{ "uniprot_canonical_ac": "O15130-1", "uniprot_ac": "O15130", "uniprot_id": "NPFF_HUMAN", "mass": { "chemical_mass": 12440.0, "monoisotopic_mass": 12440.0 }, "refseq": { "ac": "NP_001307225", "name": "pro-FMRFamide-related neuropeptide FF isoform 2", "summary": "This gene encodes a member of the FMRFamide related peptide (FARP) family of neuropeptides. The encoded preproprotein is proteolytically processed to generate multiple amidated peptides. These peptides may play a role in the regulation of heart rate and blood pressure and the modulation of morphine-induced antinociception. Patients with hypertension exhibit decreased expression of the encoded protein. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. [provided by RefSeq, Feb 2016].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001307225" }, "gene_names": [ { "name": "NPFF", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O15130", "id": "O15130" }, { "name": "FMRFAL", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001307225", "id": "NP_001307225" }, { "name": "NPFF", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001307225", "id": "NP_001307225" } ], "protein_names": [ { "name": "Pro-FMRFamide-related neuropeptide FF", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O15130" }, { "name": "FMRFamide-related peptides", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O15130" }, { "name": "pro-FMRFamide-related neuropeptide FF isoform 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001307225", "id": "NP_001307225" }, { "name": "pro-FMRFamide-related neuropeptide FF", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001307225", "id": "NP_001307225" } ], "function": [ { "annotation": "Morphine modulating peptides. Have wide-ranging physiologic effects, including the modulation of morphine-induced analgesia, elevation of arterial blood pressure, and increased somatostatin secretion from the pancreas. Neuropeptide FF potentiates and sensitizes ASIC1 and ASIC3 channels.", "evidence": [ { "database": "UniProtKB", "id": "O15130", "url": "https://www.uniprot.org/uniprot/O15130#function" }, { "database": "PubMed", "id": "11587714", "url": "https://glygen.org/publication/PubMed/11587714" } ] }, { "annotation": "Our results...highlight the neuropeptide FF-amide peptide encoding gene (NPFF) as a novel candidate risk gene for both migraine with aura and migraine without aura", "evidence": [ { "database": "RefSeq", "id": "NP_001307225", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001307225" }, { "database": "PubMed", "id": "26660531", "url": "https://glygen.org/publication/PubMed/26660531" } ] }, { "annotation": "Reduction of NPFF release within the dorsal motor nucleus and ambiguus nucleus could serve as a possible cause of the impairment of cardiac vagal control in hypertensive patients", "evidence": [ { "database": "RefSeq", "id": "NP_001307225", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001307225" }, { "database": "PubMed", "id": "21120930", "url": "https://glygen.org/publication/PubMed/21120930" } ] }, { "annotation": "The distribution of Neuropeptide FF and Neuropeptide VF in central and peripheral tissues and their role in energy homeostasis control. Review article", "evidence": [ { "database": "RefSeq", "id": "NP_001307225", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001307225" }, { "database": "PubMed", "id": "34534716", "url": "https://glygen.org/publication/PubMed/34534716" } ] }, { "annotation": "This gene encodes a member of the FMRFamide related peptide (FARP) family of neuropeptides. The encoded preproprotein is proteolytically processed to generate multiple amidated peptides. These peptides may play a role in the regulation of heart rate and blood pressure and the modulation of morphine-induced antinociception. Patients with hypertension exhibit decreased expression of the encoded protein. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. [provided by RefSeq, Feb 2016].", "evidence": [ { "database": "RefSeq", "id": "NP_001307225", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001307225" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "18.51", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000139574", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000139574" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "16.41", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000139574", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000139574" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "17.43", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000139574", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000139574" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "16.94", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000139574", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000139574" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "25.52", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000139574", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000139574" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "24.88", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000139574", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000139574" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "31.33", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000139574", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000139574" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "20.33", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000139574", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000139574" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "19.53", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000139574", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000139574" } ] } ], "expression_disease": [], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O15130", "url": "https://www.uniprot.org/uniprot/O15130" } ], "common_name": "Human" } ], "gene": [ { "name": "NPFF", "url": "https://www.uniprot.org/uniprot/O15130", "locus": { "chromosome": "12", "start_pos": 53506688, "end_pos": 53507484, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000139574", "url": "https://www.ensembl.org/id/ENSG00000139574" } ] } } ], "crossref": [ { "id": "ENSG00000139574", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000139574", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "NPFF", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=NPFF", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "8620", "url": "https://www.ncbi.nlm.nih.gov/gene/8620", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "7901", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=7901", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O15130", "url": "https://www.ebi.ac.uk/intact/interactors/id:O15130*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR008065", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008065", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:8620", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:8620", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "604643", "url": "http://www.omim.org/entry/604643", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O15130", "url": "https://www.nextprot.org/entry/NX_O15130", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "EGLHSQF", "url": "https://omabrowser.org/oma/group/EGLHSQF/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "1361169at2759", "url": "http://www.orthodb.org/?query=1361169at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR15044", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15044", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR15044:SF0", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR15044:SF0", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF15085", "url": "http://pfam.xfam.org/family/PF15085", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O15130", "url": "https://pharos.nih.gov/targets/O15130", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O15130", "url": "http://purl.obolibrary.org/obo/PR_O15130", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-389397", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389397", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001307225", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001307225", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "O15130", "url": "https://www.uniprot.org/uniprot/O15130", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O15130-1", "url": "https://www.uniprot.org/uniprot/O15130-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O15130-2", "url": "https://www.uniprot.org/uniprot/O15130-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MDSRQAAALLVLLLLIDGGCAEGPGGQQEDQLSAEEDSEPLPPQDAQTSGSLLHYLLQAMERPGRSQAFLFQPQRFGRNTQGSWRNEWLSPRAGEGLNSQFWSLAAPQRFGKK", "length": 113, "header": "sp|O15130-1|NPFF_HUMAN Isoform 1 of Pro-FMRFamide-related neuropeptide FF OS=Homo sapiens OX=9606 GN=NPFF PE=1 SV=1 CANONICAL=O15130-1" }, "isoforms": [ { "isoform_ac": "O15130-1", "url": "", "sequence": { "sequence": "MDSRQAAALLVLLLLIDGGCAEGPGGQQEDQLSAEEDSEPLPPQDAQTSGSLLHYLLQAMERPGRSQAFLFQPQRFGRNTQGSWRNEWLSPRAGEGLNSQFWSLAAPQRFGKK", "length": 113, "header": "sp|O15130-1|NPFF_HUMAN Isoform 1 of Pro-FMRFamide-related neuropeptide FF OS=Homo sapiens OX=9606 GN=NPFF PE=1 SV=1 CANONICAL=O15130-1" }, "locus": { "chromosome": "12", "start_pos": 53507474, "end_pos": 53506779, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000267017.4", "url": "https://www.ensembl.org/id/ENST00000267017.4" }, { "database": "Ensembl Peptide", "id": "ENSP00000267017.3", "url": "https://www.ensembl.org/id/ENSP00000267017.3" } ] } }, { "isoform_ac": "O15130-2", "url": "", "sequence": { "sequence": "MVPQPPTTCPWKPVPSPCDLRVQGICPSSFPDTPLAQEEDSEPLPPQDAQTSGSLLHYLLQAMERPGRSQAFLFQPQRFGRNTQGSWRNEWLSPRAGEGLNSQFWSLAAPQRFGKK", "length": 116, "header": "sp|O15130-2|NPFF_HUMAN Isoform 2 of Pro-FMRFamide-related neuropeptide FF OS=Homo sapiens OX=9606 GN=NPFF PE=1 SV=1 CANONICAL=O15130-1" }, "locus": {} } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Genomic organization of the human galpha14 and Galphaq genes and mutation analysis in chorea-acanthocytosis (CHAC).", "journal": "Genomics", "date": "1999", "authors": "Rubio JP, Levy ER, Dobson-Stone C, Monaco AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "10191087", "url": "https://glygen.org/publication/PubMed/10191087" } ] }, { "title": "Structure and function of human prepro-orexin gene.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Sakurai T, Moriguchi T, Furuya K, Kajiwara N, Nakamura T, Yanagisawa M, Goto K", "evidence": [ { "database": "Reactome", "id": "R-HSA-389397", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389397" } ], "reference": [ { "type": "PubMed", "id": "10364220", "url": "https://glygen.org/publication/PubMed/10364220" } ] }, { "title": "Selective regulation of Galpha(q/11) by an RGS domain in the G protein-coupled receptor kinase, GRK2.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Carman CV, Parent JL, Day PW, Pronin AN, Sternweis PM, Wedegaertner PB, Gilman AG, Benovic JL, Kozasa T", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "10567430", "url": "https://glygen.org/publication/PubMed/10567430" } ] }, { "title": "Solution structure of a new hypothalamic neuropeptide, human hypocretin-2/orexin-B.", "journal": "European journal of biochemistry", "date": "1999", "authors": "Lee JH, Bang E, Chae KJ, Kim JY, Lee DW, Lee W", "evidence": [ { "database": "Reactome", "id": "R-HSA-389397", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389397" } ], "reference": [ { "type": "PubMed", "id": "10583376", "url": "https://glygen.org/publication/PubMed/10583376" } ] }, { "title": "Selective regulation of Gq signaling by G protein-coupled receptor kinase 2: direct interaction of kinase N terminus with activated galphaq.", "journal": "Molecular pharmacology", "date": "2000", "authors": "Sallese M, Mariggio S, D'Urbano E, Iacovelli L, De Blasi A", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "10727532", "url": "https://glygen.org/publication/PubMed/10727532" } ] }, { "title": "G protein-coupled receptor kinase-5 regulates thrombin-activated signaling in endothelial cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2000", "authors": "Tiruppathi C, Yan W, Sandoval R, Naqvi T, Pronin AN, Benovic JL, Malik AB", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "10861009", "url": "https://glygen.org/publication/PubMed/10861009" } ] }, { "title": "Structure, function, and control of phosphoinositide-specific phospholipase C.", "journal": "Physiological reviews", "date": "2000", "authors": "Rebecchi MJ, Pentyala SN", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "11015615", "url": "https://glygen.org/publication/PubMed/11015615" } ] }, { "title": "Identification and characterization of two G protein-coupled receptors for neuropeptide FF.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Bonini JA, Jones KA, Adham N, Forray C, Artymyshyn R, Durkin MM, Smith KE, Tamm JA, Boteju LW, Lakhlani PP, Raddatz R, Yao WJ, Ogozalek KL, Boyle N, Kouranova EV, Quan Y, Vaysse PJ, Wetzel JM, Branchek TA, Gerald C, Borowsky B", "evidence": [ { "database": "Reactome", "id": "R-HSA-389397", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389397" } ], "reference": [ { "type": "PubMed", "id": "11024015", "url": "https://glygen.org/publication/PubMed/11024015" } ] }, { "title": "Characterization of the binding of [(125)I]-human prolactin releasing peptide (PrRP) to GPR10, a novel G protein coupled receptor.", "journal": "British journal of pharmacology", "date": "2000", "authors": "Langmead CJ, Szekeres PG, Chambers JK, Ratcliffe SJ, Jones DN, Hirst WD, Price GW, Herdon HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-389397", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389397" } ], "reference": [ { "type": "PubMed", "id": "11030716", "url": "https://glygen.org/publication/PubMed/11030716" } ] }, { "title": "Discovery and mapping of ten novel G protein-coupled receptor genes.", "journal": "Gene", "date": "2001", "authors": "Lee DK, Nguyen T, Lynch KR, Cheng R, Vanti WB, Arkhitko O, Lewis T, Evans JF, George SR, O'Dowd BF", "evidence": [ { "database": "Reactome", "id": "R-HSA-389397", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389397" } ], "reference": [ { "type": "PubMed", "id": "11574155", "url": "https://glygen.org/publication/PubMed/11574155" } ] }, { "title": "Selective modulation of heteromeric ASIC proton-gated channels by neuropeptide FF.", "journal": "Neuropharmacology", "date": "2001-10", "authors": "Catarsi S, Babinski K, S\u00e9gu\u00e9la P", "evidence": [ { "database": "UniProtKB", "id": "O15130", "url": "https://www.uniprot.org/uniprot/O15130" } ], "reference": [ { "type": "PubMed", "id": "11587714", "url": "https://glygen.org/publication/PubMed/11587714" } ] }, { "title": "Competing modes of self-association in the regulatory domains of Bruton's tyrosine kinase: intramolecular contact versus asymmetric homodimerization.", "journal": "Protein science : a publication of the Protein Society", "date": "2002", "authors": "Laederach A, Cradic KW, Brazin KN, Zamoon J, Fulton DB, Huang XY, Andreotti AH", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "11742120", "url": "https://glygen.org/publication/PubMed/11742120" } ] }, { "title": "A unique fold of phospholipase C-beta mediates dimerization and interaction with G alpha q.", "journal": "Nature structural biology", "date": "2002", "authors": "Singer AU, Waldo GL, Harden TK, Sondek J", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "11753430", "url": "https://glygen.org/publication/PubMed/11753430" } ] }, { "title": "Regulators of G-protein signalling as new central nervous system drug targets.", "journal": "Nature reviews. Drug discovery", "date": "2002", "authors": "Neubig RR, Siderovski DP", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "12120503", "url": "https://glygen.org/publication/PubMed/12120503" } ] }, { "title": "Identification and characterization of a novel RF-amide peptide ligand for orphan G-protein-coupled receptor SP9155.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Jiang Y, Luo L, Gustafson EL, Yadav D, Laverty M, Murgolo N, Vassileva G, Zeng M, Laz TM, Behan J, Qiu P, Wang L, Wang S, Bayne M, Greene J, Monsma F Jr, Zhang FL", "evidence": [ { "database": "Reactome", "id": "R-HSA-389397", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389397" } ], "reference": [ { "type": "PubMed", "id": "12714592", "url": "https://glygen.org/publication/PubMed/12714592" } ] }, { "title": "The GAPs, GEFs, and GDIs of heterotrimeric G-protein alpha subunits.", "journal": "International journal of biological sciences", "date": "2005", "authors": "Siderovski DP, Willard FS", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "15951850", "url": "https://glygen.org/publication/PubMed/15951850" } ] }, { "title": "Cell signalling diversity of the Gqalpha family of heterotrimeric G proteins.", "journal": "Cellular signalling", "date": "2006", "authors": "Hubbard KB, Hepler JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "16182515", "url": "https://glygen.org/publication/PubMed/16182515" } ] }, { "title": "Galphaq binds to p110alpha/p85alpha phosphoinositide 3-kinase and displaces Ras.", "journal": "The Biochemical journal", "date": "2006", "authors": "Ballou LM, Chattopadhyay M, Li Y, Scarlata S, Lin RZ", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "16268778", "url": "https://glygen.org/publication/PubMed/16268778" } ] }, { "title": "Snapshot of activated G proteins at the membrane: the Galphaq-GRK2-Gbetagamma complex.", "journal": "Science (New York, N.Y.)", "date": "2005", "authors": "Tesmer VM, Kawano T, Shankaranarayanan A, Kozasa T, Tesmer JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "16339447", "url": "https://glygen.org/publication/PubMed/16339447" } ] }, { "title": "Orexin-A is composed of a highly conserved C-terminal and a specific, hydrophilic N-terminal region, revealing the structural basis of specific recognition by the orexin-1 receptor.", "journal": "Journal of peptide science : an official publication of the European Peptide Society", "date": "2006", "authors": "Takai T, Takaya T, Nakano M, Akutsu H, Nakagawa A, Aimoto S, Nagai K, Ikegami T", "evidence": [ { "database": "Reactome", "id": "R-HSA-389397", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389397" } ], "reference": [ { "type": "PubMed", "id": "16429482", "url": "https://glygen.org/publication/PubMed/16429482" } ] }, { "title": "Stable association between G alpha(q) and phospholipase C beta 1 in living cells.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Dowal L, Provitera P, Scarlata S", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "16754659", "url": "https://glygen.org/publication/PubMed/16754659" } ] }, { "title": "Structural basis of function in heterotrimeric G proteins.", "journal": "Quarterly reviews of biophysics", "date": "2006", "authors": "Oldham WM, Hamm HE", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "16923326", "url": "https://glygen.org/publication/PubMed/16923326" } ] }, { "title": "Structural diversity in the RGS domain and its interaction with heterotrimeric G protein alpha-subunits.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Soundararajan M, Willard FS, Kimple AJ, Turnbull AP, Ball LJ, Schoch GA, Gileadi C, Fedorov OY, Dowler EF, Higman VA, Hutsell SQ, Sundstrom M, Doyle DA, Siderovski DP", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "18434541", "url": "https://glygen.org/publication/PubMed/18434541" } ] }, { "title": "Galphaq binds two effectors separately in cells: evidence for predetermined signaling pathways.", "journal": "Biophysical journal", "date": "2008", "authors": "Golebiewska U, Scarlata S", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "18515384", "url": "https://glygen.org/publication/PubMed/18515384" } ] }, { "title": "Dissociation of heterotrimeric g proteins in cells.", "journal": "Science signaling", "date": "2008", "authors": "Lambert NA", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "18577758", "url": "https://glygen.org/publication/PubMed/18577758" } ] }, { "title": "Assembly of high order G alpha q-effector complexes with RGS proteins.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Shankaranarayanan A, Thal DM, Tesmer VM, Roman DL, Neubig RR, Kozasa T, Tesmer JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "18936096", "url": "https://glygen.org/publication/PubMed/18936096" } ] }, { "title": "G alpha 16, a G protein alpha subunit specifically expressed in hematopoietic cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1991", "authors": "Amatruda TT 3rd, Steele DA, Slepak VZ, Simon MI", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "1905813", "url": "https://glygen.org/publication/PubMed/1905813" } ] }, { "title": "Vasopressin (VP) and neuropeptide FF (NPFF) systems in the normal and hypertensive human brainstem.", "journal": "The Journal of comparative neurology", "date": "2011", "authors": "Goncharuk VD, Buijs RM, Jhamandas JH, Swaab DF", "evidence": [ { "database": "RefSeq", "id": "NP_001307225", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001307225" } ], "reference": [ { "type": "PubMed", "id": "21120930", "url": "https://glygen.org/publication/PubMed/21120930" } ] }, { "title": "Gene-based pleiotropy across migraine with aura and migraine without aura patient groups.", "journal": "Cephalalgia : an international journal of headache", "date": "2016", "authors": "Zhao H, Eising E, de Vries B, Vijfhuizen LS, Anttila V, Winsvold BS, Kurth T, Stefansson H, Kallela M, Malik R, Stam AH, Ikram MA, Ligthart L, Freilinger T, Alexander M, Muller-Myhsok B, Schreiber S, Meitinger T, Aromas A, Eriksson JG, Boomsma DI, van Duijn CM, Zwart JA, Quaye L, Kubisch C, Dichgans M, Wessman M, Stefansson K, Chasman DI, Palotie A, Martin NG, Montgomery GW, Ferrari MD, Terwindt GM, van den Maagdenberg AM, Nyholt DR", "evidence": [ { "database": "RefSeq", "id": "NP_001307225", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001307225" } ], "reference": [ { "type": "PubMed", "id": "26660531", "url": "https://glygen.org/publication/PubMed/26660531" } ] }, { "title": "Purification and characterization of membrane-bound phospholipase C specific for phosphoinositides from human platelets.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Banno Y, Yada Y, Nozawa Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "2841328", "url": "https://glygen.org/publication/PubMed/2841328" } ] }, { "title": "The influence of bound GDP on the kinetics of guanine nucleotide binding to G proteins.", "journal": "The Journal of biological chemistry", "date": "1986", "authors": "Ferguson KM, Higashijima T, Smigel MD, Gilman AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "3086311", "url": "https://glygen.org/publication/PubMed/3086311" } ] }, { "title": "The distribution of Neuropeptide FF and Neuropeptide VF in central and peripheral tissues and their role in energy homeostasis control.", "journal": "Neuropeptides", "date": "2021", "authors": "Koller J, Herzog H, Zhang L", "evidence": [ { "database": "RefSeq", "id": "NP_001307225", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001307225" } ], "reference": [ { "type": "PubMed", "id": "34534716", "url": "https://glygen.org/publication/PubMed/34534716" } ] }, { "title": "Mechanism of GTP hydrolysis by G-protein alpha subunits.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Kleuss C, Raw AS, Lee E, Sprang SR, Gilman AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "7937899", "url": "https://glygen.org/publication/PubMed/7937899" } ] }, { "title": "Human G(alpha q): cDNA and tissue distribution.", "journal": "Biochimica et biophysica acta", "date": "1996", "authors": "Chen B, Leverette RD, Schwinn DA, Kwatra MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "8664309", "url": "https://glygen.org/publication/PubMed/8664309" } ] }, { "title": "A human gene encoding morphine modulating peptides related to NPFF and FMRFamide.", "journal": "FEBS Lett.", "date": "1997", "authors": "Perry SJ, Yi-Kung Huang E, Cronk D, Bagust J, Sharma R, Walker RJ, Wilson S, Burke JF", "evidence": [ { "database": "UniProtKB", "id": "O15130", "url": "https://www.uniprot.org/uniprot/O15130" }, { "database": "Reactome", "id": "R-HSA-389397", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389397" } ], "reference": [ { "type": "PubMed", "id": "9224703", "url": "https://glygen.org/publication/PubMed/9224703" } ] }, { "title": "Direct stimulation of Bruton's tyrosine kinase by G(q)-protein alpha-subunit.", "journal": "Nature", "date": "1997", "authors": "Bence K, Ma W, Kozasa T, Huang XY", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "9305846", "url": "https://glygen.org/publication/PubMed/9305846" } ] }, { "title": "Orexins and orexin receptors: a family of hypothalamic neuropeptides and G protein-coupled receptors that regulate feeding behavior.", "journal": "Cell", "date": "1998", "authors": "Sakurai T, Amemiya A, Ishii M, Matsuzaki I, Chemelli RM, Tanaka H, Williams SC, Richardson JA, Kozlowski GP, Wilson S, Arch JR, Buckingham RE, Haynes AC, Carr SA, Annan RS, McNulty DE, Liu WS, Terrett JA, Elshourbagy NA, Bergsma DJ, Yanagisawa M", "evidence": [ { "database": "Reactome", "id": "R-HSA-389397", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389397" } ], "reference": [ { "type": "PubMed", "id": "9491897", "url": "https://glygen.org/publication/PubMed/9491897" } ] }, { "title": "Identification of the binding site for Gqalpha on its effector Bruton's tyrosine kinase.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Ma YC, Huang XY", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "9770463", "url": "https://glygen.org/publication/PubMed/9770463" } ] } ], "pathway": [ { "id": "hsa:8620", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:8620", "resource": "KEGG Pathway" }, { "id": "R-HSA-389397", "name": "Orexin and neuropeptides FF and QRFP bind to their respective receptors", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389397", "resource": "Reactome", "description": "Orexin and neuropeptides FF and QRFP bind to their respective receptors" }, { "id": "R-HSA-416476", "name": "G alpha (q) signalling events", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476", "resource": "Reactome", "description": "G alpha (q) signalling events" } ], "orthologs": [ { "uniprot_canonical_ac": "Q9WVA8-1", "protein_name": "Pro-FMRFamide-related neuropeptide FF", "gene_name": "Npff", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MDSKWAALLLLLLLLLNWGHTEEAGSWGEDQVFAGEDKGPHPPQYAHIPDRIQTPGSLFRVLLQAMDTPRRSPAFLFQPQRFGRSAWGSWSKEQLNPQARQFWSLAAPQRFGKK", "length": 114 }, "evidence": [ { "id": "45917924", "url": "http://www.informatics.jax.org/homology/45917924", "database": "MGI" }, { "id": "O15130", "url": "https://omabrowser.org/oma/group/O15130/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9WVA9-1", "protein_name": "Pro-FMRFamide-related neuropeptide FF", "gene_name": "Npff", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MDSKWAAVLLLLLLLRNWGHAEEAGSWGEDQVFAEEDKGPHPSQYAHTPDRIQTPGSLMRVLLQAMERPRRNPAFLFQPQRFGRNAWGPWSKEQLSPQAREFWSLAAPQRFGKK", "length": 114 }, "evidence": [ { "id": "45917924", "url": "http://www.informatics.jax.org/homology/45917924", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "signaling receptor binding", "id": "GO:0005102", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005102", "evidence": [ { "database": "UniProtKB", "id": "O15130", "url": "https://www.uniprot.org/uniprot/O15130" } ], "pmid": "" }, { "name": "G protein-coupled receptor binding", "id": "GO:0001664", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001664", "evidence": [ { "database": "UniProtKB", "id": "O15130", "url": "https://www.uniprot.org/uniprot/O15130" } ], "pmid": "" }, { "name": "neuropeptide hormone activity", "id": "GO:0005184", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005184", "evidence": [ { "database": "UniProtKB", "id": "O15130", "url": "https://www.uniprot.org/uniprot/O15130" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 6, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "O15130", "url": "https://www.uniprot.org/uniprot/O15130" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "O15130", "url": "https://www.uniprot.org/uniprot/O15130" } ], "pmid": "" }, { "name": "dendrite", "id": "GO:0030425", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030425", "evidence": [ { "database": "UniProtKB", "id": "O15130", "url": "https://www.uniprot.org/uniprot/O15130" } ], "pmid": "" }, { "name": "perikaryon", "id": "GO:0043204", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043204", "evidence": [ { "database": "UniProtKB", "id": "O15130", "url": "https://www.uniprot.org/uniprot/O15130" } ], "pmid": "" }, { "name": "axon terminus", "id": "GO:0043679", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043679", "evidence": [ { "database": "UniProtKB", "id": "O15130", "url": "https://www.uniprot.org/uniprot/O15130" } ], "pmid": "" }, { "name": "postsynapse", "id": "GO:0098794", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098794", "evidence": [ { "database": "UniProtKB", "id": "O15130", "url": "https://www.uniprot.org/uniprot/O15130" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 3, "go_terms": [ { "name": "neuropeptide signaling pathway", "id": "GO:0007218", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007218", "evidence": [ { "database": "UniProtKB", "id": "O15130", "url": "https://www.uniprot.org/uniprot/O15130" } ], "pmid": "" }, { "name": "excitatory postsynaptic potential", "id": "GO:0060079", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060079", "evidence": [ { "database": "UniProtKB", "id": "O15130", "url": "https://www.uniprot.org/uniprot/O15130" } ], "pmid": "" }, { "name": "chemical synaptic transmission", "id": "GO:0007268", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007268", "evidence": [ { "database": "UniProtKB", "id": "O15130", "url": "https://www.uniprot.org/uniprot/O15130" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 38 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }