{ "uniprot_canonical_ac": "O15120-1", "uniprot_ac": "O15120", "uniprot_id": "PLCB_HUMAN", "mass": { "chemical_mass": 30914.0, "monoisotopic_mass": 30914.0 }, "refseq": { "ac": "NP_001012745", "name": "1-acyl-sn-glycerol-3-phosphate acyltransferase beta isoform b", "summary": "This gene encodes a member of the 1-acylglycerol-3-phosphate O-acyltransferase family. The protein is located within the endoplasmic reticulum membrane and converts lysophosphatidic acid to phosphatidic acid, the second step in de novo phospholipid biosynthesis. Mutations in this gene have been associated with congenital generalized lipodystrophy (CGL), or Berardinelli-Seip syndrome, a disease characterized by a near absence of adipose tissue and severe insulin resistance. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001012745" }, "gene_names": [ { "name": "AGPAT2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O15120", "id": "O15120" }, { "name": "1-AGPAT2; BSCL; BSCL1; LPAAB; LPAAT-beta; LPLAT2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001012745", "id": "NP_001012745" }, { "name": "AGPAT2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001012745", "id": "NP_001012745" } ], "protein_names": [ { "name": "1-acyl-sn-glycerol-3-phosphate acyltransferase beta", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O15120" }, { "name": "1-AGP acyltransferase 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O15120" }, { "name": "1-AGPAT 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O15120" }, { "name": "1-acyl-sn-glycerol-3-phosphate acyltransferase beta isoform b", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001012745", "id": "NP_001012745" }, { "name": "1-acylglycerol-3-phosphate O-acyltransferase 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O15120" }, { "name": "2.3.1.51", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O15120" }, { "name": "LPAAT-beta", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O15120" }, { "name": "Lysophosphatidic acid acyltransferase beta", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O15120" }, { "name": "lysophosphatidic acid acyltransferase-beta; 1-AGP acyltransferase 2; 1-acyl-sn-glycerol-3-phosphate acyltransferase beta; testicular tissue protein Li 143; 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acid acyltransferase, beta); lysophospholipid acyltransferase 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001012745", "id": "NP_001012745" } ], "function": [ { "annotation": "A rare frameshift mutation in the AGPAT2 gene in a family from gaza with congenital generalized lipodystrophy.", "evidence": [ { "database": "RefSeq", "id": "NP_001012745", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001012745" }, { "database": "PubMed", "id": "32412105", "url": "https://glygen.org/publication/PubMed/32412105" } ] }, { "annotation": "AGPAT2 interaction with CDP-diacylglycerol synthases promotes the flux of fatty acids through the CDP-diacylglycerol pathway. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001012745", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001012745" }, { "database": "PubMed", "id": "34824276", "url": "https://glygen.org/publication/PubMed/34824276" } ] }, { "annotation": "Circular RNA circ-CHI3L1.2 modulates cisplatin resistance of osteosarcoma cells via the miR-340-5p/LPAATbeta axis.", "evidence": [ { "database": "RefSeq", "id": "NP_001012745", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001012745" }, { "database": "PubMed", "id": "34164774", "url": "https://glygen.org/publication/PubMed/34164774" } ] }, { "annotation": "Congenital Generalized Lipoatrophy (Berardinelli-Seip Syndrome) Type 1: Description of Novel AGPAT2 Homozygous Variants Showing the Highly Heterogeneous Presentation of the Disease. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001012745", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001012745" }, { "database": "PubMed", "id": "32117065", "url": "https://glygen.org/publication/PubMed/32117065" } ] }, { "annotation": "Converts 1-acyl-sn-glycerol-3-phosphate (lysophosphatidic acid or LPA) into 1,2-diacyl-sn-glycerol-3-phosphate (phosphatidic acid or PA) by incorporating an acyl moiety at the sn-2 position of the glycerol backbone.", "evidence": [ { "database": "UniProtKB", "id": "O15120", "url": "https://www.uniprot.org/uniprot/O15120#function" }, { "database": "PubMed", "id": "15629135", "url": "https://glygen.org/publication/PubMed/15629135" }, { "database": "PubMed", "id": "9242711", "url": "https://glygen.org/publication/PubMed/9242711" }, { "database": "PubMed", "id": "19075029", "url": "https://glygen.org/publication/PubMed/19075029" }, { "database": "PubMed", "id": "21873652", "url": "https://glygen.org/publication/PubMed/21873652" } ] }, { "annotation": "Oligomers of the lipodystrophy protein seipin may co-ordinate GPAT3 and AGPAT2 enzymes to facilitate adipocyte differentiation. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001012745", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001012745" }, { "database": "PubMed", "id": "32094408", "url": "https://glygen.org/publication/PubMed/32094408" } ] }, { "annotation": "This gene encodes a member of the 1-acylglycerol-3-phosphate O-acyltransferase family. The protein is located within the endoplasmic reticulum membrane and converts lysophosphatidic acid to phosphatidic acid, the second step in de novo phospholipid biosynthesis. Mutations in this gene have been associated with congenital generalized lipodystrophy (CGL), or Berardinelli-Seip syndrome, a disease characterized by a near absence of adipose tissue and severe insulin resistance. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_001012745", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001012745" } ] } ], "disease": [ { "disease_id": "DOID:0050585", "recommended_name": { "id": "DOID:0050585", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0050585", "name": "congenital generalized lipodystrophy", "description": "A lipodystrophy that is characterized by extreme scarcity of subcutaneous fat, muscular hypertrophy, fatty liver, hypertriglyceremia and metabolic complications including insulin resistance." }, "synonyms": [ { "id": "MONDO:0012071", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012071", "name": "congenital generalized lipodystrophy type 1", "description": "Any congenital generalized lipodystrophy in which the cause of the disease is a mutation in the AGPAT2 gene." }, { "id": "MONDO:0012071", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012071", "name": "AGPAT2 congenital generalised lipodystrophy (disease)", "description": "" }, { "id": "MONDO:0012071", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012071", "name": "AGPAT2 congenital generalized lipodystrophy (disease)", "description": "" }, { "id": "MONDO:0012071", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012071", "name": "BSCL1", "description": "" }, { "id": "MONDO:0012071", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012071", "name": "Berardinelli-Seip congenital lipodystrophy, type 1", "description": "" }, { "id": "MONDO:0012071", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012071", "name": "Brunzell syndrome AGPAT2-related", "description": "" }, { "id": "MONDO:0012071", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012071", "name": "CGL1", "description": "" }, { "id": "MONDO:0012071", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012071", "name": "congenital generalised lipodystrophy (disease) caused by mutation in AGPAT2", "description": "" }, { "id": "MONDO:0012071", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012071", "name": "congenital generalized lipodystrophy (disease) caused by mutation in AGPAT2", "description": "" }, { "id": "MONDO:0012071", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012071", "name": "congenital generalized lipodystrophy type 1", "description": "" }, { "id": "MONDO:0012071", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012071", "name": "AGPAT2-related Brunzell syndrome", "description": "" }, { "id": "MONDO:0012071", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012071", "name": "Berardinelli-Seip congenital lipodystrophy type 1", "description": "" }, { "id": "MONDO:0012071", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012071", "name": "Brunzell syndrome, AGPAT2-related", "description": "" }, { "id": "MONDO:0012071", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012071", "name": "lipodystrophy, Berardinelli-Seip congenital, type 1", "description": "" }, { "id": "MONDO:0012071", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012071", "name": "lipodystrophy, congenital generalized, type 1", "description": "" }, { "id": "MIM:608594", "resource": "MIM", "url": "https://www.omim.org/entry/608594", "name": "Congenital generalized lipodystrophy 1", "description": "Congenital generalized lipodystrophy 1" } ], "evidence": [ { "id": "608594", "database": "MIM", "url": "https://www.omim.org/entry/608594" } ] }, { "disease_id": "DOID:0111135", "recommended_name": { "id": "DOID:0111135", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111135", "name": "congenital generalized lipodystrophy type 1", "description": "A congenital generalized lipodystrophy that has_material_basis_in an autosomal recessive mutation of AGPAT2 on chromosome 9q34.3." }, "synonyms": [ { "id": "DOID:0111135", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111135", "name": "Berardinelli-Seip Congenital Lipodystrophy, Type 1", "description": "" }, { "id": "DOID:0111135", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111135", "name": "Brunzell syndrome AGPAT2-related", "description": "" }, { "id": "MONDO:0012071", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012071", "name": "congenital generalized lipodystrophy type 1", "description": "Any congenital generalized lipodystrophy in which the cause of the disease is a mutation in the AGPAT2 gene." }, { "id": "MONDO:0012071", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012071", "name": "AGPAT2 congenital generalised lipodystrophy (disease)", "description": "" }, { "id": "MONDO:0012071", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012071", "name": "AGPAT2 congenital generalized lipodystrophy (disease)", "description": "" }, { "id": "MONDO:0012071", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012071", "name": "BSCL1", "description": "" }, { "id": "MONDO:0012071", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012071", "name": "Berardinelli-Seip congenital lipodystrophy, type 1", "description": "" }, { "id": "MONDO:0012071", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012071", "name": "Brunzell syndrome AGPAT2-related", "description": "" }, { "id": "MONDO:0012071", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012071", "name": "CGL1", "description": "" }, { "id": "MONDO:0012071", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012071", "name": "congenital generalised lipodystrophy (disease) caused by mutation in AGPAT2", "description": "" }, { "id": "MONDO:0012071", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012071", "name": "congenital generalized lipodystrophy (disease) caused by mutation in AGPAT2", "description": "" }, { "id": "MONDO:0012071", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012071", "name": "congenital generalized lipodystrophy type 1", "description": "" }, { "id": "MONDO:0012071", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012071", "name": "AGPAT2-related Brunzell syndrome", "description": "" }, { "id": "MONDO:0012071", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012071", "name": "Berardinelli-Seip congenital lipodystrophy type 1", "description": "" }, { "id": "MONDO:0012071", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012071", "name": "Brunzell syndrome, AGPAT2-related", "description": "" }, { "id": "MONDO:0012071", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012071", "name": "lipodystrophy, Berardinelli-Seip congenital, type 1", "description": "" }, { "id": "MONDO:0012071", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012071", "name": "lipodystrophy, congenital generalized, type 1", "description": "" }, { "id": "MIM:608594", "resource": "MIM", "url": "https://www.omim.org/entry/608594", "name": "Congenital generalized lipodystrophy 1", "description": "Congenital generalized lipodystrophy 1" } ], "evidence": [ { "id": "608594", "database": "MIM", "url": "https://www.omim.org/entry/608594" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "89.03", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000169692", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000169692" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "78.83", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000169692", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000169692" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "87.81", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000169692", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000169692" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "88.35", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000169692", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000169692" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "96.22", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000169692", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000169692" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "86.59", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000169692", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000169692" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "93.4", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000169692", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000169692" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "84.99", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000169692", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000169692" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "91.27", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000169692", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000169692" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "79.36", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000169692", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000169692" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "95.19", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000169692", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000169692" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "91.24", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000169692", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000169692" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "93.08", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000169692", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000169692" } ] } ], "expression_disease": [ { "significant": "No", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O15120", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15120" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O15120", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15120" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O15120", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15120" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O15120", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15120" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O15120", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15120" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O15120", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15120" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O15120", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15120" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O15120", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15120" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O15120", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15120" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O15120", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15120" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O15120", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15120" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O15120", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O15120" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O15120", "url": "https://www.uniprot.org/uniprot/O15120" } ], "common_name": "Human" } ], "gene": [ { "name": "AGPAT2", "url": "https://www.uniprot.org/uniprot/O15120", "locus": { "chromosome": "9", "start_pos": 136673143, "end_pos": 136687457, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000169692", "url": "https://www.ensembl.org/id/ENSG00000169692" } ] } } ], "crossref": [ { "id": "ENSG00000169692", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000169692", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "2.3.1.51", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=2.3.1.51&UniProtAcc=O15120", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "cd07989", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd07989", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL4772", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL4772", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "AGPAT2", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=AGPAT2", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "10555", "url": "https://www.ncbi.nlm.nih.gov/gene/10555", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "325", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=325", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O15120", "url": "https://www.ebi.ac.uk/intact/interactors/id:O15120*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR002123", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002123", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR004552", "url": "https://www.ebi.ac.uk/interpro/entry/IPR004552", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:10555", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:10555", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "603100", "url": "http://www.omim.org/entry/603100", "database": "MIM", "categories": [ "Other" ] }, { "id": "608594", "url": "http://www.omim.org/entry/608594", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O15120", "url": "https://www.nextprot.org/entry/NX_O15120", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "MPRPLCY", "url": "https://omabrowser.org/oma/group/MPRPLCY/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "209232at2759", "url": "http://www.orthodb.org/?query=209232at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10434", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10434", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10434:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10434:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01553", "url": "http://pfam.xfam.org/family/PF01553", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O15120", "url": "https://pharos.nih.gov/targets/O15120", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O15120", "url": "http://purl.obolibrary.org/obo/PR_O15120", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001012745", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001012745", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "19709", "url": "https://www.rhea-db.org/rhea/19709", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "33187", "url": "https://www.rhea-db.org/rhea/33187", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "35899", "url": "https://www.rhea-db.org/rhea/35899", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "35903", "url": "https://www.rhea-db.org/rhea/35903", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "35907", "url": "https://www.rhea-db.org/rhea/35907", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "35915", "url": "https://www.rhea-db.org/rhea/35915", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "37131", "url": "https://www.rhea-db.org/rhea/37131", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "37139", "url": "https://www.rhea-db.org/rhea/37139", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "37143", "url": "https://www.rhea-db.org/rhea/37143", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "37155", "url": "https://www.rhea-db.org/rhea/37155", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "37159", "url": "https://www.rhea-db.org/rhea/37159", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "37171", "url": "https://www.rhea-db.org/rhea/37171", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "37175", "url": "https://www.rhea-db.org/rhea/37175", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "37179", "url": "https://www.rhea-db.org/rhea/37179", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "37183", "url": "https://www.rhea-db.org/rhea/37183", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "37187", "url": "https://www.rhea-db.org/rhea/37187", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "37603", "url": "https://www.rhea-db.org/rhea/37603", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "O15120", "url": "https://www.uniprot.org/uniprot/O15120", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O15120-1", "url": "https://www.uniprot.org/uniprot/O15120-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O15120-2", "url": "https://www.uniprot.org/uniprot/O15120-2", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MELWPCLAAALLLLLLLVQLSRAAEFYAKVALYCALCFTVSAVASLVCLLRHGGRTVENMSIIGWFVRSFKYFYGLRFEVRDPRRLQEARPCVIVSNHQSILDMMGLMEVLPERCVQIAKRELLFLGPVGLIMYLGGVFFINRQRSSTAMTVMADLGERMVRENLKVWIYPEGTRNDNGDLLPFKKGAFYLAVQAQVPIVPVVYSSFSSFYNTKKKFFTSGTVTVQVLEAIPTSGLTAADVPALVDTCHRAMRTTFLHISKTPQENGATAGSGVQPAQ", "length": 278, "header": "sp|O15120-1|PLCB_HUMAN Isoform 1 of 1-acyl-sn-glycerol-3-phosphate acyltransferase beta OS=Homo sapiens OX=9606 GN=AGPAT2 PE=1 SV=1 CANONICAL=O15120-1" }, "isoforms": [ { "isoform_ac": "O15120-1", "url": "", "sequence": { "sequence": "MELWPCLAAALLLLLLLVQLSRAAEFYAKVALYCALCFTVSAVASLVCLLRHGGRTVENMSIIGWFVRSFKYFYGLRFEVRDPRRLQEARPCVIVSNHQSILDMMGLMEVLPERCVQIAKRELLFLGPVGLIMYLGGVFFINRQRSSTAMTVMADLGERMVRENLKVWIYPEGTRNDNGDLLPFKKGAFYLAVQAQVPIVPVVYSSFSSFYNTKKKFFTSGTVTVQVLEAIPTSGLTAADVPALVDTCHRAMRTTFLHISKTPQENGATAGSGVQPAQ", "length": 278, "header": "sp|O15120-1|PLCB_HUMAN Isoform 1 of 1-acyl-sn-glycerol-3-phosphate acyltransferase beta OS=Homo sapiens OX=9606 GN=AGPAT2 PE=1 SV=1 CANONICAL=O15120-1" }, "locus": { "chromosome": "9", "start_pos": 136687357, "end_pos": 136673755, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000371696.7", "url": "https://www.ensembl.org/id/ENST00000371696.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000360761.2", "url": "https://www.ensembl.org/id/ENSP00000360761.2" } ] } }, { "isoform_ac": "O15120-2", "url": "", "sequence": { "sequence": "MELWPCLAAALLLLLLLVQLSRAAEFYAKVALYCALCFTVSAVASLVCLLRHGGRTVENMSIIGWFVRSFKYFYGLRFEVRDPRRLQEARPCVIVSNHQSILDMMGLMEVLPERCVQIAKRELLFLGPVGLIMYLGGVFFINRQRSSTAMTVMADLGERMVRENVPIVPVVYSSFSSFYNTKKKFFTSGTVTVQVLEAIPTSGLTAADVPALVDTCHRAMRTTFLHISKTPQENGATAGSGVQPAQ", "length": 246, "header": "sp|O15120-2|PLCB_HUMAN Isoform 2 of 1-acyl-sn-glycerol-3-phosphate acyltransferase beta OS=Homo sapiens OX=9606 GN=AGPAT2 PE=1 SV=1 CANONICAL=O15120-1" }, "locus": { "chromosome": "9", "start_pos": 136687357, "end_pos": 136673755, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000371694.7", "url": "https://www.ensembl.org/id/ENST00000371694.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000360759.3", "url": "https://www.ensembl.org/id/ENSP00000360759.3" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [ "enzyme" ], "publication": [ { "title": "Cloning and characterization of novel mouse and human secretory phospholipase A(2)s.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Ishizaki J, Suzuki N, Higashino K, Yokota Y, Ono T, Kawamoto K, Fujii N, Arita H, Hanasaki K", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "10455175", "url": "https://glygen.org/publication/PubMed/10455175" } ] }, { "title": "Isolation of a cDNA encoding human lysophosphatidic acid phosphatase that is involved in the regulation of mitochondrial lipid biosynthesis.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Hiroyama M, Takenawa T", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "10506173", "url": "https://glygen.org/publication/PubMed/10506173" } ] }, { "title": "Ether lipid biosynthesis: alkyl-dihydroxyacetonephosphate synthase protein deficiency leads to reduced dihydroxyacetonephosphate acyltransferase activities.", "journal": "Journal of lipid research", "date": "1999", "authors": "de Vet EC, Ijlst L, Oostheim W, Dekker C, Moser HW, van Den Bosch H, Wanders RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "10553003", "url": "https://glygen.org/publication/PubMed/10553003" } ] }, { "title": "Structures, enzymatic properties, and expression of novel human and mouse secretory phospholipase A(2)s.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Suzuki N, Ishizaki J, Yokota Y, Higashino K, Ono T, Ikeda M, Fujii N, Kawamoto K, Hanasaki K", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "10681567", "url": "https://glygen.org/publication/PubMed/10681567" } ] }, { "title": "Cloning and recombinant expression of a structurally novel human secreted phospholipase A2.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Gelb MH, Valentin E, Ghomashchi F, Lazdunski M, Lambeau G", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "11031251", "url": "https://glygen.org/publication/PubMed/11031251" } ] }, { "title": "Cloning and recombinant expression of human group IIF-secreted phospholipase A(2).", "journal": "Biochemical and biophysical research communications", "date": "2000", "authors": "Valentin E, Singer AG, Ghomashchi F, Lazdunski M, Gelb MH, Lambeau G", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "11112443", "url": "https://glygen.org/publication/PubMed/11112443" } ] }, { "title": "A novel phospholipase A1 with sequence homology to a mammalian Sec23p-interacting protein, p125.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Nakajima K, Sonoda H, Mizoguchi T, Aoki J, Arai H, Nagahama M, Tagaya M, Tani K", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "11788596", "url": "https://glygen.org/publication/PubMed/11788596" } ] }, { "title": "Identification of a soluble form phospholipase A2 receptor as a circulating endogenous inhibitor for secretory phospholipase A2.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Higashino Ki K, Yokota Y, Ono T, Kamitani S, Arita H, Hanasaki K", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "11830583", "url": "https://glygen.org/publication/PubMed/11830583" } ] }, { "title": "AGPAT2 is mutated in congenital generalized lipodystrophy linked to chromosome 9q34.", "journal": "Nature genetics", "date": "2002", "authors": "Agarwal AK, Arioglu E, De Almeida S, Akkoc N, Taylor SI, Bowcock AM, Barnes RI, Garg A", "evidence": [ { "database": "UniProtKB", "id": "O15120", "url": "https://www.uniprot.org/uniprot/O15120" } ], "reference": [ { "type": "PubMed", "id": "11967537", "url": "https://glygen.org/publication/PubMed/11967537" } ] }, { "title": "A novel phosphatidic acid-selective phospholipase A1 that produces lysophosphatidic acid.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Sonoda H, Aoki J, Hiramatsu T, Ishida M, Bandoh K, Nagai Y, Taguchi R, Inoue K, Arai H", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "12063250", "url": "https://glygen.org/publication/PubMed/12063250" } ] }, { "title": "Crystal structure of human group X secreted phospholipase A2. Electrostatically neutral interfacial surface targets zwitterionic membranes.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Pan YH, Yu BZ, Singer AG, Ghomashchi F, Lambeau G, Gelb MH, Jain MK, Bahnson BJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "12161451", "url": "https://glygen.org/publication/PubMed/12161451" } ] }, { "title": "Interfacial kinetic and binding properties of the complete set of human and mouse groups I, II, V, X, and XII secreted phospholipases A2.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Singer AG, Ghomashchi F, Le Calvez C, Bollinger J, Bezzine S, Rouault M, Sadilek M, Nguyen E, Lazdunski M, Lambeau G, Gelb MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "12359733", "url": "https://glygen.org/publication/PubMed/12359733" } ] }, { "title": "Cellular arachidonate-releasing function of novel classes of secretory phospholipase A2s (groups III and XII).", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Murakami M, Masuda S, Shimbara S, Bezzine S, Lazdunski M, Lambeau G, Gelb MH, Matsukura S, Kokubu F, Adachi M, Kudo I", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "12522102", "url": "https://glygen.org/publication/PubMed/12522102" } ] }, { "title": "Biochemical and molecular characterization of two phosphatidic acid-selective phospholipase A1s, mPA-PLA1alpha and mPA-PLA1beta.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Hiramatsu T, Sonoda H, Takanezawa Y, Morikawa R, Ishida M, Kasahara K, Sanai Y, Taguchi R, Aoki J, Arai H", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "12963729", "url": "https://glygen.org/publication/PubMed/12963729" } ] }, { "title": "Phospholipid scramblase 3 controls mitochondrial structure, function, and apoptotic response.", "journal": "Molecular cancer research : MCR", "date": "2003", "authors": "Liu J, Dai Q, Chen J, Durrant D, Freeman A, Liu T, Grossman D, Lee RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "14573790", "url": "https://glygen.org/publication/PubMed/14573790" } ] }, { "title": "Acquired and inherited lipodystrophies.", "journal": "N. Engl. J. Med.", "date": "2004", "authors": "Garg Abhimanyu", "evidence": [ { "database": "UniProtKB", "id": "O15120", "url": "https://www.uniprot.org/uniprot/O15120" } ], "reference": [ { "type": "PubMed", "id": "15028826", "url": "https://glygen.org/publication/PubMed/15028826" } ] }, { "title": "Cloning and characterization of murine 1-acyl-sn-glycerol 3-phosphate acyltransferases and their regulation by PPARalpha in murine heart.", "journal": "The Biochemical journal", "date": "2005", "authors": "Lu B, Jiang YJ, Zhou Y, Xu FY, Hatch GM, Choy PC", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "15367102", "url": "https://glygen.org/publication/PubMed/15367102" } ] }, { "title": "Enzymatic activity of naturally occurring 1-acylglycerol-3-phosphate-O-acyltransferase 2 mutants associated with congenital generalized lipodystrophy.", "journal": "Biochemical and biophysical research communications", "date": "2005", "authors": "Haque W, Garg A, Agarwal AK", "evidence": [ { "database": "UniProtKB", "id": "O15120", "url": "https://www.uniprot.org/uniprot/O15120" } ], "reference": [ { "type": "PubMed", "id": "15629135", "url": "https://glygen.org/publication/PubMed/15629135" } ] }, { "title": "Crystal structures of human glycerol 3-phosphate dehydrogenase 1 (GPD1).", "journal": "Journal of molecular biology", "date": "2006", "authors": "Ou X, Ji C, Han X, Zhao X, Li X, Mao Y, Wong LL, Bartlam M, Rao Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "16460752", "url": "https://glygen.org/publication/PubMed/16460752" } ] }, { "title": "A regulatory role for 1-acylglycerol-3-phosphate-O-acyltransferase 2 in adipocyte differentiation.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Gale SE, Frolov A, Han X, Bickel PE, Cao L, Bowcock A, Schaffer JE, Ory DS", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "16495223", "url": "https://glygen.org/publication/PubMed/16495223" } ] }, { "title": "Functional characterization of human 1-acylglycerol-3-phosphate acyltransferase isoform 8: cloning, tissue distribution, gene structure, and enzymatic activity.", "journal": "Archives of biochemistry and biophysics", "date": "2006", "authors": "Agarwal AK, Barnes RI, Garg A", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "16620771", "url": "https://glygen.org/publication/PubMed/16620771" } ] }, { "title": "Cloning and characterization of mouse lung-type acyl-CoA:lysophosphatidylcholine acyltransferase 1 (LPCAT1). Expression in alveolar type II cells and possible involvement in surfactant production.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Nakanishi H, Shindou H, Hishikawa D, Harayama T, Ogasawara R, Suwabe A, Taguchi R, Shimizu T", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "16704971", "url": "https://glygen.org/publication/PubMed/16704971" } ] }, { "title": "Identification and characterization of a lysophosphatidylcholine acyltransferase in alveolar type II cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Chen X, Hyatt BA, Mucenski ML, Mason RJ, Shannon JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "16864775", "url": "https://glygen.org/publication/PubMed/16864775" } ] }, { "title": "A common lipid links Mfn-mediated mitochondrial fusion and SNARE-regulated exocytosis.", "journal": "Nature cell biology", "date": "2006", "authors": "Choi SY, Huang P, Jenkins GM, Chan DC, Schiller J, Frohman MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "17028579", "url": "https://glygen.org/publication/PubMed/17028579" } ] }, { "title": "Molecular identification of microsomal acyl-CoA:glycerol-3-phosphate acyltransferase, a key enzyme in de novo triacylglycerol synthesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Cao J, Li JL, Li D, Tobin JF, Gimeno RE", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "17170135", "url": "https://glygen.org/publication/PubMed/17170135" } ] }, { "title": "Topology of acyltransferase motifs and substrate specificity and accessibility in 1-acyl-sn-glycero-3-phosphate acyltransferase 1.", "journal": "Biochimica et biophysica acta", "date": "2007", "authors": "Yamashita A, Nakanishi H, Suzuki H, Kamata R, Tanaka K, Waku K, Sugiura T", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "17707131", "url": "https://glygen.org/publication/PubMed/17707131" } ] }, { "title": "AGPAT6 is a novel microsomal glycerol-3-phosphate acyltransferase.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Chen YQ, Kuo MS, Li S, Bui HH, Peake DA, Sanders PE, Thibodeaux SJ, Chu S, Qian YW, Zhao Y, Bredt DS, Moller DE, Konrad RJ, Beigneux AP, Young SG, Cao G", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "18238778", "url": "https://glygen.org/publication/PubMed/18238778" } ] }, { "title": "Acyl-CoA:lysophospholipid acyltransferases.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Shindou H, Shimizu T", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "18718904", "url": "https://glygen.org/publication/PubMed/18718904" } ] }, { "title": "The microsomal cardiolipin remodeling enzyme acyl-CoA lysocardiolipin acyltransferase is an acyltransferase of multiple anionic lysophospholipids.", "journal": "Journal of lipid research", "date": "2009", "authors": "Zhao Y, Chen YQ, Li S, Konrad RJ, Cao G", "evidence": [ { "database": "UniProtKB", "id": "O15120", "url": "https://www.uniprot.org/uniprot/O15120" } ], "reference": [ { "type": "PubMed", "id": "19075029", "url": "https://glygen.org/publication/PubMed/19075029" } ] }, { "title": "Biochemistry, physiology, and genetics of GPAT, AGPAT, and lipin enzymes in triglyceride synthesis.", "journal": "American journal of physiology. Endocrinology and metabolism", "date": "2009", "authors": "Takeuchi K, Reue K", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "19336658", "url": "https://glygen.org/publication/PubMed/19336658" } ] }, { "title": "GPD1L links redox state to cardiac excitability by PKC-dependent phosphorylation of the sodium channel SCN5A.", "journal": "American journal of physiology. Heart and circulatory physiology", "date": "2009", "authors": "Valdivia CR, Ueda K, Ackerman MJ, Makielski JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "19666841", "url": "https://glygen.org/publication/PubMed/19666841" } ] }, { "title": "Interfacial kinetic and binding properties of mammalian group IVB phospholipase A2 (cPLA2beta) and comparison with the other cPLA2 isoforms.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Ghomashchi F, Naika GS, Bollinger JG, Aloulou A, Lehr M, Leslie CC, Gelb MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "20705608", "url": "https://glygen.org/publication/PubMed/20705608" } ] }, { "title": "Enzymatic activities of the human AGPAT isoform 3 and isoform 5: localization of AGPAT5 to mitochondria.", "journal": "Journal of lipid research", "date": "2011", "authors": "Prasad SS, Garg A, Agarwal AK", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "21173190", "url": "https://glygen.org/publication/PubMed/21173190" } ] }, { "title": "Human 1-acylglycerol-3-phosphate O-acyltransferase isoforms 1 and 2: biochemical characterization and inability to rescue hepatic steatosis in Agpat2(-/-) gene lipodystrophic mice.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Agarwal AK, Sukumaran S, Cortes VA, Tunison K, Mizrachi D, Sankella S, Gerard RD, Horton JD, Garg A", "evidence": [ { "database": "UniProtKB", "id": "O15120", "url": "https://www.uniprot.org/uniprot/O15120" } ], "reference": [ { "type": "PubMed", "id": "21873652", "url": "https://glygen.org/publication/PubMed/21873652" } ] }, { "title": "Lysophospholipid acyltransferases: 1-acylglycerol-3-phosphate O-acyltransferases. From discovery to disease.", "journal": "Current opinion in lipidology", "date": "2012", "authors": "Agarwal AK", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "22777291", "url": "https://glygen.org/publication/PubMed/22777291" } ] }, { "title": "Roles of SAM and DDHD domains in mammalian intracellular phospholipase A1 KIAA0725p.", "journal": "Biochimica et biophysica acta", "date": "2012", "authors": "Inoue H, Baba T, Sato S, Ohtsuki R, Takemori A, Watanabe T, Tagaya M, Tani K", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "22922100", "url": "https://glygen.org/publication/PubMed/22922100" } ] }, { "title": "Alteration of fatty-acid-metabolizing enzymes affects mitochondrial form and function in hereditary spastic paraplegia.", "journal": "American journal of human genetics", "date": "2012", "authors": "Tesson C, Nawara M, Salih MA, Rossignol R, Zaki MS, Al Balwi M, Schule R, Mignot C, Obre E, Bouhouche A, Santorelli FM, Durand CM, Oteyza AC, El-Hachimi KH, Al Drees A, Bouslam N, Lamari F, Elmalik SA, Kabiraj MM, Seidahmed MZ, Esteves T, Gaussen M, Monin ML, Gyapay G, Lechner D, Gonzalez M, Depienne C, Mochel F, Lavie J, Schols L, Lacombe D, Yahyaoui M, Al Abdulkareem I, Zuchner S, Yamashita A, Benomar A, Goizet C, Durr A, Gleeson JG, Darios F, Brice A, Stevanin G", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "23176821", "url": "https://glygen.org/publication/PubMed/23176821" } ] }, { "title": "Mutations in DDHD2, encoding an intracellular phospholipase A(1), cause a recessive form of complex hereditary spastic paraplegia.", "journal": "American journal of human genetics", "date": "2012", "authors": "Schuurs-Hoeijmakers JH, Geraghty MT, Kamsteeg EJ, Ben-Salem S, de Bot ST, Nijhof B, van de Vondervoort II, van der Graaf M, Nobau AC, Otte-Holler I, Vermeer S, Smith AC, Humphreys P, Schwartzentruber J, Ali BR, Al-Yahyaee SA, Tariq S, Pramathan T, Bayoumi R, Kremer HP, van de Warrenburg BP, van den Akker WM, Gilissen C, Veltman JA, Janssen IM, Vulto-van Silfhout AT, van der Velde-Visser S, Lefeber DJ, Diekstra A, Erasmus CE, Willemsen MA, Vissers LE, Lammens M, van Bokhoven H, Brunner HG, Wevers RA, Schenck A, Al-Gazali L, de Vries BB, de Brouwer AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "23176823", "url": "https://glygen.org/publication/PubMed/23176823" } ] }, { "title": "Proteome profiling of human neutrophil granule subsets, secretory vesicles, and cell membrane: correlation with transcriptome profiling of neutrophil precursors.", "journal": "Journal of leukocyte biology", "date": "2013", "authors": "Rorvig S, Ostergaard O, Heegaard NH, Borregaard N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695" } ], "reference": [ { "type": "PubMed", "id": "23650620", "url": "https://glygen.org/publication/PubMed/23650620" } ] }, { "title": "Crystal structures and biochemical studies of human lysophosphatidic acid phosphatase type 6.", "journal": "Protein & cell", "date": "2013", "authors": "Li J, Dong Y, Lu X, Wang L, Peng W, Zhang XC, Rao Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "23807634", "url": "https://glygen.org/publication/PubMed/23807634" } ] }, { "title": "Alkaline phosphatase: an overview.", "journal": "Indian journal of clinical biochemistry : IJCB", "date": "2014", "authors": "Sharma U, Pal D, Prasad R", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "24966474", "url": "https://glygen.org/publication/PubMed/24966474" } ] }, { "title": "Mitoguardin Regulates Mitochondrial Fusion through MitoPLD and Is Required for Neuronal Homeostasis.", "journal": "Molecular cell", "date": "2016", "authors": "Zhang Y, Liu X, Bai J, Tian X, Zhao X, Liu W, Duan X, Shang W, Fan HY, Tong C", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "26711011", "url": "https://glygen.org/publication/PubMed/26711011" } ] }, { "title": "Cloning and recombinant expression of phospholipase A2 present in rheumatoid arthritic synovial fluid.", "journal": "The Journal of biological chemistry", "date": "1989", "authors": "Seilhamer JJ, Pruzanski W, Vadas P, Plant S, Miller JA, Kloss J, Johnson LK", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "2925608", "url": "https://glygen.org/publication/PubMed/2925608" } ] }, { "title": "Oligomers of the lipodystrophy protein seipin may co-ordinate GPAT3 and AGPAT2 enzymes to facilitate adipocyte differentiation.", "journal": "Scientific reports", "date": "2020", "authors": "Sim MFM, Persiani E, Talukder MMU, Mcilroy GD, Roumane A, Edwardson JM, Rochford JJ", "evidence": [ { "database": "RefSeq", "id": "NP_001012745", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001012745" } ], "reference": [ { "type": "PubMed", "id": "32094408", "url": "https://glygen.org/publication/PubMed/32094408" } ] }, { "title": "Congenital Generalized Lipoatrophy (Berardinelli-Seip Syndrome) Type 1: Description of Novel AGPAT2 Homozygous Variants Showing the Highly Heterogeneous Presentation of the Disease.", "journal": "Frontiers in endocrinology", "date": "2020", "authors": "Ceccarini G, Magno S, Pelosini C, Ferrari F, Sessa MR, Scabia G, Maffei M, Jeru I, Lascols O, Vigouroux C, Santini F", "evidence": [ { "database": "RefSeq", "id": "NP_001012745", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001012745" } ], "reference": [ { "type": "PubMed", "id": "32117065", "url": "https://glygen.org/publication/PubMed/32117065" } ] }, { "title": "A rare frameshift mutation in the AGPAT2 gene in a family from gaza with congenital generalized lipodystrophy.", "journal": "Clinical endocrinology", "date": "2020", "authors": "Gorin K, Golomb M, Spitzen S, Leitersdorf E, Schurr D, Haj-Yahia A, Weiss R, Leibowitz G, Durst R", "evidence": [ { "database": "RefSeq", "id": "NP_001012745", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001012745" } ], "reference": [ { "type": "PubMed", "id": "32412105", "url": "https://glygen.org/publication/PubMed/32412105" } ] }, { "title": "Circular RNA circ-CHI3L1.2 modulates cisplatin resistance of osteosarcoma cells via the miR-340-5p/LPAATbeta axis.", "journal": "Human cell", "date": "2021", "authors": "Zhang Z, Zhou Q, Luo F, Zhou R, Xu J, Xiao J, Dai F, Song L", "evidence": [ { "database": "RefSeq", "id": "NP_001012745", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001012745" } ], "reference": [ { "type": "PubMed", "id": "34164774", "url": "https://glygen.org/publication/PubMed/34164774" } ] }, { "title": "Partial sequencing of human adult, human fetal, and bovine intestinal alkaline phosphatases: comparison with the human placental and liver isozymes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1986", "authors": "Hua JC, Berger J, Pan YC, Hulmes JD, Udenfriend S", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "3458202", "url": "https://glygen.org/publication/PubMed/3458202" } ] }, { "title": "AGPAT2 interaction with CDP-diacylglycerol synthases promotes the flux of fatty acids through the CDP-diacylglycerol pathway.", "journal": "Nature communications", "date": "2021", "authors": "Mak HY, Ouyang Q, Tumanov S, Xu J, Rong P, Dong F, Lam SM, Wang X, Lukmantara I, Du X, Gao M, Brown AJ, Gong X, Shui G, Stocker R, Huang X, Chen S, Yang H", "evidence": [ { "database": "RefSeq", "id": "NP_001012745", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001012745" } ], "reference": [ { "type": "PubMed", "id": "34824276", "url": "https://glygen.org/publication/PubMed/34824276" } ] }, { "title": "Studies on prophospholipase A2 and its enzyme from human pancreatic juice. Catalytic properties and sequence of the N-terminal region.", "journal": "European journal of biochemistry", "date": "1982", "authors": "Grataroli R, Dijkman R, Dutilh CE, van der Ouderaa F, De Haas GH, Figarella C", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "7060561", "url": "https://glygen.org/publication/PubMed/7060561" } ] }, { "title": "The sequence of a human mitochondrial glycerol-3-phosphate dehydrogenase-encoding cDNA.", "journal": "Gene", "date": "1994", "authors": "Lehn DA, Brown LJ, Simonson GD, Moran SM, MacDonald MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "7821823", "url": "https://glygen.org/publication/PubMed/7821823" } ] }, { "title": "Enzymatic, metabolic and secretory patterns in human islets of type 2 (non-insulin-dependent) diabetic patients.", "journal": "Diabetologia", "date": "1994", "authors": "Fernandez-Alvarez J, Conget I, Rasschaert J, Sener A, Gomis R, Malaisse WJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "8163052", "url": "https://glygen.org/publication/PubMed/8163052" } ] }, { "title": "Purification of peroxisomal acyl-CoA: dihydroxyacetonephosphate acyltransferase from human placenta.", "journal": "Biochimica et biophysica acta", "date": "1994", "authors": "Ofman R, Wanders RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "8186247", "url": "https://glygen.org/publication/PubMed/8186247" } ] }, { "title": "Cloning and recombinant expression of a novel human low molecular weight Ca(2+)-dependent phospholipase A2.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Chen J, Engle SJ, Seilhamer JJ, Tischfield JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "8300559", "url": "https://glygen.org/publication/PubMed/8300559" } ] }, { "title": "Human ADP-ribosylation factor-activated phosphatidylcholine-specific phospholipase D defines a new and highly conserved gene family.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Hammond SM, Altshuller YM, Sung TC, Rudge SA, Rose K, Engebrecht J, Morris AJ, Frohman MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "8530346", "url": "https://glygen.org/publication/PubMed/8530346" } ] }, { "title": "Molecular cloning of human mitochondrial glycerophosphate dehydrogenase gene: genomic structure, chromosomal localization, and existence of a pseudogene.", "journal": "Biochemical and biophysical research communications", "date": "1996", "authors": "Matsutani A, Takeuchi Y, Ishihara H, Kuwano S, Oka Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "8687421", "url": "https://glygen.org/publication/PubMed/8687421" } ] }, { "title": "Targeting of proteins to granule subsets is determined by timing and not by sorting: The specific granule protein NGAL is localized to azurophil granules when expressed in HL-60 cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Le Cabec V, Cowland JB, Calafat J, Borregaard N", "evidence": [ { "database": "Reactome", "id": "R-HSA-6798695", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695" } ], "reference": [ { "type": "PubMed", "id": "8692836", "url": "https://glygen.org/publication/PubMed/8692836" } ] }, { "title": "Cloning, chromosomal mapping, and expression of a novel human secretory phospholipase A2.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Cupillard L, Koumanov K, Mattei MG, Lazdunski M, Lambeau G", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "9188469", "url": "https://glygen.org/publication/PubMed/9188469" } ] }, { "title": "Cloning and expression of two human lysophosphatidic acid acyltransferase cDNAs that enhance cytokine-induced signaling responses in cells.", "journal": "DNA Cell Biol.", "date": "1997", "authors": "West J, Tompkins CK, Balantac N, Nudelman E, Meengs B, White T, Bursten S, Coleman J, Kumar A, Singer JW, Leung DW", "evidence": [ { "database": "UniProtKB", "id": "O15120", "url": "https://www.uniprot.org/uniprot/O15120" }, { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "9212163", "url": "https://glygen.org/publication/PubMed/9212163" } ] }, { "title": "Human lysophosphatidic acid acyltransferase. cDNA cloning, expression, and localization to chromosome 9q34.3.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Eberhardt C, Gray PW, Tjoelker LW", "evidence": [ { "database": "UniProtKB", "id": "O15120", "url": "https://www.uniprot.org/uniprot/O15120" } ], "reference": [ { "type": "PubMed", "id": "9242711", "url": "https://glygen.org/publication/PubMed/9242711" } ] }, { "title": "A human cDNA sequence with homology to non-mammalian lysophosphatidic acid acyltransferases.", "journal": "Biochem. J.", "date": "1997", "authors": "Stamps A C, Elmore M A, Hill M E, Kelly K, Makda A A, Finnen M J", "evidence": [ { "database": "UniProtKB", "id": "O15120", "url": "https://www.uniprot.org/uniprot/O15120" } ], "reference": [ { "type": "PubMed", "id": "9291118", "url": "https://glygen.org/publication/PubMed/9291118" } ] }, { "title": "Characterization of a human lysophosphatidic acid acyltransferase that is encoded by a gene located in the class III region of the human major histocompatibility complex.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Aguado B, Campbell RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "9461603", "url": "https://glygen.org/publication/PubMed/9461603" } ] }, { "title": "Cloning and initial characterization of a human phospholipase D2 (hPLD2). ADP-ribosylation factor regulates hPLD2.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Lopez I, Arnold RS, Lambeth JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-1483166", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166" } ], "reference": [ { "type": "PubMed", "id": "9582313", "url": "https://glygen.org/publication/PubMed/9582313" } ] } ], "pathway": [ { "id": "hsa:10555", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:10555", "resource": "KEGG Pathway" }, { "id": "R-HSA-1483166", "name": "Synthesis of PA", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166", "resource": "Reactome", "description": "Synthesis of PA" }, { "id": "R-HSA-6798695", "name": "Neutrophil degranulation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6798695", "resource": "Reactome", "description": "Neutrophil degranulation" } ], "orthologs": [ { "uniprot_canonical_ac": "D4AC45-1", "protein_name": "1-acyl-sn-glycerol-3-phosphate acyltransferase", "gene_name": "Agpat2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MGAAGRLNRTARFYVKVGLYCVLCLSFSAAASIVCLLRHGGRTVDNMSIISWFVRSFKYVYGLRFEVSGQKKLEVDGPCVIISNHQSILDMMGLMEILPKRCVQIAKRELMFTGPVGLIMYLGGVYFINRQQAKTAMSLMADLGDLMVKENLKVWIYPEGTRNDNGDLLPFKKGAFYLAIQAQVPIIPVVYSSFSSFYNVKTKLFTSGTIRVQVLDAVPTNGLTDADVTKLVDTCYQSMRATFLQISEIPQENSTIKESGVLPAQ", "length": 265 }, "evidence": [ { "id": "O15120", "url": "https://omabrowser.org/oma/group/O15120/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q8K3K7-1", "protein_name": "1-acyl-sn-glycerol-3-phosphate acyltransferase beta", "gene_name": "Agpat2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MDPWPWLTAALLLLLLLVQLSRTARFYAKVGLYCVLCLSFSAAASIVCLLRHGGRTVDNMSIISWFVRSFKYVYGLRFEVSGQKKLEVDGPCVIISNHQSILDMMGLMEILPKRCVQIAKRELMFTGPVGLIMYLGGVYFINRQQARTAMSVMADLGDLMVKENLKVWIYPEGTRNDNGDLLPFKKGAFYLAIQAQVPIIPVVYSSFSSFYNVKTKLFTSGTIKVQVLDAVPTNGLTDADVTKLVDTCYQSMRATFLQISQIPQENSAIKEPGVLPAQ", "length": 278 }, "evidence": [ { "id": "45932840", "url": "http://www.informatics.jax.org/homology/45932840", "database": "MGI" }, { "id": "O15120", "url": "https://omabrowser.org/oma/group/O15120/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 8, "go_terms": [ { "name": "positive regulation of cytokine-mediated signaling pathway", "id": "GO:0001961", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001961", "evidence": [ { "database": "UniProtKB", "id": "O15120", "url": "https://www.uniprot.org/uniprot/O15120" } ], "pmid": "" }, { "name": "phosphatidic acid biosynthetic process", "id": "GO:0006654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006654", "evidence": [ { "database": "UniProtKB", "id": "O15120", "url": "https://www.uniprot.org/uniprot/O15120" } ], "pmid": "" }, { "name": "epidermis development", "id": "GO:0008544", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008544", "evidence": [ { "database": "UniProtKB", "id": "O15120", "url": "https://www.uniprot.org/uniprot/O15120" } ], "pmid": "" }, { "name": "positive regulation of cytokine production", "id": "GO:0001819", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001819", "evidence": [ { "database": "UniProtKB", "id": "O15120", "url": "https://www.uniprot.org/uniprot/O15120" } ], "pmid": "" }, { "name": "response to xenobiotic stimulus", "id": "GO:0009410", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009410", "evidence": [ { "database": "UniProtKB", "id": "O15120", "url": "https://www.uniprot.org/uniprot/O15120" } ], "pmid": "" }, { "name": "triglyceride biosynthetic process", "id": "GO:0019432", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019432", "evidence": [ { "database": "UniProtKB", "id": "O15120", "url": "https://www.uniprot.org/uniprot/O15120" } ], "pmid": "" }, { "name": "phospholipid metabolic process", "id": "GO:0006644", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006644", "evidence": [ { "database": "UniProtKB", "id": "O15120", "url": "https://www.uniprot.org/uniprot/O15120" } ], "pmid": "" }, { "name": "CDP-diacylglycerol biosynthetic process", "id": "GO:0016024", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016024", "evidence": [ { "database": "UniProtKB", "id": "O15120", "url": "https://www.uniprot.org/uniprot/O15120" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "1-acylglycerol-3-phosphate O-acyltransferase activity", "id": "GO:0003841", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003841", "evidence": [ { "database": "UniProtKB", "id": "O15120", "url": "https://www.uniprot.org/uniprot/O15120" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "endoplasmic reticulum", "id": "GO:0005783", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005783", "evidence": [ { "database": "UniProtKB", "id": "O15120", "url": "https://www.uniprot.org/uniprot/O15120" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "O15120", "url": "https://www.uniprot.org/uniprot/O15120" } ], "pmid": "" }, { "name": "specific granule membrane", "id": "GO:0035579", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035579", "evidence": [ { "database": "UniProtKB", "id": "O15120", "url": "https://www.uniprot.org/uniprot/O15120" } ], "pmid": "" }, { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "O15120", "url": "https://www.uniprot.org/uniprot/O15120" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 59, "end_pos": 61, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [ { "id": "19709", "name": "", "equation": "a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q6QA69-1", "Q924S1-1", "Q4V8J4-1", "P0C1Q3-1", "D4AC45-1", "Q1HAQ0-1", "Q3T1J2-1", "D3ZI76-1", "F7EQT9-1", "Q8WTS1-1", "Q53EU6-1", "Q6UWP7-1", "Q6ZWT7-1", "Q9NRZ5-1", "Q7L5N7-1", "Q99943-1", "Q9NRZ7-1", "Q9NST1-1", "Q9NUQ2-1", "O15120-1", "Q6NUI2-1", "Q8NF37-1", "Q9DBL9-1", "Q8C0N2-1", "Q3UN02-1", "O35083-1", "Q9D517-1", "Q8K3K7-1", "Q8K4X7-1", "Q8BYI6-1", "Q91WW7-1", "Q9D1E8-1", "Q14DK4-1", "Q3TFD2-1", "P33333-1", "Q06508-1", "Q08548-1", "Q12385-1", "Q7KTI0-1", "Q9VYJ4-1" ], "evidence": [ { "id": "19709", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/19709" } ] }, { "id": "33187", "name": "", "equation": "(9Z)-octadecenoyl-CoA + 1-hexadecanoyl-sn-glycero-3-phosphate = 1-hexadecanoyl-2-(9Z-octadecenoyl)-sn-glycero-3-phosphate + CoA", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q6QA69-1", "Q4V8J4-1", "P0C1Q3-1", "Q3T1J2-1", "D4AC45-1", "F7EQT9-1", "Q8WTS1-1", "Q53EU6-1", "Q6UWP7-1", "Q99943-1", "Q9NRZ7-1", "Q9NUQ2-1", "O15120-1", "Q6ZWT7-1", "Q7L5N7-1", "Q9DBL9-1", "Q8C0N2-1", "Q3UN02-1", "O35083-1", "Q9D517-1", "Q8K3K7-1", "Q9D1E8-1", "Q8BYI6-1", "P33333-1", "Q06508-1" ], "evidence": [ { "id": "33187", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/33187" } ] }, { "id": "35899", "name": "", "equation": "1-hexadecanoyl-sn-glycero-3-phosphate + tetradecanoyl-CoA = 1-hexadecanoyl-2-tetradecanoyl-sn-glycero-3-phosphate + CoA", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O15120-1", "Q8K3K7-1" ], "evidence": [ { "id": "35899", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/35899" } ] }, { "id": "35903", "name": "", "equation": "1-hexadecanoyl-sn-glycero-3-phosphate + hexadecanoyl-CoA = 1,2-dihexadecanoyl-sn-glycero-3-phosphate + CoA", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O15120-1", "Q8K3K7-1" ], "evidence": [ { "id": "35903", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/35903" } ] }, { "id": "35907", "name": "", "equation": "1-hexadecanoyl-sn-glycero-3-phosphate + octadecanoyl-CoA = 1-hexadecanoyl-2-octadecanoyl-sn-glycero-3-phosphate + CoA", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O15120-1", "Q8K3K7-1" ], "evidence": [ { "id": "35907", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/35907" } ] }, { "id": "35915", "name": "", "equation": "(5Z,8Z,11Z,14Z)-eicosatetraenoyl-CoA + 1-hexadecanoyl-sn-glycero-3-phosphate = 1-hexadecanoyl-2-(5Z,8Z,11Z,14Z-eicosatetraenoyl)-sn-glycero-3-phosphate + CoA", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q9NRZ7-1", "O15120-1", "Q9D517-1", "Q8K3K7-1" ], "evidence": [ { "id": "35915", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/35915" } ] }, { "id": "37131", "name": "", "equation": "(9Z)-octadecenoyl-CoA + 1-(9Z-octadecenoyl)-sn-glycero-3-phosphate = 1,2-di-(9Z-octadecenoyl)-sn-glycero-3-phosphate + CoA", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q6QA69-1", "Q4V8J4-1", "P0C1Q3-1", "D4AC45-1", "D3ZI76-1", "F7EQT9-1", "Q8WTS1-1", "Q53EU6-1", "Q6UWP7-1", "Q99943-1", "Q9NRZ7-1", "Q9NUQ2-1", "O15120-1", "Q6NUI2-1", "Q7L5N7-1", "Q9NST1-1", "Q9DBL9-1", "Q8C0N2-1", "Q3UN02-1", "O35083-1", "Q9D517-1", "Q8K3K7-1", "Q9D1E8-1", "Q14DK4-1", "Q8BYI6-1", "Q91WW7-1", "Q12043-1", "P36165-1", "Q08548-1" ], "evidence": [ { "id": "37131", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/37131" } ] }, { "id": "37139", "name": "", "equation": "(9Z)-octadecenoyl-CoA + 1-(9Z,12Z,15Z)-octadecatrienoyl-sn-glycero-3-phosphate = 1-(9Z,12Z,15Z)-octadecatrienoyl-2-(9Z)-octadecenoyl-sn-glycero-3-phosphate + CoA", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q4V8J4-1", "D4AC45-1", "F7EQT9-1", "Q53EU6-1", "Q6UWP7-1", "Q99943-1", "O15120-1", "Q8C0N2-1", "Q3UN02-1", "O35083-1", "Q8K3K7-1" ], "evidence": [ { "id": "37139", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/37139" } ] }, { "id": "37143", "name": "", "equation": "1-(9Z-octadecenoyl)-sn-glycero-3-phosphate + hexadecanoyl-CoA = 1-(9Z)-octadecenoyl-2-hexadecanoyl-sn-glycero-3-phosphate + CoA", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q6QA69-1", "Q4V8J4-1", "P0C1Q3-1", "D4AC45-1", "F7EQT9-1", "Q8WTS1-1", "Q53EU6-1", "Q6UWP7-1", "Q99943-1", "O15120-1", "Q7L5N7-1", "Q9NST1-1", "Q9DBL9-1", "Q8C0N2-1", "Q3UN02-1", "O35083-1", "Q8K3K7-1", "Q8BYI6-1", "Q91WW7-1" ], "evidence": [ { "id": "37143", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/37143" } ] }, { "id": "37155", "name": "", "equation": "1-(9Z-octadecenoyl)-sn-glycero-3-phosphate + heptadecanoyl-CoA = 1-(9Z)-octadecenoyl-2-heptadecanoyl-sn-glycero-3-phosphate + CoA", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P0C1Q3-1", "D4AC45-1", "F7EQT9-1", "Q99943-1", "Q9NRZ7-1", "Q9NUQ2-1", "O15120-1", "Q7L5N7-1", "O35083-1", "Q9D517-1", "Q8K3K7-1", "Q9D1E8-1", "Q8BYI6-1" ], "evidence": [ { "id": "37155", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/37155" } ] }, { "id": "37159", "name": "", "equation": "(9Z,12Z)-octadecadienoyl-CoA + 1-(9Z-octadecenoyl)-sn-glycero-3-phosphate = 1-(9Z)-octadecenoyl-2-(9Z,12Z)-octadecadienoyl-sn-glycero-3-phosphate + CoA", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q4V8J4-1", "P0C1Q3-1", "D4AC45-1", "F7EQT9-1", "Q53EU6-1", "Q99943-1", "Q9NRZ7-1", "O15120-1", "Q7L5N7-1", "Q9NST1-1", "Q8C0N2-1", "O35083-1", "Q9D517-1", "Q8K3K7-1", "Q8BYI6-1", "Q91WW7-1" ], "evidence": [ { "id": "37159", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/37159" } ] }, { "id": "37171", "name": "", "equation": "1-(9Z-octadecenoyl)-sn-glycero-3-phosphate + tetradecanoyl-CoA = 1-(9Z)-octadecenoyl-2-tetradecanoyl-sn-glycero-3-phosphate + CoA", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q4V8J4-1", "P0C1Q3-1", "D4AC45-1", "F7EQT9-1", "Q53EU6-1", "Q99943-1", "Q9NUQ2-1", "O15120-1", "Q7L5N7-1", "Q8C0N2-1", "O35083-1", "Q8K3K7-1", "Q9D1E8-1", "Q8BYI6-1" ], "evidence": [ { "id": "37171", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/37171" } ] }, { "id": "37175", "name": "", "equation": "1-(9Z-octadecenoyl)-sn-glycero-3-phosphate + pentadecanoyl-CoA = 1-(9Z)-octadecenoyl-2-pentadecanoyl-sn-glycero-3-phosphate + CoA", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "P0C1Q3-1", "D4AC45-1", "F7EQT9-1", "Q99943-1", "Q9NRZ7-1", "Q9NUQ2-1", "O15120-1", "Q7L5N7-1", "O35083-1", "Q9D517-1", "Q8K3K7-1", "Q9D1E8-1", "Q8BYI6-1" ], "evidence": [ { "id": "37175", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/37175" } ] }, { "id": "37179", "name": "", "equation": "(9Z)-octadecenoyl-CoA + 1-(6Z,9Z,12Z-octadecatrienoyl)-sn-glycero-3-phosphate = (6Z,9Z,12Z)-octadecatrienoyl-2-(9Z)-octadecenoyl-sn-glycero-3-phosphate + CoA", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q4V8J4-1", "D4AC45-1", "F7EQT9-1", "Q53EU6-1", "Q99943-1", "O15120-1", "Q8C0N2-1", "O35083-1", "Q8K3K7-1" ], "evidence": [ { "id": "37179", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/37179" } ] }, { "id": "37183", "name": "", "equation": "(9Z)-octadecenoyl-CoA + 1-eicosanoyl-sn-glycero-3-phosphate = 1-eicosanoyl-2-(9Z)-octadecenoyl-sn-glycero-3-phosphate + CoA", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "D4AC45-1", "F7EQT9-1", "Q99943-1", "O15120-1", "O35083-1", "Q8K3K7-1" ], "evidence": [ { "id": "37183", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/37183" } ] }, { "id": "37187", "name": "", "equation": "(9Z)-octadecenoyl-CoA + 1-tetradecanoyl-sn-glycerol 3-phosphate = 1-tetradecanoyl-2-(9Z)-octadecenoyl-sn-glycero-3-phosphate + CoA", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q4V8J4-1", "D4AC45-1", "F7EQT9-1", "Q53EU6-1", "Q99943-1", "O15120-1", "Q8C0N2-1", "O35083-1", "Q8K3K7-1" ], "evidence": [ { "id": "37187", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/37187" } ] }, { "id": "37603", "name": "", "equation": "(11Z)-octadecenoyl-CoA + 1-(9Z-octadecenoyl)-sn-glycero-3-phosphate = 1-(9Z)-octadecenoyl-2-(11Z)-octadecenoyl-sn-glycero-3-phosphate + CoA", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "D4AC45-1", "F7EQT9-1", "Q99943-1", "O15120-1", "O35083-1", "Q8K3K7-1" ], "evidence": [ { "id": "37603", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/37603" } ] }, { "id": "R-HSA-6799350", "name": "Exocytosis of specific granule membrane proteins", "equation": "", "summary": "Secondary (specific) granules are peroxidase-negative and rich in antimicrobial substances (Joiner et al. 1989, Rorvig et al. 2012). They are more irregular and elongated in form than azurophil granules (Bainton et al. 1971). This may reflect volume adjustment in azurophil granules, which are known to proteolytically process a significant fraction of the proteins that are targeted to them, while little or no processing and therefore no increase in osmotic activity due to proteolysis has been observed in secondary granules (Borregaard & Cowland 1997). Secondary and tertiary granules have overlapping contents but can be discriminated by their intrinsic buoyant densities when centrifuged on gradient media (Kjeldsen et al. 1994).", "cellular_location": "plasma membrane, specific granule membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q13393-1", "P61225-1", "O15120-1", "Q9NPA2-1", "P62834-1", "P00749-1", "O14672-1", "P78325-1", "P43353-1", "Q8TF62-1", "P98196-1", "Q9Y2Q0-1", "Q12913-1", "Q13303-1", "O15121-1", "O75907-1", "O14975-1", "Q5T4S7-1", "Q10588-1", "P04839-1", "Q68CP4-1", "P23467-1", "P30519-1", "O94804-1" ], "evidence": [ { "id": "R-HSA-6799350", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6799350" } ] }, { "id": "R-HSA-75885", "name": "1-acyl LPA is acylated to PA by AGPAT (LPAAT)", "equation": "", "summary": "At the endoplasmic reticulum (ER) membrane, 1-acyl-lysophosphatidic acid (LPA) is acylated to phosphatidic acid (PA) by the enzymes 1-acyl-sn-glycerol-3-phosphate acyltransferases (AGPAT1 through 11), and lysophosphatidylcholine acyltransferase (LPCAT1) (Aguado and Campbell 1998).

See recent review by Agarwal (2012, in press).

AGPAT1, 2, 3 and LPCAT1 have been characterized biochemically (AGPAT1, 2: Yamashita et al. 2007, West et al. 1997, Aguado and Campbell 1998, Gale et al. 2006; AGPAT3: Agarwal et al. 2006; LPCAT1: Nakanishi et al. 2006, Chen et al. 2006). Two additional proteins, AGPAT4 and AGPAT5, are inferred to have such activity based on studies of homologous mouse enzymes (Lu et al. 2005). These enzymes differ in their tissue specific patterns of expression in the body and in their preferences for specific acyl CoA molecules (Shindou and Shimizu 2009; Takeuchi and Reue 2009).
", "cellular_location": "cytosol, endoplasmic reticulum membrane", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O15120-1", "Q9NRZ5-1", "Q86UL3-1", "Q9NRZ7-1", "Q6UWP7-1", "Q9NUQ2-1", "Q643R3-1", "Q8NF37-1", "Q53EU6-1", "Q99943-1" ], "evidence": [ { "id": "R-HSA-75885", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-75885" } ] } ], "reaction_participants": [], "reaction_enzymes": [ { "uniprot_ac": "D3ZI76", "gene_name": "Gpat2", "activity": [ { "ec_number": "2.3.1.51", "activity": "a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA.", "evidence": [ { "id": "D3ZI76", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZI76" } ] }, { "ec_number": "2.3.1.15", "activity": "an acyl-CoA + sn-glycerol 3-phosphate = a 1-acyl-sn-glycero-3-phosphate + CoA.", "evidence": [ { "id": "D3ZI76", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZI76" } ] }, { "ec_number": "2.3.1.15", "activity": "", "evidence": [ { "id": "D3ZI76", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZI76" } ] } ] }, { "uniprot_ac": "D4AC45", "gene_name": "Agpat2", "activity": [ { "ec_number": "2.3.1.51", "activity": "a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA.", "evidence": [ { "id": "D4AC45", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4AC45" } ] }, { "ec_number": "2.3.1.51", "activity": "", "evidence": [ { "id": "D4AC45", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D4AC45" } ] } ] }, { "uniprot_ac": "F7EQT9", "gene_name": "Agpat1", "activity": [ { "ec_number": "2.3.1.51", "activity": "a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA.", "evidence": [ { "id": "F7EQT9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F7EQT9" } ] }, { "ec_number": "2.3.1.51", "activity": "", "evidence": [ { "id": "F7EQT9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F7EQT9" } ] } ] }, { "uniprot_ac": "O14672", "gene_name": "ADAM10", "activity": [ { "ec_number": "3.4.24.81", "activity": "Endopeptidase of broad specificity.", "evidence": [ { "id": "O14672", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14672" } ] }, { "ec_number": "3.4.24.81", "activity": "", "evidence": [ { "id": "O14672", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14672" } ] } ] }, { "uniprot_ac": "O14975", "gene_name": "SLC27A2", "activity": [ { "ec_number": "6.2.1.3", "activity": "a long-chain fatty acid + ATP + CoA = a long-chain fatty acyl-CoA + AMP + diphosphate.", "evidence": [ { "id": "O14975", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14975" } ] }, { "ec_number": "6.2.1.-", "activity": "", "evidence": [ { "id": "O14975", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14975" } ] }, { "ec_number": "6.2.1.7", "activity": "(25R)-3alpha,7alpha,12alpha-trihydroxy-5beta-cholestan-26-oate + ATP + CoA = (25R)-3alpha,7alpha,12alpha-trihydroxy-5beta-cholestan-26-oyl-CoA + AMP + diphosphate.", "evidence": [ { "id": "O14975", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14975" } ] }, { "ec_number": "6.2.1.24", "activity": "3,7,11,15-tetramethylhexadecanoate + ATP + CoA = AMP + diphosphate + phytanoyl-CoA.", "evidence": [ { "id": "O14975", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14975" } ] }, { "ec_number": "6.2.1.15", "activity": "(5Z,8Z,11Z,14Z)-eicosatetraenoate + ATP + CoA = (5Z,8Z,11Z,14Z)-eicosatetraenoyl-CoA + AMP + diphosphate.", "evidence": [ { "id": "O14975", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14975" } ] }, { "ec_number": "6.2.1.3", "activity": "", "evidence": [ { "id": "O14975", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14975" } ] } ] }, { "uniprot_ac": "O15120", "gene_name": "AGPAT2", "activity": [ { "ec_number": "2.3.1.51", "activity": "a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA.", "evidence": [ { "id": "O15120", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15120" } ] }, { "ec_number": "2.3.1.51", "activity": "", "evidence": [ { "id": "O15120", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15120" } ] } ] }, { "uniprot_ac": "O15121", "gene_name": "DEGS1", "activity": [ { "ec_number": "1.14.19.17", "activity": "an N-acylsphinganine + 2 Fe(II)-[cytochrome b5] + 2 H(+) + O2 = an N-acylsphing-4-enine + 2 Fe(III)-[cytochrome b5] + 2 H2O.", "evidence": [ { "id": "O15121", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15121" } ] }, { "ec_number": "5.2.1.-", "activity": "", "evidence": [ { "id": "O15121", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15121" } ] }, { "ec_number": "1.14.19.17", "activity": "", "evidence": [ { "id": "O15121", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O15121" } ] } ] }, { "uniprot_ac": "O35083", "gene_name": "Agpat1", "activity": [ { "ec_number": "2.3.1.51", "activity": "a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA.", "evidence": [ { "id": "O35083", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35083" } ] }, { "ec_number": "2.3.1.51", "activity": "", "evidence": [ { "id": "O35083", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O35083" } ] } ] }, { "uniprot_ac": "O75907", "gene_name": "DGAT1", "activity": [ { "ec_number": "2.3.1.20", "activity": "a 1,2-diacyl-sn-glycerol + an acyl-CoA = a triacyl-sn-glycerol + CoA.", "evidence": [ { "id": "O75907", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75907" } ] }, { "ec_number": "2.3.1.76", "activity": "all-trans-retinol + an acyl-CoA = an all-trans-retinyl ester + CoA.", "evidence": [ { "id": "O75907", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75907" } ] }, { "ec_number": "2.3.1.20", "activity": "", "evidence": [ { "id": "O75907", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O75907" } ] } ] }, { "uniprot_ac": "O94804", "gene_name": "STK10", "activity": [ { "ec_number": "2.7.11.1", "activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].", "evidence": [ { "id": "O94804", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O94804" } ] }, { "ec_number": "2.7.11.1", "activity": "", "evidence": [ { "id": "O94804", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O94804" } ] } ] }, { "uniprot_ac": "P00749", "gene_name": "PLAU", "activity": [ { "ec_number": "3.4.21.73", "activity": "Specific cleavage of Arg-|-Val bond in plasminogen to form plasmin.", "evidence": [ { "id": "P00749", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00749" } ] }, { "ec_number": "3.4.21.73", "activity": "", "evidence": [ { "id": "P00749", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P00749" } ] } ] }, { "uniprot_ac": "P04839", "gene_name": "CYBB", "activity": [ { "ec_number": "1.-.-.-", "activity": "", "evidence": [ { "id": "P04839", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P04839" } ] } ] }, { "uniprot_ac": "P0C1Q3", "gene_name": "Lpcat2", "activity": [ { "ec_number": "2.3.1.51", "activity": "a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA.", "evidence": [ { "id": "P0C1Q3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C1Q3" } ] }, { "ec_number": "2.3.1.23", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphocholine + CoA.", "evidence": [ { "id": "P0C1Q3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C1Q3" } ] }, { "ec_number": "2.3.1.67", "activity": "1-O-alkyl-sn-glycero-3-phosphocholine + acetyl-CoA = a 1-O-alkyl-2-acetyl-sn-glycero-3-phosphocholine + CoA.", "evidence": [ { "id": "P0C1Q3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C1Q3" } ] }, { "ec_number": "2.3.1.25", "activity": "1-O-(1Z-alkenyl)-sn-glycero-3-phosphocholine + an acyl-CoA = 1-O-(1Z-alkenyl)-2-acyl-sn-glycero-3-phosphocholine + CoA.", "evidence": [ { "id": "P0C1Q3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C1Q3" } ] }, { "ec_number": "2.3.1.23", "activity": "", "evidence": [ { "id": "P0C1Q3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P0C1Q3" } ] } ] }, { "uniprot_ac": "P23467", "gene_name": "PTPRB", "activity": [ { "ec_number": "3.1.3.48", "activity": "H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate.", "evidence": [ { "id": "P23467", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23467" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "P23467", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P23467" } ] } ] }, { "uniprot_ac": "P30519", "gene_name": "HMOX2", "activity": [ { "ec_number": "1.14.14.18", "activity": "heme b + 3 O2 + 3 reduced [NADPH--hemoprotein reductase] = biliverdin IXalpha + CO + Fe(2+) + H(+) + 3 H2O + 3 oxidized [NADPH--hemoprotein reductase].", "evidence": [ { "id": "P30519", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30519" } ] }, { "ec_number": "1.14.14.18", "activity": "", "evidence": [ { "id": "P30519", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P30519" } ] } ] }, { "uniprot_ac": "P33333", "gene_name": "SLC1", "activity": [ { "ec_number": "2.3.1.51", "activity": "a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA.", "evidence": [ { "id": "P33333", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P33333" } ] }, { "ec_number": "2.3.1.23", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphocholine + CoA.", "evidence": [ { "id": "P33333", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P33333" } ] }, { "ec_number": "2.3.1.n7", "activity": "a 1-acyl-sn-glycero-3-phosphoethanolamine + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphoethanolamine + CoA.", "evidence": [ { "id": "P33333", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P33333" } ] }, { "ec_number": "2.3.1.23", "activity": "", "evidence": [ { "id": "P33333", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P33333" } ] }, { "ec_number": "2.3.1.n7", "activity": "", "evidence": [ { "id": "P33333", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P33333" } ] }, { "ec_number": "2.3.1.51", "activity": "", "evidence": [ { "id": "P33333", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P33333" } ] } ] }, { "uniprot_ac": "P36165", "gene_name": "TGL4", "activity": [ { "ec_number": "3.1.1.3", "activity": "a triacylglycerol + H2O = a diacylglycerol + a fatty acid + H(+).", "evidence": [ { "id": "P36165", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36165" } ] }, { "ec_number": "3.1.1.3", "activity": "", "evidence": [ { "id": "P36165", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P36165" } ] } ] }, { "uniprot_ac": "P43353", "gene_name": "ALDH3B1", "activity": [ { "ec_number": "1.2.1.5", "activity": "an aldehyde + H2O + NAD(+) = a carboxylate + 2 H(+) + NADH.", "evidence": [ { "id": "P43353", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P43353" } ] }, { "ec_number": "1.2.1.28", "activity": "benzaldehyde + H2O + NAD(+) = benzoate + 2 H(+) + NADH.", "evidence": [ { "id": "P43353", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P43353" } ] }, { "ec_number": "1.2.1.7", "activity": "benzaldehyde + H2O + NADP(+) = benzoate + 2 H(+) + NADPH.", "evidence": [ { "id": "P43353", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P43353" } ] }, { "ec_number": "1.2.1.7", "activity": "", "evidence": [ { "id": "P43353", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P43353" } ] }, { "ec_number": "1.2.1.5", "activity": "", "evidence": [ { "id": "P43353", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P43353" } ] }, { "ec_number": "1.2.1.28", "activity": "", "evidence": [ { "id": "P43353", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P43353" } ] } ] }, { "uniprot_ac": "P61225", "gene_name": "RAP2B", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P61225", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61225" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P61225", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P61225" } ] } ] }, { "uniprot_ac": "P62834", "gene_name": "RAP1A", "activity": [ { "ec_number": "3.6.5.2", "activity": "GTP + H2O = GDP + H(+) + phosphate.", "evidence": [ { "id": "P62834", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62834" } ] }, { "ec_number": "3.6.5.2", "activity": "", "evidence": [ { "id": "P62834", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P62834" } ] } ] }, { "uniprot_ac": "P78325", "gene_name": "ADAM8", "activity": [ { "ec_number": "3.4.24.-", "activity": "", "evidence": [ { "id": "P78325", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P78325" } ] } ] }, { "uniprot_ac": "P98196", "gene_name": "ATP11A", "activity": [ { "ec_number": "7.6.2.1", "activity": "ATP + H2O + phospholipidSide 1 = ADP + phosphate + phospholipidSide 2.", "evidence": [ { "id": "P98196", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P98196" } ] }, { "ec_number": "7.6.2.1", "activity": "", "evidence": [ { "id": "P98196", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P98196" } ] } ] }, { "uniprot_ac": "Q06508", "gene_name": "LOA1", "activity": [ { "ec_number": "2.3.1.51", "activity": "a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA.", "evidence": [ { "id": "Q06508", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q06508" } ] }, { "ec_number": "2.3.1.51", "activity": "", "evidence": [ { "id": "Q06508", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q06508" } ] } ] }, { "uniprot_ac": "Q08548", "gene_name": "ALE1", "activity": [ { "ec_number": "2.3.1.51", "activity": "a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA.", "evidence": [ { "id": "Q08548", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q08548" } ] }, { "ec_number": "2.3.1.23", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphocholine + CoA.", "evidence": [ { "id": "Q08548", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q08548" } ] }, { "ec_number": "2.3.1.n6", "activity": "a 1-acyl-sn-glycero-3-phospho-L-serine + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phospho-L-serine + CoA.", "evidence": [ { "id": "Q08548", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q08548" } ] }, { "ec_number": "2.3.1.n7", "activity": "a 1-acyl-sn-glycero-3-phosphoethanolamine + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphoethanolamine + CoA.", "evidence": [ { "id": "Q08548", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q08548" } ] }, { "ec_number": "2.3.1.23", "activity": "", "evidence": [ { "id": "Q08548", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q08548" } ] }, { "ec_number": "2.3.1.n7", "activity": "", "evidence": [ { "id": "Q08548", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q08548" } ] }, { "ec_number": "2.3.1.n6", "activity": "", "evidence": [ { "id": "Q08548", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q08548" } ] }, { "ec_number": "2.3.1.51", "activity": "", "evidence": [ { "id": "Q08548", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q08548" } ] } ] }, { "uniprot_ac": "Q10588", "gene_name": "BST1", "activity": [ { "ec_number": "3.2.2.6", "activity": "H2O + NAD(+) = ADP-D-ribose + H(+) + nicotinamide.", "evidence": [ { "id": "Q10588", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q10588" } ] }, { "ec_number": "3.2.2.6", "activity": "", "evidence": [ { "id": "Q10588", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q10588" } ] } ] }, { "uniprot_ac": "Q12043", "gene_name": "TGL5", "activity": [ { "ec_number": "3.1.1.3", "activity": "a triacylglycerol + H2O = a diacylglycerol + a fatty acid + H(+).", "evidence": [ { "id": "Q12043", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12043" } ] }, { "ec_number": "3.1.1.3", "activity": "", "evidence": [ { "id": "Q12043", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12043" } ] } ] }, { "uniprot_ac": "Q12385", "gene_name": "ICT1", "activity": [ { "ec_number": "2.3.1.51", "activity": "a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA.", "evidence": [ { "id": "Q12385", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12385" } ] }, { "ec_number": "2.3.1.51", "activity": "", "evidence": [ { "id": "Q12385", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12385" } ] } ] }, { "uniprot_ac": "Q12913", "gene_name": "PTPRJ", "activity": [ { "ec_number": "3.1.3.48", "activity": "H2O + O-phospho-L-tyrosyl-[protein] = L-tyrosyl-[protein] + phosphate.", "evidence": [ { "id": "Q12913", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12913" } ] }, { "ec_number": "3.1.3.48", "activity": "", "evidence": [ { "id": "Q12913", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q12913" } ] } ] }, { "uniprot_ac": "Q13303", "gene_name": "KCNAB2", "activity": [ { "ec_number": "1.1.1.-", "activity": "", "evidence": [ { "id": "Q13303", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13303" } ] } ] }, { "uniprot_ac": "Q13393", "gene_name": "PLD1", "activity": [ { "ec_number": "3.1.4.4", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a 1-acyl-sn-glycero-3-phosphate + choline + H(+).", "evidence": [ { "id": "Q13393", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13393" } ] }, { "ec_number": "3.1.4.4", "activity": "", "evidence": [ { "id": "Q13393", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q13393" } ] } ] }, { "uniprot_ac": "Q14DK4", "gene_name": "Gpat2", "activity": [ { "ec_number": "2.3.1.51", "activity": "a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA.", "evidence": [ { "id": "Q14DK4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q14DK4" } ] }, { "ec_number": "2.3.1.15", "activity": "an acyl-CoA + sn-glycerol 3-phosphate = a 1-acyl-sn-glycero-3-phosphate + CoA.", "evidence": [ { "id": "Q14DK4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q14DK4" } ] }, { "ec_number": "2.3.1.15", "activity": "", "evidence": [ { "id": "Q14DK4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q14DK4" } ] } ] }, { "uniprot_ac": "Q1HAQ0", "gene_name": "Lpcat1", "activity": [ { "ec_number": "2.3.1.51", "activity": "a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA.", "evidence": [ { "id": "Q1HAQ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q1HAQ0" } ] }, { "ec_number": "2.3.1.23", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphocholine + CoA.", "evidence": [ { "id": "Q1HAQ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q1HAQ0" } ] }, { "ec_number": "2.3.1.67", "activity": "1-O-alkyl-sn-glycero-3-phosphocholine + acetyl-CoA = a 1-O-alkyl-2-acetyl-sn-glycero-3-phosphocholine + CoA.", "evidence": [ { "id": "Q1HAQ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q1HAQ0" } ] }, { "ec_number": "2.3.1.25", "activity": "1-O-(1Z-alkenyl)-sn-glycero-3-phosphocholine + an acyl-CoA = 1-O-(1Z-alkenyl)-2-acyl-sn-glycero-3-phosphocholine + CoA.", "evidence": [ { "id": "Q1HAQ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q1HAQ0" } ] }, { "ec_number": "2.3.1.23", "activity": "", "evidence": [ { "id": "Q1HAQ0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q1HAQ0" } ] } ] }, { "uniprot_ac": "Q3T1J2", "gene_name": "Mboat2", "activity": [ { "ec_number": "2.3.1.51", "activity": "a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA.", "evidence": [ { "id": "Q3T1J2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3T1J2" } ] }, { "ec_number": "2.3.1.23", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphocholine + CoA.", "evidence": [ { "id": "Q3T1J2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3T1J2" } ] }, { "ec_number": "2.3.1.n7", "activity": "a 1-acyl-sn-glycero-3-phosphoethanolamine + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphoethanolamine + CoA.", "evidence": [ { "id": "Q3T1J2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3T1J2" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q3T1J2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3T1J2" } ] } ] }, { "uniprot_ac": "Q3TFD2", "gene_name": "Lpcat1", "activity": [ { "ec_number": "2.3.1.51", "activity": "a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA.", "evidence": [ { "id": "Q3TFD2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3TFD2" } ] }, { "ec_number": "2.3.1.23", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphocholine + CoA.", "evidence": [ { "id": "Q3TFD2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3TFD2" } ] }, { "ec_number": "2.3.1.67", "activity": "1-O-alkyl-sn-glycero-3-phosphocholine + acetyl-CoA = a 1-O-alkyl-2-acetyl-sn-glycero-3-phosphocholine + CoA.", "evidence": [ { "id": "Q3TFD2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3TFD2" } ] }, { "ec_number": "2.3.1.25", "activity": "1-O-(1Z-alkenyl)-sn-glycero-3-phosphocholine + an acyl-CoA = 1-O-(1Z-alkenyl)-2-acyl-sn-glycero-3-phosphocholine + CoA.", "evidence": [ { "id": "Q3TFD2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3TFD2" } ] }, { "ec_number": "2.3.1.23", "activity": "", "evidence": [ { "id": "Q3TFD2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3TFD2" } ] } ] }, { "uniprot_ac": "Q3UN02", "gene_name": "Lclat1", "activity": [ { "ec_number": "2.3.1.51", "activity": "a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA.", "evidence": [ { "id": "Q3UN02", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UN02" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q3UN02", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UN02" } ] } ] }, { "uniprot_ac": "Q4V8J4", "gene_name": "Gpat3", "activity": [ { "ec_number": "2.3.1.51", "activity": "a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA.", "evidence": [ { "id": "Q4V8J4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4V8J4" } ] }, { "ec_number": "2.3.1.15", "activity": "an acyl-CoA + sn-glycerol 3-phosphate = a 1-acyl-sn-glycero-3-phosphate + CoA.", "evidence": [ { "id": "Q4V8J4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4V8J4" } ] }, { "ec_number": "2.3.1.15", "activity": "", "evidence": [ { "id": "Q4V8J4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q4V8J4" } ] } ] }, { "uniprot_ac": "Q53EU6", "gene_name": "GPAT3", "activity": [ { "ec_number": "2.3.1.51", "activity": "a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA.", "evidence": [ { "id": "Q53EU6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q53EU6" } ] }, { "ec_number": "2.3.1.15", "activity": "an acyl-CoA + sn-glycerol 3-phosphate = a 1-acyl-sn-glycero-3-phosphate + CoA.", "evidence": [ { "id": "Q53EU6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q53EU6" } ] }, { "ec_number": "2.3.1.15", "activity": "", "evidence": [ { "id": "Q53EU6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q53EU6" } ] } ] }, { "uniprot_ac": "Q5T4S7", "gene_name": "UBR4", "activity": [ { "ec_number": "2.3.2.27", "activity": "S-ubiquitinyl-[E2 ubiquitin-conjugating enzyme]-L-cysteine + [acceptor protein]-L-lysine = [E2 ubiquitin-conjugating enzyme]-L-cysteine + N(6)-ubiquitinyl-[acceptor protein]-L-lysine.", "evidence": [ { "id": "Q5T4S7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5T4S7" } ] }, { "ec_number": "2.3.2.27", "activity": "", "evidence": [ { "id": "Q5T4S7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5T4S7" } ] } ] }, { "uniprot_ac": "Q643R3", "gene_name": "LPCAT4", "activity": [ { "ec_number": "2.3.1.121", "activity": "1-O-(1Z-alkenyl)-sn-glycero-3-phosphoethanolamine + an acyl-CoA = 1-O-(1Z-alkenyl)-2-acyl-sn-glycero-3-phosphoethanolamine + CoA.", "evidence": [ { "id": "Q643R3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q643R3" } ] }, { "ec_number": "2.3.1.23", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphocholine + CoA.", "evidence": [ { "id": "Q643R3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q643R3" } ] }, { "ec_number": "2.3.1.67", "activity": "1-O-alkyl-sn-glycero-3-phosphocholine + acetyl-CoA = a 1-O-alkyl-2-acetyl-sn-glycero-3-phosphocholine + CoA.", "evidence": [ { "id": "Q643R3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q643R3" } ] }, { "ec_number": "2.3.1.n6", "activity": "a 1-acyl-sn-glycero-3-phospho-L-serine + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phospho-L-serine + CoA.", "evidence": [ { "id": "Q643R3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q643R3" } ] }, { "ec_number": "2.3.1.n7", "activity": "a 1-acyl-sn-glycero-3-phosphoethanolamine + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphoethanolamine + CoA.", "evidence": [ { "id": "Q643R3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q643R3" } ] } ] }, { "uniprot_ac": "Q68CP4", "gene_name": "HGSNAT", "activity": [ { "ec_number": "2.3.1.78", "activity": "acetyl-CoA + alpha-D-glucosaminyl-[heparan sulfate](n) = CoA + H(+) + N-acetyl-alpha-D-glucosaminyl-[heparan sulfate](n).", "evidence": [ { "id": "Q68CP4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q68CP4" } ] }, { "ec_number": "2.3.1.78", "activity": "", "evidence": [ { "id": "Q68CP4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q68CP4" } ] } ] }, { "uniprot_ac": "Q6NUI2", "gene_name": "GPAT2", "activity": [ { "ec_number": "2.3.1.51", "activity": "a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA.", "evidence": [ { "id": "Q6NUI2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6NUI2" } ] }, { "ec_number": "2.3.1.15", "activity": "an acyl-CoA + sn-glycerol 3-phosphate = a 1-acyl-sn-glycero-3-phosphate + CoA.", "evidence": [ { "id": "Q6NUI2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6NUI2" } ] }, { "ec_number": "2.3.1.15", "activity": "", "evidence": [ { "id": "Q6NUI2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6NUI2" } ] } ] }, { "uniprot_ac": "Q6QA69", "gene_name": "Abhd5", "activity": [ { "ec_number": "2.3.1.51", "activity": "a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA.", "evidence": [ { "id": "Q6QA69", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6QA69" } ] }, { "ec_number": "2.3.1.51", "activity": "", "evidence": [ { "id": "Q6QA69", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6QA69" } ] } ] }, { "uniprot_ac": "Q6UWP7", "gene_name": "LCLAT1", "activity": [ { "ec_number": "2.3.1.51", "activity": "a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA.", "evidence": [ { "id": "Q6UWP7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6UWP7" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q6UWP7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6UWP7" } ] } ] }, { "uniprot_ac": "Q6ZWT7", "gene_name": "MBOAT2", "activity": [ { "ec_number": "2.3.1.51", "activity": "a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA.", "evidence": [ { "id": "Q6ZWT7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6ZWT7" } ] }, { "ec_number": "2.3.1.23", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphocholine + CoA.", "evidence": [ { "id": "Q6ZWT7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6ZWT7" } ] }, { "ec_number": "2.3.1.n7", "activity": "a 1-acyl-sn-glycero-3-phosphoethanolamine + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphoethanolamine + CoA.", "evidence": [ { "id": "Q6ZWT7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6ZWT7" } ] }, { "ec_number": "2.3.1.-", "activity": "", "evidence": [ { "id": "Q6ZWT7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q6ZWT7" } ] } ] }, { "uniprot_ac": "Q7KTI0", "gene_name": "Agpat2", "activity": [ { "ec_number": "2.3.1.51", "activity": "a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA.", "evidence": [ { "id": "Q7KTI0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7KTI0" } ] }, { "ec_number": "2.3.1.51", "activity": "", "evidence": [ { "id": "Q7KTI0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7KTI0" } ] } ] }, { "uniprot_ac": "Q7L5N7", "gene_name": "LPCAT2", "activity": [ { "ec_number": "2.3.1.51", "activity": "a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA.", "evidence": [ { "id": "Q7L5N7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7L5N7" } ] }, { "ec_number": "2.3.1.23", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphocholine + CoA.", "evidence": [ { "id": "Q7L5N7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7L5N7" } ] }, { "ec_number": "2.3.1.67", "activity": "1-O-alkyl-sn-glycero-3-phosphocholine + acetyl-CoA = a 1-O-alkyl-2-acetyl-sn-glycero-3-phosphocholine + CoA.", "evidence": [ { "id": "Q7L5N7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7L5N7" } ] }, { "ec_number": "2.3.1.25", "activity": "1-O-(1Z-alkenyl)-sn-glycero-3-phosphocholine + an acyl-CoA = 1-O-(1Z-alkenyl)-2-acyl-sn-glycero-3-phosphocholine + CoA.", "evidence": [ { "id": "Q7L5N7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7L5N7" } ] }, { "ec_number": "2.3.1.23", "activity": "", "evidence": [ { "id": "Q7L5N7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q7L5N7" } ] } ] }, { "uniprot_ac": "Q86UL3", "gene_name": "GPAT4", "activity": [ { "ec_number": "2.3.1.15", "activity": "an acyl-CoA + sn-glycerol 3-phosphate = a 1-acyl-sn-glycero-3-phosphate + CoA.", "evidence": [ { "id": "Q86UL3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86UL3" } ] }, { "ec_number": "2.3.1.15", "activity": "", "evidence": [ { "id": "Q86UL3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q86UL3" } ] } ] }, { "uniprot_ac": "Q8BYI6", "gene_name": "Lpcat2", "activity": [ { "ec_number": "2.3.1.51", "activity": "a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA.", "evidence": [ { "id": "Q8BYI6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BYI6" } ] }, { "ec_number": "2.3.1.23", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphocholine + CoA.", "evidence": [ { "id": "Q8BYI6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BYI6" } ] }, { "ec_number": "2.3.1.67", "activity": "1-O-alkyl-sn-glycero-3-phosphocholine + acetyl-CoA = a 1-O-alkyl-2-acetyl-sn-glycero-3-phosphocholine + CoA.", "evidence": [ { "id": "Q8BYI6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BYI6" } ] }, { "ec_number": "2.3.1.25", "activity": "1-O-(1Z-alkenyl)-sn-glycero-3-phosphocholine + an acyl-CoA = 1-O-(1Z-alkenyl)-2-acyl-sn-glycero-3-phosphocholine + CoA.", "evidence": [ { "id": "Q8BYI6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BYI6" } ] }, { "ec_number": "2.3.1.23", "activity": "", "evidence": [ { "id": "Q8BYI6", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8BYI6" } ] } ] }, { "uniprot_ac": "Q8C0N2", "gene_name": "Gpat3", "activity": [ { "ec_number": "2.3.1.51", "activity": "a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA.", "evidence": [ { "id": "Q8C0N2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C0N2" } ] }, { "ec_number": "2.3.1.15", "activity": "an acyl-CoA + sn-glycerol 3-phosphate = a 1-acyl-sn-glycero-3-phosphate + CoA.", "evidence": [ { "id": "Q8C0N2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C0N2" } ] }, { "ec_number": "2.3.1.15", "activity": "", "evidence": [ { "id": "Q8C0N2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8C0N2" } ] } ] }, { "uniprot_ac": "Q8K3K7", "gene_name": "Agpat2", "activity": [ { "ec_number": "2.3.1.51", "activity": "a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA.", "evidence": [ { "id": "Q8K3K7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K3K7" } ] }, { "ec_number": "2.3.1.51", "activity": "", "evidence": [ { "id": "Q8K3K7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K3K7" } ] } ] }, { "uniprot_ac": "Q8K4X7", "gene_name": "Agpat4", "activity": [ { "ec_number": "2.3.1.51", "activity": "a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA.", "evidence": [ { "id": "Q8K4X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K4X7" } ] }, { "ec_number": "2.3.1.51", "activity": "", "evidence": [ { "id": "Q8K4X7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K4X7" } ] } ] }, { "uniprot_ac": "Q8NF37", "gene_name": "LPCAT1", "activity": [ { "ec_number": "2.3.1.51", "activity": "a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA.", "evidence": [ { "id": "Q8NF37", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NF37" } ] }, { "ec_number": "2.3.1.23", "activity": "a 1-acyl-sn-glycero-3-phosphocholine + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphocholine + CoA.", "evidence": [ { "id": "Q8NF37", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NF37" } ] }, { "ec_number": "2.3.1.67", "activity": "1-O-alkyl-sn-glycero-3-phosphocholine + acetyl-CoA = a 1-O-alkyl-2-acetyl-sn-glycero-3-phosphocholine + CoA.", "evidence": [ { "id": "Q8NF37", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NF37" } ] }, { "ec_number": "2.3.1.25", "activity": "1-O-(1Z-alkenyl)-sn-glycero-3-phosphocholine + an acyl-CoA = 1-O-(1Z-alkenyl)-2-acyl-sn-glycero-3-phosphocholine + CoA.", "evidence": [ { "id": "Q8NF37", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NF37" } ] }, { "ec_number": "2.3.1.23", "activity": "", "evidence": [ { "id": "Q8NF37", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NF37" } ] } ] }, { "uniprot_ac": "Q8TF62", "gene_name": "ATP8B4", "activity": [ { "ec_number": "7.6.2.1", "activity": "ATP + H2O + phospholipidSide 1 = ADP + phosphate + phospholipidSide 2.", "evidence": [ { "id": "Q8TF62", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8TF62" } ] }, { "ec_number": "7.6.2.1", "activity": "", "evidence": [ { "id": "Q8TF62", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8TF62" } ] } ] }, { "uniprot_ac": "Q8WTS1", "gene_name": "ABHD5", "activity": [ { "ec_number": "2.3.1.51", "activity": "a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA.", "evidence": [ { "id": "Q8WTS1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WTS1" } ] }, { "ec_number": "2.3.1.51", "activity": "", "evidence": [ { "id": "Q8WTS1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8WTS1" } ] } ] }, { "uniprot_ac": "Q91WW7", "gene_name": "Pnpla3", "activity": [ { "ec_number": "2.3.1.51", "activity": "a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA.", "evidence": [ { "id": "Q91WW7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91WW7" } ] }, { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q91WW7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91WW7" } ] }, { "ec_number": "3.1.1.3", "activity": "a triacylglycerol + H2O = a diacylglycerol + a fatty acid + H(+).", "evidence": [ { "id": "Q91WW7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91WW7" } ] }, { "ec_number": "2.3.1.51", "activity": "", "evidence": [ { "id": "Q91WW7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91WW7" } ] } ] }, { "uniprot_ac": "Q924S1", "gene_name": "Agpat4", "activity": [ { "ec_number": "2.3.1.51", "activity": "a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA.", "evidence": [ { "id": "Q924S1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q924S1" } ] }, { "ec_number": "2.3.1.51", "activity": "", "evidence": [ { "id": "Q924S1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q924S1" } ] } ] }, { "uniprot_ac": "Q99943", "gene_name": "AGPAT1", "activity": [ { "ec_number": "2.3.1.51", "activity": "a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA.", "evidence": [ { "id": "Q99943", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99943" } ] }, { "ec_number": "2.3.1.51", "activity": "", "evidence": [ { "id": "Q99943", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99943" } ] } ] }, { "uniprot_ac": "Q9D1E8", "gene_name": "Agpat5", "activity": [ { "ec_number": "2.3.1.51", "activity": "a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA.", "evidence": [ { "id": "Q9D1E8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D1E8" } ] }, { "ec_number": "2.3.1.51", "activity": "", "evidence": [ { "id": "Q9D1E8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D1E8" } ] } ] }, { "uniprot_ac": "Q9D517", "gene_name": "Agpat3", "activity": [ { "ec_number": "2.3.1.51", "activity": "a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA.", "evidence": [ { "id": "Q9D517", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D517" } ] }, { "ec_number": "2.3.1.51", "activity": "", "evidence": [ { "id": "Q9D517", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D517" } ] } ] }, { "uniprot_ac": "Q9DBL9", "gene_name": "Abhd5", "activity": [ { "ec_number": "2.3.1.51", "activity": "a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA.", "evidence": [ { "id": "Q9DBL9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DBL9" } ] }, { "ec_number": "2.3.1.51", "activity": "", "evidence": [ { "id": "Q9DBL9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DBL9" } ] } ] }, { "uniprot_ac": "Q9NPA2", "gene_name": "MMP25", "activity": [ { "ec_number": "3.4.24.-", "activity": "", "evidence": [ { "id": "Q9NPA2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NPA2" } ] } ] }, { "uniprot_ac": "Q9NRZ5", "gene_name": "AGPAT4", "activity": [ { "ec_number": "2.3.1.51", "activity": "a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA.", "evidence": [ { "id": "Q9NRZ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NRZ5" } ] }, { "ec_number": "2.3.1.51", "activity": "", "evidence": [ { "id": "Q9NRZ5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NRZ5" } ] } ] }, { "uniprot_ac": "Q9NRZ7", "gene_name": "AGPAT3", "activity": [ { "ec_number": "2.3.1.51", "activity": "a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA.", "evidence": [ { "id": "Q9NRZ7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NRZ7" } ] }, { "ec_number": "2.3.1.51", "activity": "", "evidence": [ { "id": "Q9NRZ7", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NRZ7" } ] } ] }, { "uniprot_ac": "Q9NST1", "gene_name": "PNPLA3", "activity": [ { "ec_number": "2.3.1.51", "activity": "a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA.", "evidence": [ { "id": "Q9NST1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NST1" } ] }, { "ec_number": "3.1.1.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphocholine + H2O = 1-O-alkyl-sn-glycero-3-phosphocholine + a fatty acid + H(+).", "evidence": [ { "id": "Q9NST1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NST1" } ] }, { "ec_number": "3.1.1.3", "activity": "a triacylglycerol + H2O = a diacylglycerol + a fatty acid + H(+).", "evidence": [ { "id": "Q9NST1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NST1" } ] }, { "ec_number": "2.3.1.51", "activity": "", "evidence": [ { "id": "Q9NST1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NST1" } ] } ] }, { "uniprot_ac": "Q9NUQ2", "gene_name": "AGPAT5", "activity": [ { "ec_number": "2.3.1.51", "activity": "a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA.", "evidence": [ { "id": "Q9NUQ2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NUQ2" } ] }, { "ec_number": "2.3.1.51", "activity": "", "evidence": [ { "id": "Q9NUQ2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9NUQ2" } ] } ] }, { "uniprot_ac": "Q9VYJ4", "gene_name": "Agpat1", "activity": [ { "ec_number": "2.3.1.51", "activity": "a 1-acyl-sn-glycero-3-phosphate + an acyl-CoA = a 1,2-diacyl-sn-glycero-3-phosphate + CoA.", "evidence": [ { "id": "Q9VYJ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VYJ4" } ] }, { "ec_number": "2.3.1.51", "activity": "", "evidence": [ { "id": "Q9VYJ4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9VYJ4" } ] } ] }, { "uniprot_ac": "Q9Y2Q0", "gene_name": "ATP8A1", "activity": [ { "ec_number": "7.6.2.1", "activity": "ATP + H2O + phospholipidSide 1 = ADP + phosphate + phospholipidSide 2.", "evidence": [ { "id": "Q9Y2Q0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y2Q0" } ] }, { "ec_number": "7.6.2.1", "activity": "", "evidence": [ { "id": "Q9Y2Q0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9Y2Q0" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 59, "end_pos": 61 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 63 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }