{ "uniprot_canonical_ac": "O15162-1", "uniprot_ac": "O15162", "uniprot_id": "PLS1_HUMAN", "mass": { "chemical_mass": 35049.0, "monoisotopic_mass": 35049.0 }, "refseq": { "ac": "NP_066928", "name": "phospholipid scramblase 1 isoform 1", "summary": "This gene encodes a phospholipid scramblase family member. The encoded protein is involved in disruption of the asymmetrical distribution of phospholipids between the inner and outer leaflets of the plasma membrane, resulting in externalization of phosphatidylserine. This cell membrane disruption plays an important role in the blood coagulation cascade as well as macrophage clearing of apoptotic cells. The encoded protein has additionally been implicated in gene regulation and interferon-induced antiviral responses. [provided by RefSeq, May 2022].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_066928" }, "gene_names": [ { "name": "PLSCR1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O15162", "id": "O15162" }, { "name": "MMTRA1B", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_066928", "id": "NP_066928" }, { "name": "PLSCR1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_066928", "id": "NP_066928" }, { "name": "hCG_17108", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O15162", "id": "O15162" } ], "protein_names": [ { "name": "Phospholipid scramblase 1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O15162" }, { "name": "3.1.-.-", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O15162" }, { "name": "Ca(2+)-dependent phospholipid scramblase 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O15162" }, { "name": "Erythrocyte phospholipid scramblase", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O15162" }, { "name": "Mg(2+)-dependent nuclease", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O15162" }, { "name": "MmTRA1b", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O15162" }, { "name": "PL scramblase 1; erythrocyte phospholipid scramblase; ca(2+)-dependent phospholipid scramblase 1; mg(2+)-dependent nuclease", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_066928", "id": "NP_066928" }, { "name": "PL scramblase 1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O15162" }, { "name": "phospholipid scramblase 1 isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_066928", "id": "NP_066928" } ], "function": [ { "annotation": "(Microbial infection) Acts as an attachment receptor for HCV.", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162#function" }, { "database": "PubMed", "id": "21806988", "url": "https://glygen.org/publication/PubMed/21806988" } ] }, { "annotation": "Biophysical characterization of the DNA binding motif of human phospholipid scramblase 1.", "evidence": [ { "database": "RefSeq", "id": "NP_066928", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_066928" }, { "database": "PubMed", "id": "36260146", "url": "https://glygen.org/publication/PubMed/36260146" } ] }, { "annotation": "Catalyzes calcium-induced ATP-independent rapid bidirectional and non-specific movement of phospholipids (lipid scrambling or lipid flip-flop) between the inner and outer leaflet of the plasma membrane resulting in collapse of the phospholipid asymmetry which leads to phosphatidylserine externalization on the cell surface (PubMed:9218461, PubMed:8663431, PubMed:10770950, PubMed:9572851, PubMed:9485382, PubMed:18629440, PubMed:23590222, PubMed:24648509, PubMed:24343571, PubMed:32110987, PubMed:23659204, PubMed:29748552). Mediates calcium-dependent phosphatidylserine externalization and apoptosis in neurons via its association with TRPC5 (By similarity). Also exhibits magnesium-dependent nuclease activity against double-stranded DNA and RNA but not single-stranded DNA and can enhance DNA decatenation mediated by TOP2A (PubMed:27206388, PubMed:17567603). Negatively regulates FcR-mediated phagocytosis in differentiated macrophages (PubMed:26745724). May contribute to cytokine-regulated cell proliferation and differentiation (By similarity). May play a role in the antiviral response of interferon (IFN) by amplifying and enhancing the IFN response through increased expression of select subset of potent antiviral genes (PubMed:15308695). Inhibits the functions of viral transactivators, including human T-cell leukemia virus (HTLV)-1 protein Tax, human immunodeficiency virus (HIV)-1 Tat, human hepatitis B virus (HBV) HBx, Epstein-Barr virus (EBV) BZLF1 and human cytomegalovirus IE1 and IE2 proteins through direct interactions (PubMed:22789739, PubMed:31434743, PubMed:25365352, PubMed:23501106, PubMed:35138119). Mediates also the inhibition of influenza virus infection by preventing nuclear import of the viral nucleoprotein/NP (PubMed:29352288, PubMed:35595813). Plays a crucial role as a defense factor against SARS-CoV-2 independently of its scramblase activity by directly targeting nascent viral vesicles to prevent virus-membrane fusion and the release of viral RNA into the host-cell cytosol (PubMed:37438530).", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162#function" }, { "database": "PubMed", "id": "17567603", "url": "https://glygen.org/publication/PubMed/17567603" }, { "database": "PubMed", "id": "21806988", "url": "https://glygen.org/publication/PubMed/21806988" }, { "database": "PubMed", "id": "10770950", "url": "https://glygen.org/publication/PubMed/10770950" }, { "database": "PubMed", "id": "32110987", "url": "https://glygen.org/publication/PubMed/32110987" }, { "database": "PubMed", "id": "9572851", "url": "https://glygen.org/publication/PubMed/9572851" }, { "database": "PubMed", "id": "24648509", "url": "https://glygen.org/publication/PubMed/24648509" }, { "database": "UniProtKB", "id": "Q9JJ00", "url": "https://www.uniprot.org/uniprot/Q9JJ00#function" }, { "database": "PubMed", "id": "31434743", "url": "https://glygen.org/publication/PubMed/31434743" }, { "database": "PubMed", "id": "27206388", "url": "https://glygen.org/publication/PubMed/27206388" }, { "database": "PubMed", "id": "26745724", "url": "https://glygen.org/publication/PubMed/26745724" }, { "database": "PubMed", "id": "8663431", "url": "https://glygen.org/publication/PubMed/8663431" }, { "database": "PubMed", "id": "18629440", "url": "https://glygen.org/publication/PubMed/18629440" }, { "database": "PubMed", "id": "15308695", "url": "https://glygen.org/publication/PubMed/15308695" }, { "database": "PubMed", "id": "24343571", "url": "https://glygen.org/publication/PubMed/24343571" }, { "database": "PubMed", "id": "9218461", "url": "https://glygen.org/publication/PubMed/9218461" }, { "database": "PubMed", "id": "23590222", "url": "https://glygen.org/publication/PubMed/23590222" }, { "database": "PubMed", "id": "9485382", "url": "https://glygen.org/publication/PubMed/9485382" }, { "database": "PubMed", "id": "23659204", "url": "https://glygen.org/publication/PubMed/23659204" }, { "database": "PubMed", "id": "29748552", "url": "https://glygen.org/publication/PubMed/29748552" }, { "database": "PubMed", "id": "22789739", "url": "https://glygen.org/publication/PubMed/22789739" }, { "database": "PubMed", "id": "23501106", "url": "https://glygen.org/publication/PubMed/23501106" }, { "database": "PubMed", "id": "35138119", "url": "https://glygen.org/publication/PubMed/35138119" }, { "database": "PubMed", "id": "25365352", "url": "https://glygen.org/publication/PubMed/25365352" }, { "database": "PubMed", "id": "37438530", "url": "https://glygen.org/publication/PubMed/37438530" } ] }, { "annotation": "Interaction of human phospholipid scramblase 1 with cholesterol via CRAC motif is essential for functional regulation and subcellular localization.", "evidence": [ { "database": "RefSeq", "id": "NP_066928", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_066928" }, { "database": "PubMed", "id": "35439477", "url": "https://glygen.org/publication/PubMed/35439477" } ] }, { "annotation": "May mediate accelerated ATP-independent bidirectional transbilayer migration of phospholipids upon binding calcium ions that results in a loss of phospholipid asymmetry in the plasma membrane.", "evidence": [ { "database": "UniProtKB", "id": "C9JE06", "url": "https://www.uniprot.org/uniprot/C9JE06#function" }, { "database": "UniProtKB", "id": "RU363116", "url": "https://www.uniprot.org/uniprot/RU363116#function" }, { "database": "UniProtKB", "id": "H7C5I5", "url": "https://www.uniprot.org/uniprot/H7C5I5#function" }, { "database": "UniProtKB", "id": "C9J0H3", "url": "https://www.uniprot.org/uniprot/C9J0H3#function" }, { "database": "UniProtKB", "id": "C9J7K9", "url": "https://www.uniprot.org/uniprot/C9J7K9#function" }, { "database": "UniProtKB", "id": "C9J9P4", "url": "https://www.uniprot.org/uniprot/C9J9P4#function" } ] }, { "annotation": "PLSCR1 is a cell-autonomous defence factor against SARS-CoV-2 infection.", "evidence": [ { "database": "RefSeq", "id": "NP_066928", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_066928" }, { "database": "PubMed", "id": "37438530", "url": "https://glygen.org/publication/PubMed/37438530" } ] }, { "annotation": "The Interferon-Inducible Human PLSCR1 Protein Is a Restriction Factor of Human Cytomegalovirus.", "evidence": [ { "database": "RefSeq", "id": "NP_066928", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_066928" }, { "database": "PubMed", "id": "35138119", "url": "https://glygen.org/publication/PubMed/35138119" } ] }, { "annotation": "This gene encodes a phospholipid scramblase family member. The encoded protein is involved in disruption of the asymmetrical distribution of phospholipids between the inner and outer leaflets of the plasma membrane, resulting in externalization of phosphatidylserine. This cell membrane disruption plays an important role in the blood coagulation cascade as well as macrophage clearing of apoptotic cells. The encoded protein has additionally been implicated in gene regulation and interferon-induced antiviral responses. [provided by RefSeq, May 2022].", "evidence": [ { "database": "RefSeq", "id": "NP_066928", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_066928" } ] } ], "disease": [], "snv": [], "mutagenesis": [ { "start_pos": 111, "end_pos": 111, "sequence_org": "H", "sequence_mut": "A", "comment": "60% reduction in nuclease activity; when associated with A-12; A-53; A-211 and A-262.", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" }, { "database": "PubMed", "id": "27206388", "url": "https://glygen.org/publication/PubMed/27206388" } ] }, { "start_pos": 12, "end_pos": 12, "sequence_org": "H", "sequence_mut": "A", "comment": "60% reduction in nuclease activity; when associated with A-53; A-111; A-211 and A-262.", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" }, { "database": "PubMed", "id": "27206388", "url": "https://glygen.org/publication/PubMed/27206388" } ] }, { "start_pos": 161, "end_pos": 161, "sequence_org": "T", "sequence_mut": "A", "comment": "No induction by PKC/PRKCD.", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" }, { "database": "PubMed", "id": "10770950", "url": "https://glygen.org/publication/PubMed/10770950" } ] }, { "start_pos": 184, "end_pos": 189, "sequence_org": "CCCPCC", "sequence_mut": "AAAPAA", "comment": "No palmitoylation; constitutively localizes in the nucleus. Loss of protection against SARS-CoV-2-containing vesicles.", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" }, { "database": "PubMed", "id": "12564925", "url": "https://glygen.org/publication/PubMed/12564925" }, { "database": "PubMed", "id": "15611084", "url": "https://glygen.org/publication/PubMed/15611084" }, { "database": "PubMed", "id": "37438530", "url": "https://glygen.org/publication/PubMed/37438530" } ] }, { "start_pos": 211, "end_pos": 211, "sequence_org": "H", "sequence_mut": "A", "comment": "60% reduction in nuclease activity; when associated with A-12; A-53; A-111 and A-262.", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" }, { "database": "PubMed", "id": "27206388", "url": "https://glygen.org/publication/PubMed/27206388" } ] }, { "start_pos": 262, "end_pos": 262, "sequence_org": "H", "sequence_mut": "A", "comment": "60% reduction in nuclease activity; when associated with A-12; A-53; A-111 and A-211.", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" }, { "database": "PubMed", "id": "27206388", "url": "https://glygen.org/publication/PubMed/27206388" } ] }, { "start_pos": 262, "end_pos": 262, "sequence_org": "H", "sequence_mut": "Y", "comment": "Significantly impaired anti-SARS-CoV-2 activity.", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" }, { "database": "PubMed", "id": "37438530", "url": "https://glygen.org/publication/PubMed/37438530" } ] }, { "start_pos": 273, "end_pos": 273, "sequence_org": "D", "sequence_mut": "A", "comment": "Reduces the Ca(2+)-dependent phospholipid scrambling.", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" }, { "database": "PubMed", "id": "9485382", "url": "https://glygen.org/publication/PubMed/9485382" } ] }, { "start_pos": 275, "end_pos": 275, "sequence_org": "D", "sequence_mut": "A", "comment": "Complete inactivation of the Ca(2+)-dependent phospholipid scrambling. No effect on its nuclease activity.", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" }, { "database": "PubMed", "id": "27206388", "url": "https://glygen.org/publication/PubMed/27206388" }, { "database": "PubMed", "id": "9485382", "url": "https://glygen.org/publication/PubMed/9485382" } ] }, { "start_pos": 277, "end_pos": 277, "sequence_org": "F", "sequence_mut": "A", "comment": "Reduces the Ca(2+)-dependent phospholipid scrambling.", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" }, { "database": "PubMed", "id": "9485382", "url": "https://glygen.org/publication/PubMed/9485382" } ] }, { "start_pos": 279, "end_pos": 279, "sequence_org": "I", "sequence_mut": "A", "comment": "Reduces the Ca(2+)-dependent phospholipid scrambling.", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" }, { "database": "PubMed", "id": "9485382", "url": "https://glygen.org/publication/PubMed/9485382" } ] }, { "start_pos": 281, "end_pos": 281, "sequence_org": "F", "sequence_mut": "A", "comment": "Complete inactivation of the Ca(2+)-dependent phospholipid scrambling.", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" }, { "database": "PubMed", "id": "9485382", "url": "https://glygen.org/publication/PubMed/9485382" }, { "database": "PubMed", "id": "37438530", "url": "https://glygen.org/publication/PubMed/37438530" } ] }, { "start_pos": 284, "end_pos": 284, "sequence_org": "D", "sequence_mut": "A", "comment": "Reduces the Ca(2+)-dependent phospholipid scrambling.", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" }, { "database": "PubMed", "id": "9485382", "url": "https://glygen.org/publication/PubMed/9485382" } ] }, { "start_pos": 53, "end_pos": 53, "sequence_org": "H", "sequence_mut": "A", "comment": "60% reduction in nuclease activity; when associated with A-12; A-111; A-211 and A-262.", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" }, { "database": "PubMed", "id": "27206388", "url": "https://glygen.org/publication/PubMed/27206388" } ] }, { "start_pos": 69, "end_pos": 69, "sequence_org": "Y", "sequence_mut": "F", "comment": "Decrease in phosphorylation.", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" }, { "database": "PubMed", "id": "11390389", "url": "https://glygen.org/publication/PubMed/11390389" } ] }, { "start_pos": 74, "end_pos": 74, "sequence_org": "Y", "sequence_mut": "F", "comment": "Decrease in phosphorylation.", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" }, { "database": "PubMed", "id": "11390389", "url": "https://glygen.org/publication/PubMed/11390389" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "92.7", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000188313", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000188313" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "96.49", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000188313", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000188313" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "93.86", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000188313", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000188313" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "86.99", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000188313", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000188313" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "96.9", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000188313", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000188313" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "98.07", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000188313", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000188313" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "94.46", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000188313", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000188313" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "94.59", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000188313", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000188313" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "94.76", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000188313", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000188313" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "96.58", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000188313", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000188313" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "96.36", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000188313", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000188313" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "94.45", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000188313", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000188313" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "97.46", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000188313", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000188313" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O15162", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15162" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O15162", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15162" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O15162", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15162" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O15162", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15162" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O15162", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15162" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O15162", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15162" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O15162", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15162" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O15162", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15162" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O15162", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15162" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O15162", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15162" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O15162", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15162" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O15162", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15162" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "common_name": "Human" } ], "gene": [ { "name": "PLSCR1", "url": "https://www.uniprot.org/uniprot/O15162", "locus": { "chromosome": "3", "start_pos": 146515180, "end_pos": 146544856, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000188313", "url": "https://www.ensembl.org/id/ENSG00000188313" } ] } } ], "crossref": [ { "id": "ENSG00000188313", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000188313", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "7.6.2.1", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=7.6.2.1&UniProtAcc=O15162", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "PLSCR1", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=PLSCR1", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "5359", "url": "https://www.ncbi.nlm.nih.gov/gene/5359", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "9092", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=9092", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O15162", "url": "https://www.ebi.ac.uk/intact/interactors/id:O15162*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR005552", "url": "https://www.ebi.ac.uk/interpro/entry/IPR005552", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:5359", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:5359", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "604170", "url": "http://www.omim.org/entry/604170", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O15162", "url": "https://www.nextprot.org/entry/NX_O15162", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "O15162", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O15162", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "QNWHLWR", "url": "https://omabrowser.org/oma/group/QNWHLWR/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "4390at2759", "url": "http://www.orthodb.org/?query=4390at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR23248", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23248", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23248:SF38", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23248:SF38", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1Y2A", "url": "https://www.rcsb.org/structure/1Y2A", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF03803", "url": "http://pfam.xfam.org/family/PF03803", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O15162", "url": "https://pharos.nih.gov/targets/O15162", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O15162", "url": "http://purl.obolibrary.org/obo/PR_O15162", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_066928", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_066928", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "38571", "url": "https://www.rhea-db.org/rhea/38571", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "38663", "url": "https://www.rhea-db.org/rhea/38663", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "38895", "url": "https://www.rhea-db.org/rhea/38895", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "C9J0H3", "url": "https://www.uniprot.org/uniprot/C9J0H3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9J0H3-1", "url": "https://www.uniprot.org/uniprot/C9J0H3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9J7K9", "url": "https://www.uniprot.org/uniprot/C9J7K9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9J7K9-1", "url": "https://www.uniprot.org/uniprot/C9J7K9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9J9P4", "url": "https://www.uniprot.org/uniprot/C9J9P4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9J9P4-1", "url": "https://www.uniprot.org/uniprot/C9J9P4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9JE06", "url": "https://www.uniprot.org/uniprot/C9JE06", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9JE06-1", "url": "https://www.uniprot.org/uniprot/C9JE06-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F2Z3F2", "url": "https://www.uniprot.org/uniprot/F2Z3F2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F2Z3F2-1", "url": "https://www.uniprot.org/uniprot/F2Z3F2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H7C5I5", "url": "https://www.uniprot.org/uniprot/H7C5I5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H7C5I5-1", "url": "https://www.uniprot.org/uniprot/H7C5I5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O15162-1", "url": "https://www.uniprot.org/uniprot/O15162-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O15162-2", "url": "https://www.uniprot.org/uniprot/O15162-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MDKQNSQMNASHPETNLPVGYPPQYPPTAFQGPPGYSGYPGPQVSYPPPPAGHSGPGPAGFPVPNQPVYNQPVYNQPVGAAGVPWMPAPQPPLNCPPGLEYLSQIDQILIHQQIELLEVLTGFETNNKYEIKNSFGQRVYFAAEDTDCCTRNCCGPSRPFTLRIIDNMGQEVITLERPLRCSSCCCPCCLQEIEIQAPPGVPIGYVIQTWHPCLPKFTIQNEKREDVLKISGPCVVCSCCGDVDFEIKSLDEQCVVGKISKHWTGILREAFTDADNFGIQFPLDLDVKMKAVMIGACFLIDFMFFESTGSQEQKSGVW", "length": 318, "header": "sp|O15162-1|PLS1_HUMAN Isoform 1 of Phospholipid scramblase 1 OS=Homo sapiens OX=9606 GN=PLSCR1 PE=1 SV=1 CANONICAL=O15162-1" }, "isoforms": [ { "isoform_ac": "C9J0H3-1", "url": "", "sequence": { "sequence": "MLLTRKQTCQLGILLSIHRQHSKIDQILIHQQIELLEVLTGFETNNKYEIKNSFGQRVYFAAEDTDCCTRNCCGPSRPFTLRIIDNMGQEVITLERPLRCSSCCCPCCLQEIEIQAPPGVPIGYVIQTWHPCLPKFTIQNEKREDVLKISGPCVVCSCCGDVDFEIKSLDE", "length": 171, "header": "tr|C9J0H3-1|PLS1_HUMAN Computationally mapped isoform of Phospholipid scramblase 1 OS=Homo sapiens OX=9606 GN=PLSCR1 PE=1 SV=1 CANONICAL=O15162-1" }, "locus": { "chromosome": "3", "start_pos": 146533538, "end_pos": 146517150, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000486631.5", "url": "https://www.ensembl.org/id/ENST00000486631.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000418550.1", "url": "https://www.ensembl.org/id/ENSP00000418550.1" } ] } }, { "isoform_ac": "C9J7K9-1", "url": "", "sequence": { "sequence": "MNASHPETNLPVGYPPQYPPTAFQGPPGYSGYPGPQVSYPPPPAGHSGPGPAGFPVPNQPVYNQPVYNQPVGAAGVPWMPAPQPPLNCPPGLEYLSQIDQILIHQQIELLEVLTGFETNNKYEIKNSFGQRVYFAAEDTDCCTRNCCGPSRPFTLRIIDNMGQEVITLERPLRCSSCCCPCCLQEIEIQAPPGVPIGYVIQTWHPCLPKFTIQNEKREDVLKISGPCVVCSCCGDVDFEIKSLDEQCVVGKISKHWTGILREAFTDADNFGIQFPLDLDVKMKAVMIGACFLIDFMFFESTGSQEQKSGVW", "length": 311, "header": "tr|C9J7K9-1|PLS1_HUMAN Computationally mapped isoform of Phospholipid scramblase 1 OS=Homo sapiens OX=9606 GN=PLSCR1 PE=1 SV=1 CANONICAL=O15162-1" }, "locus": { "chromosome": "3", "start_pos": 146533542, "end_pos": 146516048, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000487389.5", "url": "https://www.ensembl.org/id/ENST00000487389.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000417792.1", "url": "https://www.ensembl.org/id/ENSP00000417792.1" } ] } }, { "isoform_ac": "C9J9P4-1", "url": "", "sequence": { "sequence": "MDKQNSQMNASHPETNLPVGYPPQYPPTAFQGPPGYSGYPGPQVSYPPPPAGHSGPGPAGFPVPNQPVYNQPVYNQPVGAAGVPWMPAPQPPLNCPPGLEYLSQIDQILIHQQIELLEAEDTDCCTRNCCGPSRPFTLRIIDNMGQEVITLERPLRCSSCCCPCCLQEIEIQAPPGVPIGYVIQTWHPCLPKFTIQNEKREDVLKISGPCVVCSCCGDVDFEIKSLDEQCVVGKISKHWTGILREAFT", "length": 248, "header": "tr|C9J9P4-1|PLS1_HUMAN Computationally mapped isoform of Phospholipid scramblase 1 OS=Homo sapiens OX=9606 GN=PLSCR1 PE=1 SV=1 CANONICAL=O15162-1" }, "locus": { "chromosome": "3", "start_pos": 146536552, "end_pos": 146517090, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000462666.5", "url": "https://www.ensembl.org/id/ENST00000462666.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000418103.1", "url": "https://www.ensembl.org/id/ENSP00000418103.1" } ] } }, { "isoform_ac": "C9JE06-1", "url": "", "sequence": { "sequence": "MDKQNSQMNASHPETNLPVGYPPQYPPTAFQGPPGYSGYPGPQVSYPPPPAGHSGPGPAGFPVPNQPVYNQPVYNQPVGAAGVPWMPAPQPPLNCPPGLEYLSQIDQILIHQQIELLEVLTGFETNNKYEIKNSFGQRVYFAAEDTDCCTRNCCGPSRPFTLRIIDNMGQEVITLERPLRCSSCCCPCCLQEIEIQAPPGVPIGYVIQTWHPCLPKFTIQNEKREDVLKISGPCVVCSCCGDVDFEIKS", "length": 249, "header": "tr|C9JE06-1|PLS1_HUMAN Computationally mapped isoform of Phospholipid scramblase 1 OS=Homo sapiens OX=9606 GN=PLSCR1 PE=1 SV=1 CANONICAL=O15162-1" }, "locus": { "chromosome": "3", "start_pos": 146536552, "end_pos": 146517159, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000472349.1", "url": "https://www.ensembl.org/id/ENST00000472349.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000420523.1", "url": "https://www.ensembl.org/id/ENSP00000420523.1" } ] } }, { "isoform_ac": "F2Z3F2-1", "url": "", "sequence": { "sequence": "MDKQNSQMNASHPETNLPVGYPPQYPPTAFQDRSDTDSSAN", "length": 41, "header": "tr|F2Z3F2-1|PLS1_HUMAN Computationally mapped isoform of Phospholipid scramblase 1 OS=Homo sapiens OX=9606 GN=PLSCR1 PE=1 SV=1 CANONICAL=O15162-1" }, "locus": { "chromosome": "3", "start_pos": 146536552, "end_pos": 146525619, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000488253.5", "url": "https://www.ensembl.org/id/ENST00000488253.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000418654.1", "url": "https://www.ensembl.org/id/ENSP00000418654.1" } ] } }, { "isoform_ac": "H7C5I5-1", "url": "", "sequence": { "sequence": "XGFPVPNQPVYNQPVYNQPVGAAGVPWMPAPQPPLNCPPGLEYLSQIDQILIHQQIELLEEIQAPPGVPIGYVIQTWHPCLPKFTIQNEKREDVLKISGPCVVCSCCGDVDFEIKSLDEQCVVGKISKHWTGILREAFTDADNFGIQFPLDLDVKMKAVMIGACFLIDFMF", "length": 171, "header": "tr|H7C5I5-1|PLS1_HUMAN Computationally mapped isoform of Phospholipid scramblase 1 OS=Homo sapiens OX=9606 GN=PLSCR1 PE=1 SV=1 CANONICAL=O15162-1" }, "locus": { "chromosome": "3", "start_pos": 146528750, "end_pos": 146516089, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000483300.5", "url": "https://www.ensembl.org/id/ENST00000483300.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000420006.1", "url": "https://www.ensembl.org/id/ENSP00000420006.1" } ] } }, { "isoform_ac": "O15162-1", "url": "", "sequence": { "sequence": "MDKQNSQMNASHPETNLPVGYPPQYPPTAFQGPPGYSGYPGPQVSYPPPPAGHSGPGPAGFPVPNQPVYNQPVYNQPVGAAGVPWMPAPQPPLNCPPGLEYLSQIDQILIHQQIELLEVLTGFETNNKYEIKNSFGQRVYFAAEDTDCCTRNCCGPSRPFTLRIIDNMGQEVITLERPLRCSSCCCPCCLQEIEIQAPPGVPIGYVIQTWHPCLPKFTIQNEKREDVLKISGPCVVCSCCGDVDFEIKSLDEQCVVGKISKHWTGILREAFTDADNFGIQFPLDLDVKMKAVMIGACFLIDFMFFESTGSQEQKSGVW", "length": 318, "header": "sp|O15162-1|PLS1_HUMAN Isoform 1 of Phospholipid scramblase 1 OS=Homo sapiens OX=9606 GN=PLSCR1 PE=1 SV=1 CANONICAL=O15162-1" }, "locus": { "chromosome": "3", "start_pos": 146536552, "end_pos": 146516048, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000342435.9", "url": "https://www.ensembl.org/id/ENST00000342435.9" }, { "database": "Ensembl Peptide", "id": "ENSP00000345494.4", "url": "https://www.ensembl.org/id/ENSP00000345494.4" } ] } }, { "isoform_ac": "O15162-2", "url": "", "sequence": { "sequence": "MLLTRKQTCQLGILLSIHRQHSKIDQILIHQQIELLEVLTGFETNNKYEIKNSFGQRVYFAAEDTDCCTRNCCGPSRPFTLRIIDNMGQEVITLERPLRCSSCCCPCCLQEIEIQAPPGVPIGYVIQTWHPCLPKFTIQNEKREDVLKISGPCVVCSCCGDVDFEIKSLDEQCVVGKISKHWTGILREAFTDADNFGIQFPLDLDVKMKAVMIGACFLIDFMFFESTGSQEQKSGVW", "length": 237, "header": "sp|O15162-2|PLS1_HUMAN Isoform 2 of Phospholipid scramblase 1 OS=Homo sapiens OX=9606 GN=PLSCR1 PE=1 SV=1 CANONICAL=O15162-1" }, "locus": { "chromosome": "3", "start_pos": 146533538, "end_pos": 146516048, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000448787.6", "url": "https://www.ensembl.org/id/ENST00000448787.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000411675.2", "url": "https://www.ensembl.org/id/ENSP00000411675.2" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "O15162", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O15162" }, { "id": "29485866", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29485866" } ] } ], "phosphorylation": [ { "start_pos": 161, "end_pos": 161, "kinase_uniprot_canonical_ac": "Q05655-1", "kinase_gene_name": "PRKCD", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O15162", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15162" }, { "database": "PubMed", "id": "10770950", "url": "https://glygen.org/publication/PubMed/10770950" } ], "site_lbl": "Thr161" }, { "start_pos": 161, "end_pos": 161, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by PKC/PRKCD", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" }, { "database": "iPTMnet", "id": "O15162", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15162" }, { "database": "PubMed", "id": "10770950", "url": "https://glygen.org/publication/PubMed/10770950" } ], "site_lbl": "Thr161" }, { "start_pos": 69, "end_pos": 69, "kinase_uniprot_canonical_ac": "P00519-1", "kinase_gene_name": "ABL1", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O15162", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15162" }, { "database": "PubMed", "id": "11390389", "url": "https://glygen.org/publication/PubMed/11390389" } ], "site_lbl": "Tyr69" }, { "start_pos": 69, "end_pos": 69, "kinase_uniprot_canonical_ac": "P12931-1", "kinase_gene_name": "SRC", "residue": "Tyr", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "O15162", "url": "http://phospho.elm.eu.org/byAccession/O15162.html" }, { "database": "iPTMnet", "id": "O15162", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15162" }, { "database": "PubMed", "id": "12871937", "url": "https://glygen.org/publication/PubMed/12871937" } ], "site_lbl": "Tyr69" }, { "start_pos": 69, "end_pos": 69, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by ABL", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" }, { "database": "phospho.ELM", "id": "O15162", "url": "http://phospho.elm.eu.org/byAccession/O15162.html" }, { "database": "iPTMnet", "id": "O15162", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15162" }, { "database": "PubMed", "id": "11390389", "url": "https://glygen.org/publication/PubMed/11390389" }, { "database": "PubMed", "id": "32292520", "url": "https://glygen.org/publication/PubMed/32292520" } ], "site_lbl": "Tyr69" }, { "start_pos": 74, "end_pos": 74, "kinase_uniprot_canonical_ac": "P00519-1", "kinase_gene_name": "ABL1", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O15162", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15162" }, { "database": "PubMed", "id": "11390389", "url": "https://glygen.org/publication/PubMed/11390389" } ], "site_lbl": "Tyr74" }, { "start_pos": 74, "end_pos": 74, "kinase_uniprot_canonical_ac": "P12931-1", "kinase_gene_name": "SRC", "residue": "Tyr", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "O15162", "url": "http://phospho.elm.eu.org/byAccession/O15162.html" }, { "database": "iPTMnet", "id": "O15162", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15162" }, { "database": "PubMed", "id": "12871937", "url": "https://glygen.org/publication/PubMed/12871937" } ], "site_lbl": "Tyr74" }, { "start_pos": 74, "end_pos": 74, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine; by ABL", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" }, { "database": "phospho.ELM", "id": "O15162", "url": "http://phospho.elm.eu.org/byAccession/O15162.html" }, { "database": "iPTMnet", "id": "O15162", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15162" }, { "database": "PubMed", "id": "11390389", "url": "https://glygen.org/publication/PubMed/11390389" }, { "database": "PubMed", "id": "32292520", "url": "https://glygen.org/publication/PubMed/32292520" } ], "site_lbl": "Tyr74" } ], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Regulation of phospholipid scramblase activity during apoptosis and cell activation by protein kinase Cdelta.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Frasch SC, Henson PM, Kailey JM, Richter DA, Janes MS, Fadok VA, Bratton DL", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" }, { "database": "iPTMnet", "id": "O15162-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15162-1" } ], "reference": [ { "type": "PubMed", "id": "10770950", "url": "https://glygen.org/publication/PubMed/10770950" } ] }, { "title": "Identification of three new members of the phospholipid scramblase gene family.", "journal": "Biochim. Biophys. Acta", "date": "2000", "authors": "Wiedmer T, Zhou Q, Kwoh D Y, Sims P J", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "reference": [ { "type": "PubMed", "id": "10930526", "url": "https://glygen.org/publication/PubMed/10930526" } ] }, { "title": "c-Abl tyrosine kinase binds and phosphorylates phospholipid scramblase 1.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Sun J, Zhao J, Schwartz MA, Wang JY, Wiedmer T, Sims PJ", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" }, { "database": "iPTMnet", "id": "O15162-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15162-1" } ], "reference": [ { "type": "PubMed", "id": "11390389", "url": "https://glygen.org/publication/PubMed/11390389" } ] }, { "title": "Palmitoylation of phospholipid scramblase 1 controls its distribution between nucleus and plasma membrane.", "journal": "Biochemistry", "date": "2003", "authors": "Wiedmer T, Zhao J, Nanjundan M, Sims PJ", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "reference": [ { "type": "PubMed", "id": "12564925", "url": "https://glygen.org/publication/PubMed/12564925" } ] }, { "title": "Plasma membrane phospholipid scramblase 1 promotes EGF-dependent activation of c-Src through the epidermal growth factor receptor.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Nanjundan M, Sun J, Zhao J, Zhou Q, Sims PJ, Wiedmer T", "evidence": [ { "database": "iPTMnet", "id": "O15162", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15162" } ], "reference": [ { "type": "PubMed", "id": "12871937", "url": "https://glygen.org/publication/PubMed/12871937" } ] }, { "title": "Phospholipid scramblase 1 potentiates the antiviral activity of interferon.", "journal": "Journal of virology", "date": "2004-09", "authors": "Dong Beihua, Zhou Quansheng, Zhao Ji, Zhou Aimin, Harty Ronald N, Bose Santanu, Banerjee Amiya, Slee Roger, Guenther Jeanna, Williams Bryan R G, Wiedmer Therese, Sims Peter J, Silverman Robert H", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "reference": [ { "type": "PubMed", "id": "15308695", "url": "https://glygen.org/publication/PubMed/15308695" } ] }, { "title": "Phospholipid scramblase 1 contains a nonclassical nuclear localization signal with unique binding site in importin alpha.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Chen MH, Ben-Efraim I, Mitrousis G, Walker-Kopp N, Sims PJ, Cingolani G", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "reference": [ { "type": "PubMed", "id": "15611084", "url": "https://glygen.org/publication/PubMed/15611084" } ] }, { "title": "Phospholipid scramblase 1 binds to the promoter region of the inositol 1,4,5-triphosphate receptor type 1 gene to enhance its expression.", "journal": "J. Biol. Chem.", "date": "2005", "authors": "Zhou Quansheng, Ben-Efraim Iris, Bigcas Jo-Lawrence, Junqueira Daniela, Wiedmer Therese, Sims Peter J", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "reference": [ { "type": "PubMed", "id": "16091359", "url": "https://glygen.org/publication/PubMed/16091359" } ] }, { "title": "Nuclear interactions of topoisomerase II alpha and beta with phospholipid scramblase 1.", "journal": "Nucleic acids research", "date": "2007", "authors": "Wyles Jessica P, Wu Zhongqin, Mirski Shelagh E L, Cole Susan P C", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "reference": [ { "type": "PubMed", "id": "17567603", "url": "https://glygen.org/publication/PubMed/17567603" } ] }, { "title": "Over-expression of recombinant human phospholipid scramblase 1 in E. coli and its purification from inclusion bodies.", "journal": "Biotechnology letters", "date": "2008-12", "authors": "Sahu Santosh Kumar, Gopala Krishna A, Gummadi Sathyanarayana N", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "reference": [ { "type": "PubMed", "id": "18629440", "url": "https://glygen.org/publication/PubMed/18629440" } ] }, { "title": "Phospholipid scramblase 1 mediates hepatitis C virus entry into host cells.", "journal": "FEBS letters", "date": "2011-09-02", "authors": "Gong Qiaoling, Cheng Min, Chen Hui, Liu Xiuying, Si Youhui, Yang Yang, Yuan Yanzhi, Jin Chaozhi, Yang Wei, He Fuchu, Wang Jian", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "reference": [ { "type": "PubMed", "id": "21806988", "url": "https://glygen.org/publication/PubMed/21806988" } ] }, { "title": "Identification of PLSCR1 as a protein that interacts with RELT family members.", "journal": "Molecular and cellular biochemistry", "date": "2012", "authors": "Cusick JK, Mustian A, Jacobs AT, Reyland ME", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "reference": [ { "type": "PubMed", "id": "22052202", "url": "https://glygen.org/publication/PubMed/22052202" } ] }, { "title": "Human phospholipid scramblase 1 interacts with and regulates transactivation of HTLV-1 Tax.", "journal": "Virology", "date": "2012-10-25", "authors": "Kusano Shuichi, Eizuru Yoshito", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "reference": [ { "type": "PubMed", "id": "22789739", "url": "https://glygen.org/publication/PubMed/22789739" } ] }, { "title": "Interaction of the phospholipid scramblase 1 with HIV-1 Tat results in the repression of Tat-dependent transcription.", "journal": "Biochemical and biophysical research communications", "date": "2013-04-19", "authors": "Kusano Shuichi, Eizuru Yoshito", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "reference": [ { "type": "PubMed", "id": "23501106", "url": "https://glygen.org/publication/PubMed/23501106" } ] }, { "title": "The single C-terminal helix of human phospholipid scramblase 1 is required for membrane insertion and scrambling activity.", "journal": "The FEBS journal", "date": "2013-06", "authors": "Francis Vincent G, Mohammed Abdul M, Aradhyam Gopala K, Gummadi Sathyanarayana N", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "reference": [ { "type": "PubMed", "id": "23590222", "url": "https://glygen.org/publication/PubMed/23590222" } ] }, { "title": "Biochemical evidence for lead and mercury induced transbilayer movement of phospholipids mediated by human phospholipid scramblase 1.", "journal": "Chemical research in toxicology", "date": "2013-06-17", "authors": "Shettihalli Ashok Kumar, Gummadi Sathyanarayana N", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "reference": [ { "type": "PubMed", "id": "23659204", "url": "https://glygen.org/publication/PubMed/23659204" } ] }, { "title": "The C-terminal transmembrane domain of human phospholipid scramblase 1 is essential for the protein flip-flop activity and Ca\u00b2\u207a-binding.", "journal": "The Journal of membrane biology", "date": "2014-02", "authors": "S\u00e1nchez-Magraner Lissete, Posada Itziar M D, Andraka Nagore, Contreras F Xabier, Viguera Ana R, Gu\u00e9rin Diego M A, Arrondo Jos\u00e9 L R, Monaco Hugo L, Go\u00f1i F\u00e9lix M", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "reference": [ { "type": "PubMed", "id": "24343571", "url": "https://glygen.org/publication/PubMed/24343571" } ] }, { "title": "N-terminal proline-rich domain is required for scrambling activity of human phospholipid scramblases.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Rayala S, Francis VG, Sivagnanam U, Gummadi SN", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "reference": [ { "type": "PubMed", "id": "24648509", "url": "https://glygen.org/publication/PubMed/24648509" } ] }, { "title": "Interactome map reveals phospholipid scramblase 1 as a novel regulator of hepatitis B virus x protein.", "journal": "Journal of proteome research", "date": "2015-01-02", "authors": "Yuan Yanzhi, Tian Chunyan, Gong Qiaoling, Shang Limin, Zhang Yuehui, Jin Chaozhi, He Fuchu, Wang Jian", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "reference": [ { "type": "PubMed", "id": "25365352", "url": "https://glygen.org/publication/PubMed/25365352" } ] }, { "title": "Phospholipid Scramblase 1 Modulates FcR-Mediated Phagocytosis in Differentiated Macrophages.", "journal": "PloS one", "date": "2016", "authors": "Herate Cecile, Ramdani Ghania, Grant Nancy J, Marion Sabrina, Gasman Stephane, Niedergang Florence, Benichou Serge, Bouchet Jerome", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "reference": [ { "type": "PubMed", "id": "26745724", "url": "https://glygen.org/publication/PubMed/26745724" } ] }, { "title": "Identification and characterization of the novel nuclease activity of human phospholipid scramblase 1.", "journal": "BMC biochemistry", "date": "2016", "authors": "Sivagnanam U, Narayana Murthy S, Gummadi SN", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "reference": [ { "type": "PubMed", "id": "27206388", "url": "https://glygen.org/publication/PubMed/27206388" } ] }, { "title": "Phospholipid scramblase 1 interacts with influenza A virus NP, impairing its nuclear import and thereby suppressing virus replication.", "journal": "PLoS Pathog.", "date": "2018", "authors": "Luo Weiyu, Zhang Jie, Liang Libin, Wang Guangwen, Li Qibing, Zhu Pengyang, Zhou Yuan, Li Junping, Zhao Yuhui, Sun Nan, Huang Shanyu, Zhou Chenchen, Chang Yu, Cui Pengfei, Chen Pucheng, Jiang Yongping, Deng Guohua, Bu Zhigao, Li Chengjun, Jiang Li, Chen Hualan", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "reference": [ { "type": "PubMed", "id": "29352288", "url": "https://glygen.org/publication/PubMed/29352288" } ] }, { "title": "O-GlcNAc Transferase Recognizes Protein Substrates Using an Asparagine Ladder in the Tetratricopeptide Repeat (TPR) Superhelix.", "journal": "Journal of the American Chemical Society", "date": "2018", "authors": "Levine ZG, Fan C, Melicher MS, Orman M, Benjamin T, Walker S", "evidence": [ { "database": "O-GlcNAc Database", "id": "O15162", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O15162" } ], "reference": [ { "type": "PubMed", "id": "29485866", "url": "https://glygen.org/publication/PubMed/29485866" } ] }, { "title": "Pb(II) Induces Scramblase Activation and Ceramide-Domain Generation in Red Blood Cells.", "journal": "Scientific reports", "date": "2018-05-10", "authors": "Ahyayauch Hasna, Garc\u00eda-Arribas Aritz B, Sot Jes\u00fas, Gonz\u00e1lez-Ram\u00edrez Emilio J, Busto Jon V, Monasterio Bingen G, Jim\u00e9nez-Rojo Noemi, Contreras F Xabier, Rend\u00f3n-Ram\u00edrez Adela, Martin Cesar, Alonso Alicia, Go\u00f1i F\u00e9lix M", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "reference": [ { "type": "PubMed", "id": "29748552", "url": "https://glygen.org/publication/PubMed/29748552" } ] }, { "title": "Interaction of phospholipid scramblase 1 with the Epstein-Barr virus protein BZLF1 represses BZLF1-mediated lytic gene transcription.", "journal": "The Journal of biological chemistry", "date": "2019", "authors": "Kusano S, Ikeda M", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "reference": [ { "type": "PubMed", "id": "31434743", "url": "https://glygen.org/publication/PubMed/31434743" } ] }, { "title": "Transient Receptor Potential Canonical 5-Scramblase Signaling Complex Mediates Neuronal Phosphatidylserine Externalization and Apoptosis.", "journal": "Cells", "date": "2020", "authors": "Guo J, Li J, Xia L, Wang Y, Zhu J, Du J, Lu Y, Liu G, Yao X, Shen B", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "reference": [ { "type": "PubMed", "id": "32110987", "url": "https://glygen.org/publication/PubMed/32110987" } ] }, { "title": "Nuclear translocation of PLSCR1 activates STAT1 signaling in basal-like breast cancer.", "journal": "Theranostics", "date": "2020", "authors": "Huang P, Liao R, Chen X, Wu X, Li X, Wang Y, Cao Q, Dong C", "evidence": [ { "database": "iPTMnet", "id": "O15162", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O15162" } ], "reference": [ { "type": "PubMed", "id": "32292520", "url": "https://glygen.org/publication/PubMed/32292520" } ] }, { "title": "The Interferon-Inducible Human PLSCR1 Protein Is a Restriction Factor of Human Cytomegalovirus.", "journal": "Microbiology spectrum", "date": "2022", "authors": "Sadanari H, Takemoto M, Ishida T, Otagiri H, Daikoku T, Murayama T, Kusano S", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" }, { "database": "RefSeq", "id": "NP_066928", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_066928" } ], "reference": [ { "type": "PubMed", "id": "35138119", "url": "https://glygen.org/publication/PubMed/35138119" } ] }, { "title": "Interaction of human phospholipid scramblase 1 with cholesterol via CRAC motif is essential for functional regulation and subcellular localization.", "journal": "International journal of biological macromolecules", "date": "2022", "authors": "Koyiloth M, Gummadi SN", "evidence": [ { "database": "RefSeq", "id": "NP_066928", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_066928" } ], "reference": [ { "type": "PubMed", "id": "35439477", "url": "https://glygen.org/publication/PubMed/35439477" } ] }, { "title": "ILDR1 promotes influenza A virus replication through binding to PLSCR1.", "journal": "Sci. Rep.", "date": "2022", "authors": "Liu Yueyue, Lin Shuqian, Xie Yunhui, Zhao Lu, Du Haibo, Yang Shifa, Yin Bin, Li Guiming, Zhao Zengcheng, Huang Zhongli, Xu Zhigang, Wu Jiaqiang", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "reference": [ { "type": "PubMed", "id": "35595813", "url": "https://glygen.org/publication/PubMed/35595813" } ] }, { "title": "Biophysical characterization of the DNA binding motif of human phospholipid scramblase 1.", "journal": "European biophysics journal : EBJ", "date": "2022-12", "authors": "Rayala Sarika, Sivagnanam Ulaganathan, Gummadi Sathyanarayana N", "evidence": [ { "database": "RefSeq", "id": "NP_066928", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_066928" } ], "reference": [ { "type": "PubMed", "id": "36260146", "url": "https://glygen.org/publication/PubMed/36260146" } ] }, { "title": "PLSCR1 is a cell-autonomous defence factor against SARS-CoV-2 infection.", "journal": "Nature", "date": "2023-07", "authors": "Xu Dijin, Jiang Weiqian, Wu Lizhen, Gaudet Ryan G, Park Eui-Soon, Su Maohan, Cheppali Sudheer Kumar, Cheemarla Nagarjuna R, Kumar Pradeep, Uchil Pradeep D, Grover Jonathan R, Foxman Ellen F, Brown Chelsea M, Stansfeld Phillip J, Bewersdorf Joerg, Mothes Walther, Karatekin Erdem, Wilen Craig B, MacMicking John D", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" }, { "database": "RefSeq", "id": "NP_066928", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_066928" } ], "reference": [ { "type": "PubMed", "id": "37438530", "url": "https://glygen.org/publication/PubMed/37438530" } ] }, { "title": "Isolation of an erythrocyte membrane protein that mediates Ca2+-dependent transbilayer movement of phospholipid.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Basse F, Stout JG, Sims PJ, Wiedmer T", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "reference": [ { "type": "PubMed", "id": "8663431", "url": "https://glygen.org/publication/PubMed/8663431" } ] }, { "title": "Molecular cloning of human plasma membrane phospholipid scramblase. A protein mediating transbilayer movement of plasma membrane phospholipids.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Zhou Q, Zhao J, Stout JG, Luhm RA, Wiedmer T, Sims PJ", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "reference": [ { "type": "PubMed", "id": "9218461", "url": "https://glygen.org/publication/PubMed/9218461" } ] }, { "title": "Identity of a conserved motif in phospholipid scramblase that is required for Ca2+-accelerated transbilayer movement of membrane phospholipids.", "journal": "Biochemistry", "date": "1998", "authors": "Zhou Q, Sims PJ, Wiedmer T", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "reference": [ { "type": "PubMed", "id": "9485382", "url": "https://glygen.org/publication/PubMed/9485382" } ] }, { "title": "Palmitoylation of phospholipid scramblase is required for normal function in promoting Ca2+-activated transbilayer movement of membrane phospholipids.", "journal": "Biochemistry", "date": "1998", "authors": "Zhao J, Zhou Q, Wiedmer T, Sims PJ", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "reference": [ { "type": "PubMed", "id": "9572851", "url": "https://glygen.org/publication/PubMed/9572851" } ] }, { "title": "Identity of human normal counterpart (MmTRA1b) of mouse leukemogenesis-associated gene (MmTRA1a) product as plasma membrane phospholipid scramblase and chromosome mapping of the human MmTRA1b/phospholipid scramblase gene.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1998", "authors": "Kasukabe T, Kobayashi H, Kaneko Y, Okabe-Kado J, Honma Y", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "reference": [ { "type": "PubMed", "id": "9712717", "url": "https://glygen.org/publication/PubMed/9712717" } ] } ], "pathway": [ { "id": "hsa:5359", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:5359", "resource": "KEGG Pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "P47140-1", "protein_name": "Altered inheritance rate of mitochondria protein 25", "gene_name": "AIM25", "tax_id": 559292, "organism": "Saccharomyces cerevisiae S288C", "sequence": { "sequence": "MHRTAIFLTYRSCMRNFSTLSKTLTVSSGKVIRNGPFRRVIREKNQITKAPSVKAFKENSNSGIIKVHDPIATTILNEPTVIIERQIEFMNVFLGFEQANRYAIMDVNGNKIASMMERDFSITKAIMRQFYRLHRPFLVDVFDNWGNVIMTIKRPFSFINSHIKTIIPPSAYVDNGSDSTHYHDGKEGTTVGETIQNWHLWRRRYELFQKDGVEGSTFDQFGKIDAPFLSFDFPVTDADGKIMASVDRNWVGLGREMFTDTGVYVVRFDSQRCFDNIYPTEMLSSQVLTLDQRAVLLANAVSIDFDYFSRHSRQTGGFLSFGGGYDE", "length": 327 }, "evidence": [ { "id": "O15162", "url": "https://omabrowser.org/oma/group/O15162/", "database": "OMA" } ], "common_name": "Yeast" }, { "uniprot_canonical_ac": "P58195-1", "protein_name": "Phospholipid scramblase 1", "gene_name": "Plscr1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MEKHGPPEHAAYPIPQADYQGSQGPYPGPQGPYPGPQGPYAGPQGPYPGPQGPYAGPQGPYPGPQPGYPVPPGSYAGGDPSGFPVQHQPAYNHPGGPGGTPWMQAPPPPLDCPPGLEYLTQIDQILVHQQIELLEVLTGFETNNKYEIKNSLGQRVYFAVEDTDCCTRNCCGASRPFTLRILDNMGREVMTLERPLRCSSCCFPCCLQEIEIQAPPGVPVGYVIQTWHPCLPKFTLQNEKRQDVLKVVGPCVVCSCCSDIDFELKSLDEESVVGKISKQWSGFVREAFTDADNFGIQFPLDLDVKMKAVMLGACFLIDFMFFERTGNEEQRSGVW", "length": 335 }, "evidence": [ { "id": "45924473", "url": "http://www.informatics.jax.org/homology/45924473", "database": "MGI" }, { "id": "45924474", "url": "http://www.informatics.jax.org/homology/45924474", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q9DCW2-1", "protein_name": "Phospholipid scramblase 2", "gene_name": "Plscr2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MEAPRSGTYLPAGYAPQYPPAAVQGPPEHTGRPTFQTNYQVPQSGYPGPQASYTVSTSGHEGYAATRLPIQNNQTIVLANTQWMPAPPPILNCPPGLEYLNQIDQLLIHQQVELLEVLTGFETNNKFEIKNSLGQMVYVAVEDTDCCTRNCCEASRPFTLRILDHLGQEVMTLERPLKCSSCCFPCCLQEIEIQAPPGVPIGYVTQTWHPCLPKLTLQNDKRENVLKVVGPCVACTCCSDIDFEIKSLDEVTRIGKITKQWSGCVKEAFTDSDNFGIQFPLDLEVKMKAVTLGACFLIDYMFFEGCE", "length": 307 }, "evidence": [ { "id": "45924474", "url": "http://www.informatics.jax.org/homology/45924474", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9JJ00-1", "protein_name": "Phospholipid scramblase 1", "gene_name": "Plscr1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MENHSKQTEAPHPGTYMPAGYPPPYPPAAFQGPSDHAAYPIPQAGYQGPPGPYPGPQPGYPVPPGGYAGGGPSGFPVQNQPAYNHPGGPGGTPWMPAPPPPLNCPPGLEYLAQIDQLLVHQQIELLEVLTGFETNNKYEIKNSLGQRVYFAVEDTDCCTRNCCGASRPFTLRILDNLGREVMTLERPLRCSSCCFPCCLQEIEIQAPPGVPVGYVTQTWHPCLPKFTLQNEKKQDVLKVVGPCVVCSCCSDIDFELKSLDEESVVGKISKQWSGFVREAFTDADNFGIQFPLDLDVKMKAVMLGACFLIDFMFFERTGNEEQRSGAWQ", "length": 328 }, "evidence": [ { "id": "45924473", "url": "http://www.informatics.jax.org/homology/45924473", "database": "MGI" }, { "id": "O15162", "url": "https://omabrowser.org/oma/group/O15162/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9NRY7-2", "protein_name": "Phospholipid scramblase 2", "gene_name": "PLSCR2", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MRSWNSLFCLNSSRPPGHIVYPKHQAGHTGKQADHLGSQAFYPGRQHDYLVPPAGTAGIPVQNQPGRPEGVPWMPAPPPPLNCPPGLEYLSQIDMILIHQQIELLEVLFSFESSNMYEIKNSFGQRIYFAAEDTNFCIRNCCGRSRPFTLRITDNVGREVITLERPLRCNCCCCPCCLQEIEIQAPPGVPVGYVTQTWHPCLTKFTIKNQKREDVLKISGPCIVCSCIAGVDFEITSLDEQIVVGRISKHWSGFLREAFTDADNFGIQFPRDLDVKMKAVMIGACFLIDYMFFERTR", "length": 297 }, "evidence": [ { "id": "45924474", "url": "http://www.informatics.jax.org/homology/45924474", "database": "MGI" } ], "common_name": "Human" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 14, "go_terms": [ { "name": "phospholipid scramblase activity", "id": "GO:0017128", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0017128", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "pmid": "" }, { "name": "lead ion binding", "id": "GO:0032791", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032791", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "pmid": "" }, { "name": "magnesium ion binding", "id": "GO:0000287", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000287", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "pmid": "" }, { "name": "DNA binding", "id": "GO:0003677", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003677", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "pmid": "" }, { "name": "zinc ion binding", "id": "GO:0008270", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008270", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "pmid": "" }, { "name": "SH3 domain binding", "id": "GO:0017124", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0017124", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "pmid": "" }, { "name": "enzyme binding", "id": "GO:0019899", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019899", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "pmid": "" }, { "name": "calcium ion binding", "id": "GO:0005509", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005509", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "pmid": "" }, { "name": "CD4 receptor binding", "id": "GO:0042609", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042609", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "pmid": "" }, { "name": "epidermal growth factor receptor binding", "id": "GO:0005154", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005154", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "pmid": "" }, { "name": "virus receptor activity", "id": "GO:0001618", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001618", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "pmid": "" }, { "name": "DNA-binding transcription activator activity, RNA polymerase II-specific", "id": "GO:0001228", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001228", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "pmid": "" }, { "name": "nuclease activity", "id": "GO:0004518", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004518", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "pmid": "" }, { "name": "mercury ion binding", "id": "GO:0045340", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045340", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 12, "go_terms": [ { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "pmid": "" }, { "name": "Golgi apparatus", "id": "GO:0005794", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005794", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "pmid": "" }, { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "pmid": "" }, { "name": "nucleolus", "id": "GO:0005730", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005730", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "pmid": "" }, { "name": "membrane raft", "id": "GO:0045121", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045121", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "pmid": "" }, { "name": "perinuclear region of cytoplasm", "id": "GO:0048471", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048471", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "pmid": "" }, { "name": "collagen-containing extracellular matrix", "id": "GO:0062023", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0062023", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 18, "go_terms": [ { "name": "positive regulation of chromosome separation", "id": "GO:1905820", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1905820", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "pmid": "" }, { "name": "positive regulation of DNA topoisomerase (ATP-hydrolyzing) activity", "id": "GO:2000373", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2000373", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "pmid": "" }, { "name": "regulation of Fc receptor mediated stimulatory signaling pathway", "id": "GO:0060368", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060368", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "pmid": "" }, { "name": "response to lead ion", "id": "GO:0010288", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010288", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "pmid": "" }, { "name": "positive regulation of gene expression", "id": "GO:0010628", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010628", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "pmid": "" }, { "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "pmid": "" }, { "name": "defense response to virus", "id": "GO:0051607", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051607", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "pmid": "" }, { "name": "apoptotic process", "id": "GO:0006915", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006915", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "pmid": "" }, { "name": "acute-phase response", "id": "GO:0006953", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006953", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "pmid": "" }, { "name": "negative regulation of viral genome replication", "id": "GO:0045071", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045071", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "pmid": "" }, { "name": "platelet activation", "id": "GO:0030168", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030168", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "pmid": "" }, { "name": "plasma membrane phospholipid scrambling", "id": "GO:0017121", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0017121", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "pmid": "" }, { "name": "negative regulation of phagocytosis", "id": "GO:0050765", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050765", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "pmid": "" }, { "name": "positive regulation of innate immune response", "id": "GO:0045089", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045089", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "pmid": "" }, { "name": "response to interferon-beta", "id": "GO:0035456", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035456", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "pmid": "" }, { "name": "phosphatidylserine exposure on apoptotic cell surface", "id": "GO:0070782", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070782", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "pmid": "" }, { "name": "regulation of mast cell activation", "id": "GO:0033003", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033003", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "pmid": "" }, { "name": "phosphatidylserine biosynthetic process", "id": "GO:0006659", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006659", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 9, "end_pos": 11, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Palmitoylation is required for its phospholipid scramblase activity (PubMed:9572851). Palmitoylation regulates its localization to the cell membrane or the nucleus; trafficking to the cell membrane is dependent upon palmitoylation whereas in the absence of palmitoylation, localizes to the nucleus (PubMed:12564925).", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" }, { "database": "PubMed", "id": "12564925", "url": "https://glygen.org/publication/PubMed/12564925" }, { "database": "PubMed", "id": "9572851", "url": "https://glygen.org/publication/PubMed/9572851" } ] }, { "annotation": "Phosphorylation at Thr-161 by PKC/PKCD increases its phospholipid scramblase activity during both cell stimulation and apoptosis (PubMed:10770950). Phosphorylated by OXSR1 in the presence of RELT.", "evidence": [ { "database": "UniProtKB", "id": "O15162", "url": "https://www.uniprot.org/uniprot/O15162" }, { "database": "PubMed", "id": "10770950", "url": "https://glygen.org/publication/PubMed/10770950" }, { "database": "PubMed", "id": "22052202", "url": "https://glygen.org/publication/PubMed/22052202" } ] } ], "interactions": [], "reactions": [ { "id": "38571", "name": "", "equation": "a 1,2-diacyl-sn-glycero-3-phosphocholine(in) = a 1,2-diacyl-sn-glycero-3-phosphocholine(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P58195-1", "O15162-1", "Q9JJ00-1" ], "evidence": [ { "id": "38571", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/38571" } ] }, { "id": "38663", "name": "", "equation": "a 1,2-diacyl-sn-glycero-3-phospho-L-serine(in) = a 1,2-diacyl-sn-glycero-3-phospho-L-serine(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P58195-1", "O15162-1", "Q9JJ00-1" ], "evidence": [ { "id": "38663", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/38663" } ] }, { "id": "38895", "name": "", "equation": "a 1,2-diacyl-sn-glycero-3-phosphoethanolamine(in) = a 1,2-diacyl-sn-glycero-3-phosphoethanolamine(out)", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P58195-1", "O15162-1", "Q9JJ00-1" ], "evidence": [ { "id": "38895", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/38895" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "O15162", "gene_name": "PLSCR1", "activity": [ { "ec_number": "3.1.-.-", "activity": "", "evidence": [ { "id": "O15162", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15162" } ] } ] }, { "uniprot_ac": "P58195", "gene_name": "Plscr1", "activity": [ { "ec_number": "3.1.-.-", "activity": "", "evidence": [ { "id": "P58195", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P58195" } ] } ] }, { "uniprot_ac": "Q9JJ00", "gene_name": "Plscr1", "activity": [ { "ec_number": "3.1.-.-", "activity": "", "evidence": [ { "id": "Q9JJ00", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JJ00" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [ 69, 74, 161 ], "sequon_annotation_sites": [ { "start_pos": 9, "end_pos": 11 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 37 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }