimizu V, Lorenzo L, Puel A, Plancoulaine S, Picard C, Herman M, Cardon A, Durandy A, Bustamante J, Vallabhapurapu S, Bravo J, Warnatz K, Chaix Y, Cascarrigny F, Lebon P, Rozenberg F, Karin M, Tardieu M, Al-Muhsen S, Jouanguy E, Zhang SY, Abel L, Casanova JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5602571", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5602571" } ], "reference": [ { "type": "PubMed", "id": "20832341", "url": "https://glygen.org/publication/PubMed/20832341" } ] }, { "title": "Secretion of the human Toll-like receptor 3 ectodomain is affected by single nucleotide polymorphisms and regulated by Unc93b1.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Qi R, Hoose S, Schreiter J, Sawant KV, Lamb R, Ranjith-Kumar CT, Mills J, San Mateo L, Jordan JL, Kao CC", "evidence": [ { "database": "Reactome", "id": "R-HSA-1679131", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1679131" } ], "reference": [ { "type": "PubMed", "id": "20855885", "url": "https://glygen.org/publication/PubMed/20855885" } ] }, { "title": "Folding of Toll-like receptors by the HSP90 paralogue gp96 requires a substrate-specific cochaperone.", "journal": "Nature communications", "date": "2010", "authors": "Liu B, Yang Y, Qiu Z, Staron M, Hong F, Li Y, Wu S, Li Y, Hao B, Bona R, Han D, Li Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-1679131", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1679131" } ], "reference": [ { "type": "PubMed", "id": "20865800", "url": "https://glygen.org/publication/PubMed/20865800" } ] }, { "title": "Mechanism of endosomal TLR inhibition by antimalarial drugs and imidazoquinolines.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2011", "authors": "Kuznik A, Bencina M, Svajger U, Jeras M, Rozman B, Jerala R", "evidence": [ { "database": "Reactome", "id": "R-HSA-1679131", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1679131" } ], "reference": [ { "type": "PubMed", "id": "21398612", "url": "https://glygen.org/publication/PubMed/21398612" } ] }, { "title": "Nucleic acid recognition by Toll-like receptors is coupled to stepwise processing by cathepsins and asparagine endopeptidase.", "journal": "The Journal of experimental medicine", "date": "2011", "authors": "Ewald SE, Engel A, Lee J, Wang M, Bogyo M, Barton GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1679131", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1679131" } ], "reference": [ { "type": "PubMed", "id": "21402738", "url": "https://glygen.org/publication/PubMed/21402738" } ] }, { "title": "Negative regulation of signaling by a soluble form of toll-like receptor 9.", "journal": "European journal of immunology", "date": "2011", "authors": "Chockalingam A, Cameron JL, Brooks JC, Leifer CA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1679131", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1679131" } ], "reference": [ { "type": "PubMed", "id": "21604257", "url": "https://glygen.org/publication/PubMed/21604257" } ] }, { "title": "The Ripoptosome, a signaling platform that assembles in response to genotoxic stress and loss of IAPs.", "journal": "Molecular cell", "date": "2011", "authors": "Tenev T, Bianchi K, Darding M, Broemer M, Langlais C, Wallberg F, Zachariou A, Lopez J, MacFarlane M, Cain K, Meier P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013957" } ], "reference": [ { "type": "PubMed", "id": "21737329", "url": "https://glygen.org/publication/PubMed/21737329" } ] }, { "title": "cIAPs block Ripoptosome formation, a RIP1/caspase-8 containing intracellular cell death complex differentially regulated by cFLIP isoforms.", "journal": "Molecular cell", "date": "2011", "authors": "Feoktistova M, Geserick P, Kellert B, Dimitrova DP, Langlais C, Hupe M, Cain K, MacFarlane M, Hacker G, Leverkus M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013957" } ], "reference": [ { "type": "PubMed", "id": "21737330", "url": "https://glygen.org/publication/PubMed/21737330" } ] }, { "title": "Herpes simplex virus encephalitis in a patient with complete TLR3 deficiency: TLR3 is otherwise redundant in protective immunity.", "journal": "The Journal of experimental medicine", "date": "2011", "authors": "Guo Y, Audry M, Ciancanelli M, Alsina L, Azevedo J, Herman M, Anguiano E, Sancho-Shimizu V, Lorenzo L, Pauwels E, Philippe PB, Perez de Diego R, Cardon A, Vogt G, Picard C, Andrianirina ZZ, Rozenberg F, Lebon P, Plancoulaine S, Tardieu M, Valerie Doireau, Jouanguy E, Chaussabel D, Geissmann F, Abel L, Casanova JL, Zhang SY", "evidence": [ { "database": "Reactome", "id": "R-HSA-5602410", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5602410" } ], "reference": [ { "type": "PubMed", "id": "21911422", "url": "https://glygen.org/publication/PubMed/21911422" } ] }, { "title": "cIAP1/2 are direct E3 ligases conjugating diverse types of ubiquitin chains to receptor interacting proteins kinases 1 to 4 (RIP1-4).", "journal": "PloS one", "date": "2011", "authors": "Bertrand MJ, Lippens S, Staes A, Gilbert B, Roelandt R, De Medts J, Gevaert K, Declercq W, Vandenabeele P", "evidence": [ { "database": "Reactome", "id": "R-HSA-168927", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168927" } ], "reference": [ { "type": "PubMed", "id": "21931591", "url": "https://glygen.org/publication/PubMed/21931591" } ] }, { "title": "Respiratory syncytial virus glycoprotein G interacts with DC-SIGN and L-SIGN to activate ERK1 and ERK2.", "journal": "Journal of virology", "date": "2012-02", "authors": "Johnson Teresa R, McLellan Jason S, Graham Barney S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833110", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833110" } ], "reference": [ { "type": "PubMed", "id": "22090124", "url": "https://glygen.org/publication/PubMed/22090124" } ] }, { "title": "Herpes simplex encephalitis in children with autosomal recessive and dominant TRIF deficiency.", "journal": "The Journal of clinical investigation", "date": "2011", "authors": "Sancho-Shimizu V, Perez de Diego R, Lorenzo L, Halwani R, Alangari A, Israelsson E, Fabrega S, Cardon A, Maluenda J, Tatematsu M, Mahvelati F, Herman M, Ciancanelli M, Guo Y, AlSum Z, Alkhamis N, Al-Makadma AS, Ghadiri A, Boucherit S, Plancoulaine S, Picard C, Rozenberg F, Tardieu M, Lebon P, Jouanguy E, Rezaei N, Seya T, Matsumoto M, Chaussabel D, Puel A, Zhang SY, Abel L, Al-Muhsen S, Casanova JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5602566", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5602566" } ], "reference": [ { "type": "PubMed", "id": "22105173", "url": "https://glygen.org/publication/PubMed/22105173" } ] }, { "title": "Toll-like receptors activate programmed necrosis in macrophages through a receptor-interacting kinase-3-mediated pathway.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2011", "authors": "He S, Liang Y, Shao F, Wang X", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013957" } ], "reference": [ { "type": "PubMed", "id": "22123964", "url": "https://glygen.org/publication/PubMed/22123964" } ] }, { "title": "UNC93B1 physically associates with human TLR8 and regulates TLR8-mediated signaling.", "journal": "PloS one", "date": "2011", "authors": "Itoh H, Tatematsu M, Watanabe A, Iwano K, Funami K, Seya T, Matsumoto M", "evidence": [ { "database": "Reactome", "id": "R-HSA-1679131", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1679131" } ], "reference": [ { "type": "PubMed", "id": "22164301", "url": "https://glygen.org/publication/PubMed/22164301" } ] }, { "title": "A common polymorphism in TLR3 confers natural resistance to HIV-1 infection.", "journal": "J. Immunol.", "date": "2012", "authors": "Sironi Manuela, Biasin Mara, Cagliani Rachele, Forni Diego, De Luca Mariacristina, Saulle Irma, Lo Caputo Sergio, Mazzotta Francesco, Mac\u00edas Juan, Pineda Juan A, Caruz Antonio, Clerici Mario", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "reference": [ { "type": "PubMed", "id": "22174453", "url": "https://glygen.org/publication/PubMed/22174453" } ] }, { "title": "The molecular chaperone gp96/GRP94 interacts with Toll-like receptors and integrins via its C-terminal hydrophobic domain.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Wu S, Hong F, Gewirth D, Guo B, Liu B, Li Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-1679131", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1679131" } ], "reference": [ { "type": "PubMed", "id": "22223641", "url": "https://glygen.org/publication/PubMed/22223641" } ] }, { "title": "dsRNA induces apoptosis through an atypical death complex associating TLR3 to caspase-8.", "journal": "Cell death and differentiation", "date": "2012", "authors": "Estornes Y, Toscano F, Virard F, Jacquemin G, Pierrot A, Vanbervliet B, Bonnin M, Lalaoui N, Mercier-Gouy P, Pacheco Y, Salaun B, Renno T, Micheau O, Lebecque S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013957", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013957" } ], "reference": [ { "type": "PubMed", "id": "22421964", "url": "https://glygen.org/publication/PubMed/22421964" } ] }, { "title": "Lateral clustering of TLR3:dsRNA signaling units revealed by TLR3ecd:3Fabs quaternary structure.", "journal": "Journal of molecular biology", "date": "2012", "authors": "Luo J, Obmolova G, Malia TJ, Wu SJ, Duffy KE, Marion JD, Bell JK, Ge P, Zhou ZH, Teplyakov A, Zhao Y, Lamb RJ, Jordan JL, San Mateo LR, Sweet RW, Gilliland GL", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455#ptm_processing" }, { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "reference": [ { "type": "PubMed", "id": "22579623", "url": "https://glygen.org/publication/PubMed/22579623" } ] }, { "title": "Cleavage of Toll-like receptor 3 by cathepsins B and H is essential for signaling.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2012", "authors": "Garcia-Cattaneo A, Gobert FX, Muller M, Toscano F, Flores M, Lescure A, Del Nery E, Benaroch P", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "reference": [ { "type": "PubMed", "id": "22611194", "url": "https://glygen.org/publication/PubMed/22611194" } ] }, { "title": "Impaired intrinsic immunity to HSV-1 in human iPSC-derived TLR3-deficient CNS cells.", "journal": "Nature", "date": "2012", "authors": "Lafaille FG, Pessach IM, Zhang SY, Ciancanelli MJ, Herman M, Abhyankar A, Ying SW, Keros S, Goldstein PA, Mostoslavsky G, Ordovas-Montanes J, Jouanguy E, Plancoulaine S, Tu E, Elkabetz Y, Al-Muhsen S, Tardieu M, Schlaeger TM, Daley GQ, Abel L, Casanova JL, Studer L, Notarangelo LD", "evidence": [ { "database": "Reactome", "id": "R-HSA-5602415", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5602415" } ], "reference": [ { "type": "PubMed", "id": "23103873", "url": "https://glygen.org/publication/PubMed/23103873" } ] }, { "title": "Crystal structure and mechanism of activation of TANK-binding kinase 1.", "journal": "Cell reports", "date": "2013", "authors": "Larabi A, Devos JM, Ng SL, Nanao MH, Round A, Maniatis T, Panne D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013973", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013973" } ], "reference": [ { "type": "PubMed", "id": "23453971", "url": "https://glygen.org/publication/PubMed/23453971" } ] }, { "title": "N-linked glycosylation enrichment for in-depth cell surface proteomics of diffuse large B-cell lymphoma subtypes.", "journal": "Molecular & cellular proteomics : MCP", "date": "2014", "authors": "Deeb SJ, Cox J, Schmidt-Supprian M, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "24190977", "url": "https://glygen.org/publication/PubMed/24190977" } ] }, { "title": "The inducible nitric-oxide synthase (iNOS)/Src axis mediates Toll-like receptor 3 tyrosine 759 phosphorylation and enhances its signal transduction, leading to interferon-beta synthesis in macrophages.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Hsieh MY, Chang MY, Chen YJ, Li YK, Chuang TH, Yu GY, Cheung CH, Chen HC, Maa MC, Leu TH", "evidence": [ { "database": "iPTMnet", "id": "O15455", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15455" } ], "reference": [ { "type": "PubMed", "id": "24526685", "url": "https://glygen.org/publication/PubMed/24526685" } ] }, { "title": "WDFY1 mediates TLR3/4 signaling by recruiting TRIF.", "journal": "EMBO reports", "date": "2015", "authors": "Hu YH, Zhang Y, Jiang LQ, Wang S, Lei CQ, Sun MS, Shu HB, Liu Y", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "reference": [ { "type": "PubMed", "id": "25736436", "url": "https://glygen.org/publication/PubMed/25736436" } ] }, { "title": "Interaction between human BAP31 and respiratory syncytial virus small hydrophobic (SH) protein.", "journal": "Virology", "date": "2015-08", "authors": "Li Yan, Jain Neeraj, Limpanawat Suweeraya, To Janet, Quistgaard Esben M, Nordlund Par, Thanabalu Thirumaran, Torres Jaume", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833110", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833110" } ], "reference": [ { "type": "PubMed", "id": "25854864", "url": "https://glygen.org/publication/PubMed/25854864" } ] }, { "title": "Interferon beta (IFN-beta) Production during the Double-stranded RNA (dsRNA) Response in Hepatocytes Involves Coordinated and Feedforward Signaling through Toll-like Receptor 3 (TLR3), RNA-dependent Protein Kinase (PKR), Inducible Nitric Oxide Synthase (iNOS), and Src Protein.", "journal": "The Journal of biological chemistry", "date": "2016", "authors": "Zhang L, Xiang W, Wang G, Yan Z, Zhu Z, Guo Z, Sengupta R, Chen AF, Loughran PA, Lu B, Wang Q, Billiar TR", "evidence": [ { "database": "iPTMnet", "id": "O15455", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15455" } ], "reference": [ { "type": "PubMed", "id": "27226571", "url": "https://glygen.org/publication/PubMed/27226571" } ] }, { "title": "Double phosphorylation-induced structural changes in the signal-receiving domain of IkappaBalpha in complex with NF-kappaB.", "journal": "Proteins", "date": "2017", "authors": "Yazdi S, Naumann M, Stein M", "evidence": [ { "database": "Reactome", "id": "R-HSA-1810476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1810476" } ], "reference": [ { "type": "PubMed", "id": "27701768", "url": "https://glygen.org/publication/PubMed/27701768" } ] }, { "title": "Probing subtle conformational changes induced by phosphorylation and point mutations in the TIR domains of TLR2 and TLR3.", "journal": "Proteins", "date": "2018", "authors": "Mahita J, Sowdhamini R", "evidence": [ { "database": "iPTMnet", "id": "O15455", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15455" } ], "reference": [ { "type": "PubMed", "id": "29383749", "url": "https://glygen.org/publication/PubMed/29383749" } ] }, { "title": "Stimulation of TLR3 triggers release of lysosomal ATP in astrocytes and epithelial cells that requires TRPML1 channels.", "journal": "Scientific reports", "date": "2018", "authors": "Beckel JM, Gomez NM, Lu W, Campagno KE, Nabet B, Albalawi F, Lim JC, Boesze-Battaglia K, Mitchell CH", "evidence": [ { "database": "iPTMnet", "id": "O15455", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15455" } ], "reference": [ { "type": "PubMed", "id": "29636491", "url": "https://glygen.org/publication/PubMed/29636491" } ] }, { "title": "E3 ubiquitin ligase RNF170 inhibits innate immune responses by targeting and degrading TLR3 in murine cells.", "journal": "Cellular & molecular immunology", "date": "2020", "authors": "Song X, Liu S, Wang W, Ma Z, Cao X, Jiang M", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "reference": [ { "type": "PubMed", "id": "31076723", "url": "https://glygen.org/publication/PubMed/31076723" } ] }, { "title": "Ubiquitination of TLR3 by TRIM3 signals its ESCRT-mediated trafficking to the endolysosomes for innate antiviral response.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2020", "authors": "Li WW, Nie Y, Yang Y, Ran Y, Luo WW, Xiong MG, Wang SY, Xu ZS, Wang YY", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "reference": [ { "type": "PubMed", "id": "32878999", "url": "https://glygen.org/publication/PubMed/32878999" } ] }, { "title": "Inborn errors of type I IFN immunity in patients with life-threatening COVID-19.", "journal": "Science (New York, N.Y.)", "date": "2020", "authors": "Zhang Q, Bastard P, Liu Z, Le Pen J, Moncada-Velez M, Chen J, Ogishi M, Sabli IKD, Hodeib S, Korol C, Rosain J, Bilguvar K, Ye J, Bolze A, Bigio B, Yang R, Arias AA, Zhou Q, Zhang Y, Onodi F, Korniotis S, Karpf L, Philippot Q, Chbihi M, Bonnet-Madin L, Dorgham K, Smith N, Schneider WM, Razooky BS, Hoffmann HH, Michailidis E, Moens L, Han JE, Lorenzo L, Bizien L, Meade P, Neehus AL, Ugurbil AC, Corneau A, Kerner G, Zhang P, Rapaport F, Seeleuthner Y, Manry J, Masson C, Schmitt Y, Schluter A, Le Voyer T, Khan T, Li J, Fellay J, Roussel L, Shahrooei M, Alosaimi MF, Mansouri D, Al-Saud H, Al-Mulla F, Almourfi F, Al-Muhsen SZ, Alsohime F, Al Turki S, Hasanato R, van de Beek D, Biondi A, Bettini LR, D'Angio' M, Bonfanti P, Imberti L, Sottini A, Paghera S, Quiros-Roldan E, Rossi C, Oler AJ, Tompkins MF, Alba C, Vandernoot I, Goffard JC, Smits G, Migeotte I, Haerynck F, Soler-Palacin P, Martin-Nalda A, Colobran R, Morange PE, Keles S, Colkesen F, Ozcelik T, Yasar KK, Senoglu S, Karabela SN, Rodriguez-Gallego C, Novelli G, Hraiech S, Tandjaoui-Lambiotte Y, Duval X, Laouenan C, Snow AL, Dalgard CL, Milner JD, Vinh DC, Mogensen TH, Marr N, Spaan AN, Boisson B, Boisson-Dupuis S, Bustamante J, Puel A, Ciancanelli MJ, Meyts I, Maniatis T, Soumelis V, Amara A, Nussenzweig M, Garcia-Sastre A, Krammer F, Pujol A, Duffy D, Lifton RP, Zhang SY, Gorochov G, Beziat V, Jouanguy E, Sancho-Shimizu V, Rice CM, Abel L, Notarangelo LD, Cobat A, Su HC, Casanova JL", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "reference": [ { "type": "PubMed", "id": "32972995", "url": "https://glygen.org/publication/PubMed/32972995" } ] }, { "title": "Cryo-EM structures of Toll-like receptors in complex with UNC93B1.", "journal": "Nat. Struct. Mol. Biol.", "date": "2021", "authors": "Ishida H, Asami J, Zhang Z, Nishizawa T, Shigematsu H, Ohto U, Shimizu T", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "reference": [ { "type": "PubMed", "id": "33432245", "url": "https://glygen.org/publication/PubMed/33432245" } ] }, { "title": "Endo-M Mediated Chemoenzymatic Approach Enables Reversible Glycopeptide Labeling for O-GlcNAcylation Analysis.", "journal": "Angewandte Chemie (International ed. in English)", "date": "2022", "authors": "Chen Y, Tang F, Qin H, Yue X, Nie Y, Huang W, Ye M", "evidence": [ { "database": "O-GlcNAc Database", "id": "O15455", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O15455" } ], "reference": [ { "type": "PubMed", "id": "35289036", "url": "https://glygen.org/publication/PubMed/35289036" } ] }, { "title": "An Unexpected Encounter: Respiratory Syncytial Virus Nonstructural Protein 1 Interacts with Mediator Subunit MED25.", "journal": "Journal of virology", "date": "2022-10-12", "authors": "Van Royen Tessa, Sedeyn Koen, Moschonas George D, Toussaint Wendy, Vuylsteke Marnik, Van Haver Delphi, Impens Francis, Eyckerman Sven, Lemmens Irma, Tavernier Jan, Schepens Bert, Saelens Xavier", "evidence": [ { "database": "Reactome", "id": "R-HSA-9833110", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833110" } ], "reference": [ { "type": "PubMed", "id": "36102648", "url": "https://glygen.org/publication/PubMed/36102648" } ] }, { "title": "The Src-ZNRF1 axis controls TLR3 trafficking and interferon responses to limit lung barrier damage.", "journal": "The Journal of experimental medicine", "date": "2023-08-07", "authors": "Lin You-Sheng, Chang Yung-Chi, Chao Tai-Ling, Tsai Ya-Min, Jhuang Shu-Jhen, Ho Yu-Hsin, Lai Ting-Yu, Liu Yi-Ling, Chen Chiung-Ya, Tsai Ching-Yen, Hsueh Yi-Ping, Chang Sui-Yuan, Chuang Tsung-Hsien, Lee Chih-Yuan, Hsu Li-Chung", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "reference": [ { "type": "PubMed", "id": "37158982", "url": "https://glygen.org/publication/PubMed/37158982" } ] }, { "title": "TLR3 Gene Polymorphism in HCV Infection in the Kazakh Population of Western Kazakhstan.", "journal": "Asian Pacific journal of cancer prevention : APJCP", "date": "2023-11-01", "authors": "Nurlanova Gulzhanat, Zhumagaliyeva Galina, Iskakova Aigerim, Astrakhanov Akezhan, Kurmangazin Meirambek", "evidence": [ { "database": "RefSeq", "id": "NP_003256", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003256" } ], "reference": [ { "type": "PubMed", "id": "38019252", "url": "https://glygen.org/publication/PubMed/38019252" } ] }, { "title": "The effect of TLR3 priming conditions on MSC immunosuppressive properties.", "journal": "Stem cell research & therapy", "date": "2023-11-29", "authors": "Tolstova Tatiana, Dotsenko Ekaterina, Kozhin Peter, Novikova Svetlana, Zgoda Victor, Rusanov Alexander, Luzgina Nataliya", "evidence": [ { "database": "RefSeq", "id": "NP_003256", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003256" } ], "reference": [ { "type": "PubMed", "id": "38031182", "url": "https://glygen.org/publication/PubMed/38031182" } ] }, { "title": "Glioma-derived ANXA1 suppresses the immune response to TLR3 ligands by promoting an anti-inflammatory tumor microenvironment.", "journal": "Cellular & molecular immunology", "date": "2024-01", "authors": "Zheng Yu, Jiang Haihui, Yang Naixue, Shen Shaoping, Huang Daosheng, Jia Lemei, Ling Jing, Xu Longchen, Li Mingxiao, Yu Kefu, Ren Xiaohui, Cui Yong, Lan Xun, Lin Song, Lin Xin", "evidence": [ { "database": "RefSeq", "id": "NP_003256", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003256" } ], "reference": [ { "type": "PubMed", "id": "38049523", "url": "https://glygen.org/publication/PubMed/38049523" } ] }, { "title": "The Functional Mechanisms of Toll-Like Receptor 3 and Its Implications in Digestive System Tumors.", "journal": "Frontiers in bioscience (Landmark edition)", "date": "2023-11-24", "authors": "Han Bin, Zhang Chao, Wang Xiaoxiao, Song Huangqin, Zhang Lei, Li Tao, He Jiefeng, Zhao Haoliang", "evidence": [ { "database": "RefSeq", "id": "NP_003256", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003256" } ], "reference": [ { "type": "PubMed", "id": "38062829", "url": "https://glygen.org/publication/PubMed/38062829" } ] }, { "title": "Analysis of associations between the TLR3 SNPs rs3775291 and rs3775290 and COVID-19 in a cohort of professionals of Bel\u00e9m-PA, Brazil.", "journal": "Frontiers in cellular and infection microbiology", "date": "2023", "authors": "Silva Marcos Jess\u00e9 Abrah\u00e3o, Vieira Marcelo Cleyton da Silva, Souza Alex Brito, Dos Santos Everaldina Cordeiro, Marcelino Beatriz Dos Reis, Casseb Samir Mansour Moraes, Lima Karla Val\u00e9ria Batista, Lima Luana Nepomuceno Gondim Costa", "evidence": [ { "database": "RefSeq", "id": "NP_003256", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003256" } ], "reference": [ { "type": "PubMed", "id": "38173795", "url": "https://glygen.org/publication/PubMed/38173795" } ] }, { "title": "Tumor rejection antigen gp96/grp94 is an ATPase: implications for protein folding and antigen presentation.", "journal": "The EMBO journal", "date": "1993", "authors": "Li Z, Srivastava PK", "evidence": [ { "database": "Reactome", "id": "R-HSA-1679131", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1679131" } ], "reference": [ { "type": "PubMed", "id": "8344253", "url": "https://glygen.org/publication/PubMed/8344253" } ] }, { "title": "A family of human receptors structurally related to Drosophila Toll.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1998", "authors": "Rock FL, Hardiman G, Timans JC, Kastelein RA, Bazan JF", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "reference": [ { "type": "PubMed", "id": "9435236", "url": "https://glygen.org/publication/PubMed/9435236" } ] }, { "title": "Virus-dependent phosphorylation of the IRF-3 transcription factor regulates nuclear translocation, transactivation potential, and proteasome-mediated degradation.", "journal": "Molecular and cellular biology", "date": "1998", "authors": "Lin R, Heylbroeck C, Pitha PM, Hiscott J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9013973", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013973" } ], "reference": [ { "type": "PubMed", "id": "9566918", "url": "https://glygen.org/publication/PubMed/9566918" } ] }, { "title": "CpG-DNA-specific activation of antigen-presenting cells requires stress kinase activity and is preceded by non-specific endocytosis and endosomal maturation.", "journal": "The EMBO journal", "date": "1998", "authors": "Hacker H, Mischak H, Miethke T, Liptay S, Schmid R, Sparwasser T, Heeg K, Lipford GB, Wagner H", "evidence": [ { "database": "Reactome", "id": "R-HSA-1679131", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1679131" } ], "reference": [ { "type": "PubMed", "id": "9799232", "url": "https://glygen.org/publication/PubMed/9799232" } ] } ], "pathway": [ { "id": "hsa:7098", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:7098", "resource": "KEGG Pathway" }, { "id": "R-HSA-1679131", "name": "Trafficking and processing of endosomal TLR", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1679131", "resource": "Reactome", "description": "Trafficking and processing of endosomal TLR" }, { "id": "R-HSA-168164", "name": "Toll Like Receptor 3 (TLR3) Cascade", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168164", "resource": "Reactome", "description": "Toll Like Receptor 3 (TLR3) Cascade" }, { "id": "R-HSA-168927", "name": "TICAM1, RIP1-mediated IKK complex recruitment", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168927", "resource": "Reactome", "description": "TICAM1, RIP1-mediated IKK complex recruitment" }, { "id": "R-HSA-1810476", "name": "RIP-mediated NFkB activation via ZBP1", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1810476", "resource": "Reactome", "description": "RIP-mediated NFkB activation via ZBP1" }, { "id": "R-HSA-5602410", "name": "TLR3 deficiency - HSE", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5602410", "resource": "Reactome", "description": "TLR3 deficiency - HSE" }, { "id": "R-HSA-5602415", "name": "UNC93B1 deficiency - HSE", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5602415", "resource": "Reactome", "description": "UNC93B1 deficiency - HSE" }, { "id": "R-HSA-5602566", "name": "TICAM1 deficiency - HSE", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5602566", "resource": "Reactome", "description": "TICAM1 deficiency - HSE" }, { "id": "R-HSA-5602571", "name": "TRAF3 deficiency - HSE", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5602571", "resource": "Reactome", "description": "TRAF3 deficiency - HSE" }, { "id": "R-HSA-9013957", "name": "TLR3-mediated TICAM1-dependent programmed cell death", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013957", "resource": "Reactome", "description": "TLR3-mediated TICAM1-dependent programmed cell death" }, { "id": "R-HSA-9013973", "name": "TICAM1-dependent activation of IRF3/IRF7", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013973", "resource": "Reactome", "description": "TICAM1-dependent activation of IRF3/IRF7" }, { "id": "R-HSA-9014325", "name": "TICAM1,TRAF6-dependent induction of TAK1 complex", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9014325", "resource": "Reactome", "description": "TICAM1,TRAF6-dependent induction of TAK1 complex" }, { "id": "R-HSA-9833110", "name": "RSV-host interactions", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9833110", "resource": "Reactome", "description": "RSV-host interactions" } ], "orthologs": [ { "uniprot_canonical_ac": "F1LN63-1", "protein_name": "Toll-like receptor 3", "gene_name": "Tlr3", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MKGRSSYLIYSFGGLLSLWILVVSSTNQCTVRYNVADCSHLKLTHIPDDLPSNITVLNLTHNQLRGLPPANFTRYSQLALLDAGFNSISKLEPELCQILPLLKVLNLQHNELSQISDQTFAFCTNLTELHLMSNSIRKIKSNPFKNQKSLIKLDLSRNGLSSTKLGTGVQLENLQELLLAKNKIFALRSEELDFLGNSSLQKLDLSSNPLKEFSPGCFHAIGKLFVLLLNNAQLNLNLTEKLCWELSNTSIQNLSLANNQLLATSNSTFSGLKQTNLTSLDLSYNSLRYVGNDAFSWLPHLKYLSLEYNNIQSLTPHSFRGLSNLRYLSLKRAFTKQSVALASHPNIDDFSFQWLKCLEHLNMDDNTIPGIKSNTFTGLVSLKYLSLSKTFTGLQTLTNETFVSLTHSPLLTLNLTKNHISKIASGTFSWLGQLRILDLGLNEIEQELTGQEWRGLGNIFEIYLSYNKYLQLTSKSFTLVPSLQRLMLRRVALKSVDISPSPFRPLYNLTILDLSNNNIANLNEDLLEGLENLEILDFQHNNLARLWKHANPGGPVNFLKGLSHLHILNLESNGLDEIPVKVFKNLFELKSINLGLNNLNTLLPSIFDDQTSLRSLNLQKNLITSVEKSVFGPAFHNLNSLDMSFNPFDCTCESIAWFVTWLNQTHTNIPELSTHYLCNTPQRYHGLPVKLFDTSSCKDSAPFQLLFIINTSTLLTFILAVLLIHFEGWRISFYWNVSVHRILGFKEIDAQGEQFEYTAYIIHAQKDRDWVWEHFSPMEEQDQSLKFCLEERDFEAGVLGLEAIVNSIKRSRKIIFVITHHLLKDPLCRRFKVHHAVQQAIEQNLDSIILIFLQNIPDYKLNHALCLRRGMFKSHCILNWPIQKERINAFHHKLQVALGSRNSAH", "length": 905 }, "evidence": [ { "id": "45918154", "url": "http://www.informatics.jax.org/homology/45918154", "database": "MGI" }, { "id": "O15455", "url": "https://omabrowser.org/oma/group/O15455/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q99MB1-1", "protein_name": "Toll-like receptor 3", "gene_name": "Tlr3", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MKGCSSYLMYSFGGLLSLWILLVSSTNQCTVRYNVADCSHLKLTHIPDDLPSNITVLNLTHNQLRRLPPTNFTRYSQLAILDAGFNSISKLEPELCQILPLLKVLNLQHNELSQISDQTFVFCTNLTELDLMSNSIHKIKSNPFKNQKNLIKLDLSHNGLSSTKLGTGVQLENLQELLLAKNKILALRSEELEFLGNSSLRKLDLSSNPLKEFSPGCFQTIGKLFALLLNNAQLNPHLTEKLCWELSNTSIQNLSLANNQLLATSESTFSGLKWTNLTQLDLSYNNLHDVGNGSFSYLPSLRYLSLEYNNIQRLSPRSFYGLSNLRYLSLKRAFTKQSVSLASHPNIDDFSFQWLKYLEYLNMDDNNIPSTKSNTFTGLVSLKYLSLSKTFTSLQTLTNETFVSLAHSPLLTLNLTKNHISKIANGTFSWLGQLRILDLGLNEIEQKLSGQEWRGLRNIFEIYLSYNKYLQLSTSSFALVPSLQRLMLRRVALKNVDISPSPFRPLRNLTILDLSNNNIANINEDLLEGLENLEILDFQHNNLARLWKRANPGGPVNFLKGLSHLHILNLESNGLDEIPVGVFKNLFELKSINLGLNNLNKLEPFIFDDQTSLRSLNLQKNLITSVEKDVFGPPFQNLNSLDMRFNPFDCTCESISWFVNWINQTHTNISELSTHYLCNTPHHYYGFPLKLFDTSSCKDSAPFELLFIISTSMLLVFILVVLLIHIEGWRISFYWNVSVHRILGFKEIDTQAEQFEYTAYIIHAHKDRDWVWEHFSPMEEQDQSLKFCLEERDFEAGVLGLEAIVNSIKRSRKIIFVITHHLLKDPLCRRFKVHHAVQQAIEQNLDSIILIFLQNIPDYKLNHALCLRRGMFKSHCILNWPVQKERINAFHHKLQVALGSRNSAH", "length": 905 }, "evidence": [ { "id": "45918154", "url": "http://www.informatics.jax.org/homology/45918154", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 46, "go_terms": [ { "name": "cellular response to exogenous dsRNA", "id": "GO:0071360", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071360", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "pmid": "" }, { "name": "positive regulation of interferon-alpha production", "id": "GO:0032727", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032727", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "pmid": "" }, { "name": "regulation of dendritic cell cytokine production", "id": "GO:0002730", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002730", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "pmid": "" }, { "name": "positive regulation of type III interferon production", "id": "GO:0034346", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034346", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "pmid": "" }, { "name": "microglial cell activation", "id": "GO:0001774", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001774", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "pmid": "" }, { "name": "signal transduction", "id": "GO:0007165", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007165", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "pmid": "" }, { "name": "positive regulation of gene expression", "id": "GO:0010628", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010628", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "pmid": "" }, { "name": "positive regulation of apoptotic process", "id": "GO:0043065", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043065", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "pmid": "" }, { "name": "innate immune response", "id": "GO:0045087", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045087", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "pmid": "" }, { "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "pmid": "" }, { "name": "positive regulation of JNK cascade", "id": "GO:0046330", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046330", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "pmid": "" }, { "name": "defense response to virus", "id": "GO:0051607", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051607", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "pmid": "" }, { "name": "positive regulation of non-canonical NF-kappaB signal transduction", "id": "GO:1901224", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901224", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "pmid": "" }, { "name": "JNK cascade", "id": "GO:0007254", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007254", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "pmid": "" }, { "name": "positive regulation of chemokine production", "id": "GO:0032722", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032722", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "pmid": "" }, { "name": "positive regulation of interleukin-6 production", "id": "GO:0032755", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032755", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "pmid": "" }, { "name": "positive regulation of angiogenesis", "id": "GO:0045766", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045766", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "pmid": "" }, { "name": "cellular response to xenobiotic stimulus", "id": "GO:0071466", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071466", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "pmid": "" }, { "name": "male gonad development", "id": "GO:0008584", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008584", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "pmid": "" }, { "name": "positive regulation of canonical NF-kappaB signal transduction", "id": "GO:0043123", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043123", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "pmid": "" }, { "name": "positive regulation of inflammatory response", "id": "GO:0050729", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050729", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "pmid": "" }, { "name": "positive regulation of tumor necrosis factor production", "id": "GO:0032760", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032760", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "pmid": "" }, { "name": "positive regulation of type II interferon production", "id": "GO:0032729", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032729", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "pmid": "" }, { "name": "response to exogenous dsRNA", "id": "GO:0043330", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043330", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "pmid": "" }, { "name": "extrinsic apoptotic signaling pathway", "id": "GO:0097191", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097191", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "pmid": "" }, { "name": "defense response to bacterium", "id": "GO:0042742", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042742", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "pmid": "" }, { "name": "cellular response to mechanical stimulus", "id": "GO:0071260", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071260", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "pmid": "" }, { "name": "positive regulation of interleukin-8 production", "id": "GO:0032757", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032757", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "pmid": "" }, { "name": "response to dsRNA", "id": "GO:0043331", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043331", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "pmid": "" }, { "name": "cellular response to type II interferon", "id": "GO:0071346", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071346", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "pmid": "" }, { "name": "cellular response to interferon-beta", "id": "GO:0035458", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035458", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "pmid": "" }, { "name": "toll-like receptor signaling pathway", "id": "GO:0002224", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002224", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "pmid": "" }, { "name": "cellular response to virus", "id": "GO:0098586", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098586", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "pmid": "" }, { "name": "activation of NF-kappaB-inducing kinase activity", "id": "GO:0007250", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007250", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "pmid": "" }, { "name": "negative regulation of osteoclast differentiation", "id": "GO:0045671", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045671", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "pmid": "" }, { "name": "positive regulation of macrophage cytokine production", "id": "GO:0060907", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060907", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "pmid": "" }, { "name": "I-kappaB phosphorylation", "id": "GO:0007252", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007252", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "pmid": "" }, { "name": "necroptotic signaling pathway", "id": "GO:0097527", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097527", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "pmid": "" }, { "name": "detection of virus", "id": "GO:0009597", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009597", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "pmid": "" }, { "name": "positive regulation of interferon-beta production", "id": "GO:0032728", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032728", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "pmid": "" }, { "name": "toll-like receptor 3 signaling pathway", "id": "GO:0034138", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034138", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "pmid": "" }, { "name": "positive regulation of cytokine production involved in inflammatory response", "id": "GO:1900017", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1900017", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "pmid": "" }, { "name": "positive regulation of interleukin-12 production", "id": "GO:0032735", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032735", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "pmid": "" }, { "name": "hyperosmotic response", "id": "GO:0006972", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006972", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "pmid": "" }, { "name": "inflammatory response to wounding", "id": "GO:0090594", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090594", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "pmid": "" }, { "name": "type III interferon production", "id": "GO:0034343", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034343", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 11, "go_terms": [ { "name": "Golgi membrane", "id": "GO:0000139", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000139", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "pmid": "" }, { "name": "early endosome", "id": "GO:0005769", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005769", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "pmid": "" }, { "name": "extracellular matrix", "id": "GO:0031012", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031012", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "pmid": "" }, { "name": "lysosomal membrane", "id": "GO:0005765", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005765", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "pmid": "" }, { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "pmid": "" }, { "name": "endosome membrane", "id": "GO:0010008", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010008", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "pmid": "" }, { "name": "endolysosome membrane", "id": "GO:0036020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0036020", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 5, "go_terms": [ { "name": "transmembrane signaling receptor activity", "id": "GO:0004888", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004888", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "pmid": "" }, { "name": "double-stranded RNA binding", "id": "GO:0003725", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003725", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "pmid": "" }, { "name": "pattern recognition receptor activity", "id": "GO:0038187", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0038187", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "pmid": "" }, { "name": "signaling receptor activity", "id": "GO:0038023", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0038023", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 124, "end_pos": 126, "annotation": "n_glycosylation_sequon" }, { "start_pos": 196, "end_pos": 198, "annotation": "n_glycosylation_sequon" }, { "start_pos": 247, "end_pos": 249, "annotation": "n_glycosylation_sequon" }, { "start_pos": 252, "end_pos": 254, "annotation": "n_glycosylation_sequon" }, { "start_pos": 265, "end_pos": 267, "annotation": "n_glycosylation_sequon" }, { "start_pos": 275, "end_pos": 277, "annotation": "n_glycosylation_sequon" }, { "start_pos": 291, "end_pos": 293, "annotation": "n_glycosylation_sequon" }, { "start_pos": 398, "end_pos": 400, "annotation": "n_glycosylation_sequon" }, { "start_pos": 413, "end_pos": 415, "annotation": "n_glycosylation_sequon" }, { "start_pos": 507, "end_pos": 509, "annotation": "n_glycosylation_sequon" }, { "start_pos": 52, "end_pos": 54, "annotation": "n_glycosylation_sequon" }, { "start_pos": 57, "end_pos": 59, "annotation": "n_glycosylation_sequon" }, { "start_pos": 636, "end_pos": 638, "annotation": "n_glycosylation_sequon" }, { "start_pos": 662, "end_pos": 664, "annotation": "n_glycosylation_sequon" }, { "start_pos": 709, "end_pos": 711, "annotation": "n_glycosylation_sequon" }, { "start_pos": 70, "end_pos": 72, "annotation": "n_glycosylation_sequon" }, { "start_pos": 735, "end_pos": 737, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Heavily N-glycosylated, except on that part of the surface of the ectodomain that is involved in ligand binding.", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" }, { "database": "PubMed", "id": "19159218", "url": "https://glygen.org/publication/PubMed/19159218" }, { "database": "PubMed", "id": "16043704", "url": "https://glygen.org/publication/PubMed/16043704" }, { "database": "PubMed", "id": "15961631", "url": "https://glygen.org/publication/PubMed/15961631" }, { "database": "PubMed", "id": "22579623", "url": "https://glygen.org/publication/PubMed/22579623" } ] }, { "annotation": "TLR3 signaling requires a proteolytic cleavage mediated by cathepsins CTSB and CTSH, the cleavage occurs between amino acids 252 and 346. The cleaved form of TLR3 is the predominant form found in endosomes.", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" }, { "database": "PubMed", "id": "22611194", "url": "https://glygen.org/publication/PubMed/22611194" } ] }, { "annotation": "Ubiquitinated by TRIM3; leading to recognition and sorting of polyubiquitinated TLR3 by the ESCRT complexes (PubMed:32878999). Ubiquitinated by ZNRF1 via 'Lys-63'-linked ubiquitin chains; leading to TLR3 lysosomal trafficking and degradation (PubMed:37158982). Ubiquitinated by RNF170 at Lys-765 via 'Lys-48'-linked ubiquitin chains; leading to TLR3 proteasomal degradation (PubMed:31076723).", "evidence": [ { "database": "UniProtKB", "id": "O15455", "url": "https://www.uniprot.org/uniprot/O15455" }, { "database": "PubMed", "id": "32878999", "url": "https://glygen.org/publication/PubMed/32878999" }, { "database": "PubMed", "id": "37158982", "url": "https://glygen.org/publication/PubMed/37158982" }, { "database": "PubMed", "id": "31076723", "url": "https://glygen.org/publication/PubMed/31076723" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [ 52, 57, 70, 124, 140, 196, 247, 252, 265, 275, 291, 398, 413, 507, 636, 662 ], "o_linked_sites": [ 638 ], "snv_sites": [ 27, 54, 57, 59, 70, 72, 87, 116, 126, 142, 182, 196, 236, 247, 252, 265, 275, 280, 287, 293, 310, 325, 337, 367, 412, 413, 415, 509, 512, 522, 636, 638, 662, 664 ], "glycation_sites": [], "phosphorylation_sites": [ 205, 206, 759, 818, 858 ], "sequon_annotation_sites": [ { "start_pos": 124, "end_pos": 126 }, { "start_pos": 196, "end_pos": 198 }, { "start_pos": 247, "end_pos": 249 }, { "start_pos": 252, "end_pos": 254 }, { "start_pos": 265, "end_pos": 267 }, { "start_pos": 275, "end_pos": 277 }, { "start_pos": 291, "end_pos": 293 }, { "start_pos": 398, "end_pos": 400 }, { "start_pos": 413, "end_pos": 415 }, { "start_pos": 507, "end_pos": 509 }, { "start_pos": 52, "end_pos": 54 }, { "start_pos": 57, "end_pos": 59 }, { "start_pos": 636, "end_pos": 638 }, { "start_pos": 662, "end_pos": 664 }, { "start_pos": 709, "end_pos": 711 }, { "start_pos": 70, "end_pos": 72 }, { "start_pos": 735, "end_pos": 737 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 17 }, { "field": "total_sites", "count": 17 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 16 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 15 }, { "field": "total_sites", "count": 15 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 15 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 5 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 40 }, { "field": "total_sites", "count": 34 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 7 }, { "field": "total_sites", "count": 6 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 33 }, { "field": "total_sites", "count": 29 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 128 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }