{ "uniprot_canonical_ac": "O14980-1", "uniprot_ac": "O14980", "uniprot_id": "XPO1_HUMAN", "mass": { "chemical_mass": 123386.0, "monoisotopic_mass": 123386.0 }, "refseq": { "ac": "NP_003391", "name": "exportin-1 isoform 1", "summary": "This cell-cycle-regulated gene encodes a protein that mediates leucine-rich nuclear export signal (NES)-dependent protein transport. The protein specifically inhibits the nuclear export of Rev and U snRNAs. It is involved in the control of several cellular processes by controlling the localization of cyclin B, MPAK, and MAPKAP kinase 2. This protein also regulates NFAT and AP-1. [provided by RefSeq, Jan 2015].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003391" }, "gene_names": [ { "name": "XPO1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O14980", "id": "O14980" }, { "name": "CRM-1; CRM1; emb; exp1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003391", "id": "NP_003391" }, { "name": "CRM1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O14980", "id": "O14980" }, { "name": "XPO1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003391", "id": "NP_003391" } ], "protein_names": [ { "name": "Exportin-1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O14980" }, { "name": "Chromosome region maintenance 1 protein homolog", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O14980" }, { "name": "Exp1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O14980" }, { "name": "chromosome region maintenance 1 protein homolog; exportin-1 (required for chromosome region maintenance); exportin 1 (CRM1 homolog, yeast); chromosome region maintenance 1 homolog", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003391", "id": "NP_003391" }, { "name": "exportin-1 isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003391", "id": "NP_003391" } ], "function": [ { "annotation": "(Microbial infection) Mediates the export of unspliced or incompletely spliced RNAs out of the nucleus from different viruses including HIV-1, HTLV-1 and influenza A. Interacts with, and mediates the nuclear export of HIV-1 Rev and HTLV-1 Rex proteins. Involved in HTLV-1 Rex multimerization.", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980#function" }, { "database": "PubMed", "id": "9837918", "url": "https://glygen.org/publication/PubMed/9837918" }, { "database": "PubMed", "id": "14612415", "url": "https://glygen.org/publication/PubMed/14612415" } ] }, { "annotation": "CRM1 expression: association with high prognostic value in laryngeal cancer.", "evidence": [ { "database": "RefSeq", "id": "NP_003391", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003391" }, { "database": "PubMed", "id": "38031942", "url": "https://glygen.org/publication/PubMed/38031942" } ] }, { "annotation": "Differential impact of exportin-1-mediated nuclear export of RNAs on the RNA content of extracellular vesicle subpopulations.", "evidence": [ { "database": "RefSeq", "id": "NP_003391", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003391" }, { "database": "PubMed", "id": "37097386", "url": "https://glygen.org/publication/PubMed/37097386" } ] }, { "annotation": "Exportin 1 inhibition prevents neuroendocrine transformation through SOX2 down-regulation in lung and prostate cancers.", "evidence": [ { "database": "RefSeq", "id": "NP_003391", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003391" }, { "database": "PubMed", "id": "37531417", "url": "https://glygen.org/publication/PubMed/37531417" } ] }, { "annotation": "Mediates the nuclear export of cellular proteins (cargos) bearing a leucine-rich nuclear export signal (NES) and of RNAs. In the nucleus, in association with RANBP3, binds cooperatively to the NES on its target protein and to the GTPase RAN in its active GTP-bound form (Ran-GTP). Docking of this complex to the nuclear pore complex (NPC) is mediated through binding to nucleoporins. Upon transit of a nuclear export complex into the cytoplasm, disassembling of the complex and hydrolysis of Ran-GTP to Ran-GDP (induced by RANBP1 and RANGAP1, respectively) cause release of the cargo from the export receptor. The directionality of nuclear export is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. Involved in U3 snoRNA transport from Cajal bodies to nucleoli. Binds to late precursor U3 snoRNA bearing a TMG cap.", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980#function" }, { "database": "PubMed", "id": "9311922", "url": "https://glygen.org/publication/PubMed/9311922" }, { "database": "PubMed", "id": "15574332", "url": "https://glygen.org/publication/PubMed/15574332" }, { "database": "PubMed", "id": "9323133", "url": "https://glygen.org/publication/PubMed/9323133" }, { "database": "PubMed", "id": "20921223", "url": "https://glygen.org/publication/PubMed/20921223" } ] }, { "annotation": "Nuclear export of BATF2 enhances colorectal cancer proliferation through binding to CRM1.", "evidence": [ { "database": "RefSeq", "id": "NP_003391", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003391" }, { "database": "PubMed", "id": "37151195", "url": "https://glygen.org/publication/PubMed/37151195" } ] }, { "annotation": "This cell-cycle-regulated gene encodes a protein that mediates leucine-rich nuclear export signal (NES)-dependent protein transport. The protein specifically inhibits the nuclear export of Rev and U snRNAs. It is involved in the control of several cellular processes by controlling the localization of cyclin B, MPAK, and MAPKAP kinase 2. This protein also regulates NFAT and AP-1. [provided by RefSeq, Jan 2015].", "evidence": [ { "database": "RefSeq", "id": "NP_003391", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003391" } ] }, { "annotation": "XPO1-Mediated mRNA Export of Genome Maintenance Regulators Drives Chemotherapy Resistance in Aggressive Lymphoma.", "evidence": [ { "database": "RefSeq", "id": "NP_003391", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003391" }, { "database": "PubMed", "id": "37902414", "url": "https://glygen.org/publication/PubMed/37902414" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs907656491", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs907656491" }, { "id": "rs907656491", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs907656491#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 220, "end_pos": 220, "sequence_org": "P", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NAP->NAS).", "chr_id": "2", "chr_pos": "61498774", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P220", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs201602275", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201602275" }, { "id": "rs201602275", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs201602275" }, { "id": "rs201602275", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs201602275" }, { "id": "rs201602275", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs201602275" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 303, "end_pos": 303, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NTN->NTS).", "chr_id": "2", "chr_pos": "61495594", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "0.0002", "site_lbl": "N303", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1041448374", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1041448374" }, { "id": "rs1041448374", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1041448374" }, { "id": "rs1452857631", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1452857631" }, { "id": "rs1452857631", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1452857631#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 495, "end_pos": 495, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NLN->NLS).", "chr_id": "2", "chr_pos": "61492348", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N495", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1412170214", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1412170214" }, { "id": "rs1412170214", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1412170214" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 74, "end_pos": 74, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NMN->NMS).", "chr_id": "2", "chr_pos": "61526427", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N74", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs754056639", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754056639" }, { "id": "rs754056639", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs754056639" }, { "id": "rs754056639", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs754056639" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 769, "end_pos": 769, "sequence_org": "P", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NDP->NDS).", "chr_id": "2", "chr_pos": "61488173", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P769", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1802545", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1802545" }, { "id": "rs1802545", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1802545" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 793, "end_pos": 793, "sequence_org": "P", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NVP->NVS).", "chr_id": "2", "chr_pos": "61485899", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P793", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs996736538", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs996736538" }, { "id": "rs996736538", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs996736538" }, { "id": "rs996736538", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs996736538" }, { "id": "rs373021861", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs373021861" }, { "id": "rs373021861", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs373021861#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 890, "end_pos": 890, "sequence_org": "A", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NVA->NVT).", "chr_id": "2", "chr_pos": "61483946", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A890", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs373021861", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs373021861" }, { "id": "rs373021861", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs373021861#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 905, "end_pos": 905, "sequence_org": "A", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NVA->NVT).", "chr_id": "2", "chr_pos": "61483056", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A905", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [ { "start_pos": 191, "end_pos": 191, "sequence_org": "S", "sequence_mut": "A", "comment": "Does not abolish Rex-mediated mRNA export.", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" }, { "database": "PubMed", "id": "14612415", "url": "https://glygen.org/publication/PubMed/14612415" } ] }, { "start_pos": 284, "end_pos": 284, "sequence_org": "V", "sequence_mut": "E", "comment": "Does not abolish Rex-mediated mRNA export.", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" }, { "database": "PubMed", "id": "14612415", "url": "https://glygen.org/publication/PubMed/14612415" } ] }, { "start_pos": 334, "end_pos": 334, "sequence_org": "D", "sequence_mut": "G", "comment": "Does not abolish Rex-mediated mRNA export.", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" }, { "database": "PubMed", "id": "14612415", "url": "https://glygen.org/publication/PubMed/14612415" } ] }, { "start_pos": 337, "end_pos": 337, "sequence_org": "I", "sequence_mut": "L", "comment": "Does not abolish Rex-mediated mRNA export.", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" }, { "database": "PubMed", "id": "14612415", "url": "https://glygen.org/publication/PubMed/14612415" } ] }, { "start_pos": 346, "end_pos": 346, "sequence_org": "T", "sequence_mut": "A", "comment": "Does not abolish Rex-mediated mRNA export.", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" }, { "database": "PubMed", "id": "14612415", "url": "https://glygen.org/publication/PubMed/14612415" } ] }, { "start_pos": 402, "end_pos": 402, "sequence_org": "V", "sequence_mut": "I", "comment": "Does not abolish Rex-mediated mRNA export.", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" }, { "database": "PubMed", "id": "14612415", "url": "https://glygen.org/publication/PubMed/14612415" } ] }, { "start_pos": 411, "end_pos": 411, "sequence_org": "P", "sequence_mut": "T", "comment": "Strongly abolishes interaction with Rex and RANBP3, abolishes Rex-mediated mRNA export. Does not abolish interaction with RANBP3; when associated with S-414. Abolishes Rex multimerization; when associated with S-414.", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" }, { "database": "PubMed", "id": "14612415", "url": "https://glygen.org/publication/PubMed/14612415" } ] }, { "start_pos": 412, "end_pos": 412, "sequence_org": "M", "sequence_mut": "V", "comment": "Does not abolish interaction with Rex and RANBP3, and Rex-mediated mRNA export.", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" }, { "database": "PubMed", "id": "14612415", "url": "https://glygen.org/publication/PubMed/14612415" } ] }, { "start_pos": 414, "end_pos": 414, "sequence_org": "F", "sequence_mut": "S", "comment": "Strongly abolishes interaction with Rex and RANBP3, abolishes Rex-mediated mRNA export. Does not abolish interaction with RANBP3; when associated with T-411. Abolishes Rex multimerization; when associated with T-411.", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" }, { "database": "PubMed", "id": "14612415", "url": "https://glygen.org/publication/PubMed/14612415" } ] }, { "start_pos": 428, "end_pos": 447, "sequence_org": "EEVLVVENDQGEVVREFMKD", "sequence_mut": "QQVLVVQNNQGQVVRQFMKN", "comment": "Abolishes Ran binding activity in absence of cargo and abolishes partially Ran binding activity in presence of cargo.", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" }, { "database": "PubMed", "id": "15574331", "url": "https://glygen.org/publication/PubMed/15574331" } ] }, { "start_pos": 430, "end_pos": 433, "sequence_org": "VLVV", "sequence_mut": "DEDE", "comment": "Abolishes Ran binding activity both in absence or presence of cargo.", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" }, { "database": "PubMed", "id": "15574331", "url": "https://glygen.org/publication/PubMed/15574331" } ] }, { "start_pos": 430, "end_pos": 446, "sequence_org": "VLVVENDQGEVVREFMK", "sequence_mut": "DEDEENDQGEDEEEDDD", "comment": "Partially restores Ran binding activity in presence of cargo.", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" }, { "database": "PubMed", "id": "15574331", "url": "https://glygen.org/publication/PubMed/15574331" } ] }, { "start_pos": 454, "end_pos": 454, "sequence_org": "Y", "sequence_mut": "A", "comment": "Does not abolish Ran binding activity and nuclear export complex formation.", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" }, { "database": "PubMed", "id": "15574331", "url": "https://glygen.org/publication/PubMed/15574331" } ] }, { "start_pos": 474, "end_pos": 474, "sequence_org": "R", "sequence_mut": "I", "comment": "Strongly abolishes interaction with Rex and RANBP3, abolishes Rex-mediated mRNA export.", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" }, { "database": "PubMed", "id": "14612415", "url": "https://glygen.org/publication/PubMed/14612415" } ] }, { "start_pos": 481, "end_pos": 481, "sequence_org": "H", "sequence_mut": "Q", "comment": "Strongly abolishes interaction with Rex and RANBP3, abolishes Rex-mediated mRNA export.", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" }, { "database": "PubMed", "id": "14612415", "url": "https://glygen.org/publication/PubMed/14612415" } ] }, { "start_pos": 513, "end_pos": 513, "sequence_org": "E", "sequence_mut": "A", "comment": "Abolishes Ran binding activity and nuclear export complex formation. Abolishes Ran binding activity and nuclear export complex formation; when associated with A-553 and A-554.", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" }, { "database": "PubMed", "id": "15574331", "url": "https://glygen.org/publication/PubMed/15574331" } ] }, { "start_pos": 525, "end_pos": 525, "sequence_org": "L", "sequence_mut": "A", "comment": "Enhances Ran binding activity and does not abolish nuclear export complex formation. Does not abolish Ran binding activity and partially abolish nuclear export complex formation; when associated with A-561. Does not abolish Ran binding activity and partially abolish nuclear export complex formation; when associated with A-568 and A-572.", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" }, { "database": "PubMed", "id": "15574331", "url": "https://glygen.org/publication/PubMed/15574331" } ] }, { "start_pos": 550, "end_pos": 550, "sequence_org": "Q", "sequence_mut": "A", "comment": "Enhances Ran binding activity and does not abolish nuclear export complex formation; when associated with A-553 and A-590.", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" }, { "database": "PubMed", "id": "15574331", "url": "https://glygen.org/publication/PubMed/15574331" } ] }, { "start_pos": 553, "end_pos": 553, "sequence_org": "R", "sequence_mut": "A", "comment": "Enhances Ran binding activity and does not abolish nuclear export complex formation; when associated with A-550 and A-590. Abolishes Ran binding activity and nuclear export complex formation; when associated with A-513 and A-554.", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" }, { "database": "PubMed", "id": "15574331", "url": "https://glygen.org/publication/PubMed/15574331" } ] }, { "start_pos": 554, "end_pos": 554, "sequence_org": "F", "sequence_mut": "A", "comment": "Partially abolishes Ran binding activity and does not abolish nuclear export complex formation. Abolishes Ran binding activity and nuclear export complex formation; when associated with A-561. Abolishes Ran binding activity and nuclear export complex formation; when associated with A-553 and A-513.", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" }, { "database": "PubMed", "id": "15574331", "url": "https://glygen.org/publication/PubMed/15574331" } ] }, { "start_pos": 561, "end_pos": 561, "sequence_org": "F", "sequence_mut": "A", "comment": "Abolishes Ran binding activity and nuclear export complex formation. Abolishes Ran binding activity and nuclear export complex formation; when associated with A-554. Does not abolish Ran binding activity and partially abolish nuclear export complex formation; when associated with A-525.", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" }, { "database": "PubMed", "id": "15574331", "url": "https://glygen.org/publication/PubMed/15574331" } ] }, { "start_pos": 568, "end_pos": 568, "sequence_org": "K", "sequence_mut": "A", "comment": "Does not abolish Ran binding activity and partially abolish nuclear export complex formation; when associated with A-525 and A-572.", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" }, { "database": "PubMed", "id": "15574331", "url": "https://glygen.org/publication/PubMed/15574331" } ] }, { "start_pos": 572, "end_pos": 572, "sequence_org": "F", "sequence_mut": "A", "comment": "Does not abolish Ran binding activity and partially abolish nuclear export complex formation; when associated with A-525 and A-568.", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" }, { "database": "PubMed", "id": "15574331", "url": "https://glygen.org/publication/PubMed/15574331" } ] }, { "start_pos": 583, "end_pos": 583, "sequence_org": "M", "sequence_mut": "A", "comment": "Enhances Ran binding activity; when associated with A-590.", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" }, { "database": "PubMed", "id": "15574331", "url": "https://glygen.org/publication/PubMed/15574331" } ] }, { "start_pos": 590, "end_pos": 590, "sequence_org": "K", "sequence_mut": "A", "comment": "Enhances Ran binding activity and does not abolish nuclear export complex formation. Enhances Ran binding activity and does not abolish nuclear export complex formation; when associated with A-583. Enhances Ran binding activity and does not abolish nuclear export complex formation; when associated with A-550 and A-553.", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" }, { "database": "PubMed", "id": "15574331", "url": "https://glygen.org/publication/PubMed/15574331" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "92.8", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000082898", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000082898" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "97.32", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000082898", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000082898" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "96.17", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000082898", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000082898" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "94.09", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000082898", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000082898" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "97.47", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000082898", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000082898" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "97.26", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000082898", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000082898" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "90.21", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000082898", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000082898" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "96.84", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000082898", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000082898" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "95.46", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000082898", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000082898" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "94.16", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000082898", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000082898" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "95.92", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000082898", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000082898" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "94.51", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000082898", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000082898" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "96.52", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000082898", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000082898" } ] } ], "expression_disease": [ { "significant": "No", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O14980", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14980" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O14980", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14980" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O14980", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14980" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O14980", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14980" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O14980", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14980" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O14980", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14980" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O14980", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14980" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O14980", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14980" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O14980", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14980" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O14980", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14980" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O14980", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14980" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O14980", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14980" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "common_name": "Human" } ], "gene": [ { "name": "XPO1", "url": "https://www.uniprot.org/uniprot/O14980", "locus": { "chromosome": "2", "start_pos": 61476032, "end_pos": 61538741, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000082898", "url": "https://www.ensembl.org/id/ENSG00000082898" } ] } } ], "crossref": [ { "id": "ENSG00000082898", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000082898", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "CHEMBL5661", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL5661", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "XPO1", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=XPO1", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "7514", "url": "https://www.ncbi.nlm.nih.gov/gene/7514", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "12825", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=12825", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O14980", "url": "https://www.ebi.ac.uk/intact/interactors/id:O14980*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001494", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001494", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011989", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011989", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013598", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013598", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR014877", "url": "https://www.ebi.ac.uk/interpro/entry/IPR014877", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR016024", "url": "https://www.ebi.ac.uk/interpro/entry/IPR016024", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR040485", "url": "https://www.ebi.ac.uk/interpro/entry/IPR040485", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR041123", "url": "https://www.ebi.ac.uk/interpro/entry/IPR041123", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR041235", "url": "https://www.ebi.ac.uk/interpro/entry/IPR041235", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR045065", "url": "https://www.ebi.ac.uk/interpro/entry/IPR045065", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:7514", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:7514", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "602559", "url": "http://www.omim.org/entry/602559", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O14980", "url": "https://www.nextprot.org/entry/NX_O14980", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "O14980", "url": "https://oglcnac.org/atlas/detail/O14980", "database": "O-GlcNAc Atlas", "categories": [ "Glycoproteomics" ] }, { "id": "O14980", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14980", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "WAFKHNN", "url": "https://omabrowser.org/oma/group/WAFKHNN/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "169519at2759", "url": "http://www.orthodb.org/?query=169519at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11223", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11223", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11223:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11223:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1W9C", "url": "https://www.rcsb.org/structure/1W9C", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2L1L", "url": "https://www.rcsb.org/structure/2L1L", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3GB8", "url": "https://www.rcsb.org/structure/3GB8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4BSM", "url": "https://www.rcsb.org/structure/4BSM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4BSN", "url": "https://www.rcsb.org/structure/4BSN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5DIS", "url": "https://www.rcsb.org/structure/5DIS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6TVO", "url": "https://www.rcsb.org/structure/6TVO", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7B51", "url": "https://www.rcsb.org/structure/7B51", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF03810", "url": "http://pfam.xfam.org/family/PF03810", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF08389", "url": "http://pfam.xfam.org/family/PF08389", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF08767", "url": "http://pfam.xfam.org/family/PF08767", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF18777", "url": "http://pfam.xfam.org/family/PF18777", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF18784", "url": "http://pfam.xfam.org/family/PF18784", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF18787", "url": "http://pfam.xfam.org/family/PF18787", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O14980", "url": "https://pharos.nih.gov/targets/O14980", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O14980", "url": "http://purl.obolibrary.org/obo/PR_O14980", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-141430", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-141430", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-141444", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-141444", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-165054", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-165054", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-168333", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168333", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2173788", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173788", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2467813", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2467813", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2500257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2500257", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-3769402", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3769402", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-450520", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-450520", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-68877", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68877", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9648025", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648025", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9707616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9768919", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9768919", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9828806", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9828806", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_003391", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003391", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A7I2V2C5", "url": "https://www.uniprot.org/uniprot/A0A7I2V2C5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V2C5-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V2C5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V2H0", "url": "https://www.uniprot.org/uniprot/A0A7I2V2H0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V2H0-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V2H0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V2S3", "url": "https://www.uniprot.org/uniprot/A0A7I2V2S3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V2S3-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V2S3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V2Y6", "url": "https://www.uniprot.org/uniprot/A0A7I2V2Y6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V2Y6-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V2Y6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V396", "url": "https://www.uniprot.org/uniprot/A0A7I2V396", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V396-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V396-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V3J1", "url": "https://www.uniprot.org/uniprot/A0A7I2V3J1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V3J1-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V3J1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V3N0", "url": "https://www.uniprot.org/uniprot/A0A7I2V3N0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V3N0-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V3N0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V3P3", "url": "https://www.uniprot.org/uniprot/A0A7I2V3P3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V3P3-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V3P3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V3W6", "url": "https://www.uniprot.org/uniprot/A0A7I2V3W6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V3W6-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V3W6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V461", "url": "https://www.uniprot.org/uniprot/A0A7I2V461", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V461-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V461-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V488", "url": "https://www.uniprot.org/uniprot/A0A7I2V488", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V488-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V488-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V4A3", "url": "https://www.uniprot.org/uniprot/A0A7I2V4A3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V4A3-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V4A3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V531", "url": "https://www.uniprot.org/uniprot/A0A7I2V531", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V531-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V531-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V6B9", "url": "https://www.uniprot.org/uniprot/A0A7I2V6B9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2V6B9-1", "url": "https://www.uniprot.org/uniprot/A0A7I2V6B9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2YQP1", "url": "https://www.uniprot.org/uniprot/A0A7I2YQP1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2YQP1-1", "url": "https://www.uniprot.org/uniprot/A0A7I2YQP1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2YQV4", "url": "https://www.uniprot.org/uniprot/A0A7I2YQV4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2YQV4-1", "url": "https://www.uniprot.org/uniprot/A0A7I2YQV4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2YQX3", "url": "https://www.uniprot.org/uniprot/A0A7I2YQX3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7I2YQX3-1", "url": "https://www.uniprot.org/uniprot/A0A7I2YQX3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7P0Z4B7", "url": "https://www.uniprot.org/uniprot/A0A7P0Z4B7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A7P0Z4B7-1", "url": "https://www.uniprot.org/uniprot/A0A7P0Z4B7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9IYM2", "url": "https://www.uniprot.org/uniprot/C9IYM2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9IYM2-1", "url": "https://www.uniprot.org/uniprot/C9IYM2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9J673", "url": "https://www.uniprot.org/uniprot/C9J673", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9J673-1", "url": "https://www.uniprot.org/uniprot/C9J673-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9JKM9", "url": "https://www.uniprot.org/uniprot/C9JKM9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "C9JKM9-1", "url": "https://www.uniprot.org/uniprot/C9JKM9-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8WF71", "url": "https://www.uniprot.org/uniprot/F8WF71", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8WF71-1", "url": "https://www.uniprot.org/uniprot/F8WF71-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O14980-1", "url": "https://www.uniprot.org/uniprot/O14980-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MPAIMTMLADHAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAWTRVDTILEFSQNMNTKYYGLQILENVIKTRWKILPRNQCEGIKKYVVGLIIKTSSDPTCVEKEKVYIGKLNMILVQILKQEWPKHWPTFISDIVGASRTSESLCQNNMVILKLLSEEVFDFSSGQITQVKSKHLKDSMCNEFSQIFQLCQFVMENSQNAPLVHATLETLLRFLNWIPLGYIFETKLISTLIYKFLNVPMFRNVSLKCLTEIAGVSVSQYEEQFVTLFTLTMMQLKQMLPLNTNIRLAYSNGKDDEQNFIQNLSLFLCTFLKEHDQLIEKRLNLRETLMEALHYMLLVSEVEETEIFKICLEYWNHLAAELYRESPFSTSASPLLSGSQHFDVPPRRQLYLPMLFKVRLLMVSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYVDTERIMTEKLHNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFVQVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDQTVQEHLIEKYMLLPNQVWDSIIQQATKNVDILKDPETVKQLGSILKTNVRACKAVGHPFVIQLGRIYLDMLNVYKCLSENISAAIQANGEMVTKQPLIRSMRTVKRETLKLISGWVSRSNDPQMVAENFVPPLLDAVLIDYQRNVPAAREPEVLSTMAIIVNKLGGHITAEIPQIFDAVFECTLNMINKDFEEYPEHRTNFFLLLQAVNSHCFPAFLAIPPTQFKLVLDSIIWAFKHTMRNVADTGLQILFTLLQNVAQEEAAAQSFYQTYFCDILQHIFSVVTDTSHTAGLTMHASILAYMFNLVEEGKISTSLNPGNPVNNQIFLQEYVANLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLVQIKEFAGEDTSDLFLEEREIALRQADEEKHKRQMSVPGIFNPHEIPEEMCD", "length": 1071, "header": "sp|O14980-1|XPO1_HUMAN Isoform 1 of Exportin-1 OS=Homo sapiens OX=9606 GN=XPO1 PE=1 SV=1 CANONICAL=O14980-1" }, "isoforms": [ { "isoform_ac": "A0A7I2V2C5-1", "url": "", "sequence": { "sequence": "MPAIMTMLADHAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAWTRVDTILEFSQNMNTKYYGLQILENVIKTRWKILPRNQCEGMVSRCVAHAAGCWA", "length": 115, "header": "tr|A0A7I2V2C5-1|XPO1_HUMAN Computationally mapped isoform of Exportin-1 OS=Homo sapiens OX=9606 GN=XPO1 PE=1 SV=1 CANONICAL=O14980-1" }, "locus": { "chromosome": "2", "start_pos": 61533897, "end_pos": 61520432, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000679035.1", "url": "https://www.ensembl.org/id/ENST00000679035.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000502854.1", "url": "https://www.ensembl.org/id/ENSP00000502854.1" } ] } }, { "isoform_ac": "A0A7I2V2H0-1", "url": "", "sequence": { "sequence": "MPAIMTMLADHAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAWTRVDTILEFSQNMNTKYYGLQILENVIKTRWKILPRNQCEGIKKYVVGLIIKTSSDPTCVEENSQNAPLVHATLETLLRFLNWIPLGYIFETKLISTLIYKFLNVPMFRNVSLKCLTEIAGVSVSQYEEQFVTLFTLTMMQLKQMLPLNTNIRLAYSNGKDDEQNFIQNLSLFLCTFLKEHDQLIEKRLNLRETLMEALHYMLLVSEVEETEIFKICLEYWNHLAAELYRESPFSTSASPLLSGSQHFDVPPRRQLYLPMLFKVRLLMVSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYVDTERIMTEKLHNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFVQVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDQTVQEHLIEKYMLLPNQVWDSIIQQATKNVDILKDPETVKQLGSILKTNVRACKAVGHPFVIQLGRIYLDMLNVYKCLSENISAAIQANGEMVTKQPLIRSMRTVKRETLKLISGWVSRSNDPQMVAENFVPPLLDAVLIDYQRNVPAAREPEVLSTMAIIVNKLGGHITAEIPQIFDAVFECTLNMINKDFEEYPEHRTNFFLLLQAVNSHCFPAFLAIPPTQFKLVLDSIIWAFKHTMRNVADTGLQILFTLLQNVAQEEAAAQSFYQTYFCDILQHIFSVVTDTSHTAGLTMHASILAYMFNLVEEGKISTSLNPGNPVNNQIFLQEYVANLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLVQIKEFAGEDTSDLFLEEREIALRQADEEKHKRQMSVPGIFNPHEIPEEMCD", "length": 979, "header": "tr|A0A7I2V2H0-1|XPO1_HUMAN Computationally mapped isoform of Exportin-1 OS=Homo sapiens OX=9606 GN=XPO1 PE=1 SV=1 CANONICAL=O14980-1" }, "locus": { "chromosome": "2", "start_pos": 61533897, "end_pos": 61478823, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000678877.1", "url": "https://www.ensembl.org/id/ENST00000678877.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000502889.1", "url": "https://www.ensembl.org/id/ENSP00000502889.1" } ] } }, { "isoform_ac": "A0A7I2V2S3-1", "url": "", "sequence": { "sequence": "MPAIMTMLADHAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAWTRVDTILEFSQNMNTKYYGLQILENVIKTRWKILPRNQCEGIKKYVVGLIIKTSSDPTCVEKEKVYIGKLNMILVQILKQEWPKHWPTFISDIVGASRTSESLCQNNMVILKLLSEEVFDFSSGQITQVKSKHLKDSMCNEFSQIFQLCQFVMENSQNAPLVHATLETLLRFLNWIPLGYIFETKLISTLIYKFLNVPMFRNVSLKCLTEIAGVSVSQYEEQFVTLFTLTMMQLKQVRLLMVSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYVDTERIMTEKLHNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFVQVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDQTVQEHLIEKYMLLPNQVWDSIIQQATKNVDILKDPETVKQLGSILKTNVRACKAVGHPFVIQLGRIYLDMLNVYKCLSENISAAIQANGEMVTKQPLIRSMRTVKRETLKLISGWVSRSNDPQMVAENFVPPLLDAVLIDYQRNVPAAREPEVLSTMAIIVNKLGGHITAEIPQIFDAVFECTLNMINKDFEEYPEHRTNFFLLLQAVNSHCFPAFLAIPPTQFKLVLDSIIWAFKHTMRNVADTGLQILFTLLQNVAQEEAAAQSFYQTYFCDILQHIFSVVTDTSHTAGLTMHASILAYMFNLVEEGKISTSLNPGNPVNNQIFLQEYVANLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLVQIKEFAGEDTSDLFLEEREIALRQADEEKHKRQMSVPGIFNPHEIPEEMCD", "length": 952, "header": "tr|A0A7I2V2S3-1|XPO1_HUMAN Computationally mapped isoform of Exportin-1 OS=Homo sapiens OX=9606 GN=XPO1 PE=1 SV=1 CANONICAL=O14980-1" }, "locus": { "chromosome": "2", "start_pos": 61533897, "end_pos": 61478823, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000676889.1", "url": "https://www.ensembl.org/id/ENST00000676889.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503075.1", "url": "https://www.ensembl.org/id/ENSP00000503075.1" } ] } }, { "isoform_ac": "A0A7I2V2Y6-1", "url": "", "sequence": { "sequence": "MPAIMTMLADHAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAWTRVDTILEFSQNMNTKYYGLQILENVIKTRWKILPRNQCEGIKKYVVGLIIKTSSDPTCVEKEKVYIGKLNMILVQILKQEWPKHWPTFISDIVGASRTSESLCQNNMVILKLLSEEVFDFSSGQITQVKSKHLKDSMCNEFSQIFQLCQFVMENSQNAPLVHATLETLLRFLNWIPLGYIFETKLISTLIYKFLNVPMFRNVSLKCLTEIAGVSVSQYEEQFVTLFTLTMMQLKQMLPLNTNIRLAYSNGKDDEQNFIQNLSLFLCTFLKEHDQLIEKRLNLRETLMEALHYMLLVSEVEETEIFKICLEYWNHLAAELYRESPFSTSASPLLSGSQHFDVPPRRQLYLPMLFKVRLLMVSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYVDTERIMTEKLHNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFVQVQVGEVMPFIDEILNNINTIICDLQPQQNVDILKDPETVKQLGSILKTNVRACKAVGHPFVIQLGRIYLDMLNVYKCLSENISAAIQANGEMVTKQPLIRSMRTVKRETLKLISGWVSRSNDPQMVAENFVPPLLDAVLIDYQRNVPAAREPEVLSTMAIIVNKLGGHITAEIPQIFDAVFECTLNMINKDFEEYPEHRTNFFLLLQAVNSHCFPAFLAIPPTQFKLVLDSIIWAFKHTMRNVADTGLQILFTLLQNVAQEEAAAQSFYQTYFCDILQHIFSVVTDTSHTAGLTMHASILAYMFNLVEEGKISTSLNPGNPVNNQIFLQEYVANLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLVQIKEFAGEDTSDLFLEEREIALRQADEEKHKRQMSVPGIFNPHEIPEEMCD", "length": 1026, "header": "tr|A0A7I2V2Y6-1|A0A7I2V2Y6_HUMAN Computationally mapped isoform of Exportin 1 OS=Homo sapiens OX=9606 GN=XPO1 PE=1 SV=1 CANONICAL=O14980-1" }, "locus": { "chromosome": "2", "start_pos": 61533897, "end_pos": 61478823, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000678081.1", "url": "https://www.ensembl.org/id/ENST00000678081.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503194.1", "url": "https://www.ensembl.org/id/ENSP00000503194.1" } ] } }, { "isoform_ac": "A0A7I2V396-1", "url": "", "sequence": { "sequence": "MPAIMTMLADHAARQLLDFSQKLDINLLDNVVNCLYHGEGAQAGAQWLDHSSLQP", "length": 55, "header": "tr|A0A7I2V396-1|XPO1_HUMAN Computationally mapped isoform of Exportin-1 OS=Homo sapiens OX=9606 GN=XPO1 PE=1 SV=1 CANONICAL=O14980-1" }, "locus": { "chromosome": "2", "start_pos": 61533897, "end_pos": 61529121, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000676783.1", "url": "https://www.ensembl.org/id/ENST00000676783.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503342.1", "url": "https://www.ensembl.org/id/ENSP00000503342.1" } ] } }, { "isoform_ac": "A0A7I2V3J1-1", "url": "", "sequence": { "sequence": "MPAIMTMLADHAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAWTRVDTILEFSQNMNTKYYGLQILENVIKTRWKILPRNQCEACAMNSHRYFNCVSL", "length": 115, "header": "tr|A0A7I2V3J1-1|XPO1_HUMAN Computationally mapped isoform of Exportin-1 OS=Homo sapiens OX=9606 GN=XPO1 PE=1 SV=1 CANONICAL=O14980-1" }, "locus": { "chromosome": "2", "start_pos": 61533897, "end_pos": 61498870, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000677422.1", "url": "https://www.ensembl.org/id/ENST00000677422.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503474.1", "url": "https://www.ensembl.org/id/ENSP00000503474.1" } ] } }, { "isoform_ac": "A0A7I2V3N0-1", "url": "", "sequence": { "sequence": "MPAIMTMLADHAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAWTRVDTILEFSQNMNTKYYGLQILENVIKTRWKILPRNQCEGIKKYVVGLIIKTSSDPTCVEKEKVYIGKLNMILVQILKQEWPKHWPTFISDIVGASRTSESLCQNNMVILKLLSEEVFDFSSGQITQVKSKHLKDSMCNEFSQIFQLCQFVMENSQNAPLVHATLETLLRFLNWIPLGYIFETKLISTLIYKFLNVPMFRNVSLKCLTEIAGVSVSQYEEQFVTLFTLTMMQLKQMLPLNTNIRLAYSNGKDDEQNFIQNLSLFLCTFLKEHDQLIEKRLNLRETLMEALHYMLLVSEVEETEIFKICLEYWNHLAAELYRESPFSTSASPLLSGSQHFDVPPRRQLYLPMLFKVRLLMVSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYVDTERIMTEKLHNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFVQVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDQTVQEHLIEKYMLLPNQVWDSIIQQATKNVDILKDPETVKQLGSILKTNVRACKAVGHPFVIQLGRIYLDMLNVYKCLSENISAAIQAI", "length": 735, "header": "tr|A0A7I2V3N0-1|XPO1_HUMAN Computationally mapped isoform of Exportin-1 OS=Homo sapiens OX=9606 GN=XPO1 PE=1 SV=1 CANONICAL=O14980-1" }, "locus": { "chromosome": "2", "start_pos": 61533897, "end_pos": 61488212, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000678172.1", "url": "https://www.ensembl.org/id/ENST00000678172.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503554.1", "url": "https://www.ensembl.org/id/ENSP00000503554.1" } ] } }, { "isoform_ac": "A0A7I2V3P3-1", "url": "", "sequence": { "sequence": "MPAIMTMLADHAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAWTRVDTILEFSQNMNTKYYGLQILENVIKTRWKILPRNQCEGIKKYVVGLIIKTSSDPTCVEKEKVYIGKLNMILVQILKQEWPKHWPTFISDIVGASRTSESLCQNNMVILKLLSEEVFDFSSGQITQVKSKHLKDSMCNEFSQIFQLCQFVMENSQNAPLVHATLETLLRFLNWIPLGYIFETKLISTLIYKFLNVPMFRNVSLKCLTEIAGVSVSQYEEQFVTLFTLTMMQLKQMLPLNTNIRLAYSNGKDDEQNFIQNLSLFLCTFLKEHDQLIEKRLNLRETLMEALHYMLLVSEVEETEIFKICLEYWNHLAAELYRESPFSTSASPLLSGSQHFDVPPRRQLYLPMLFKVRLLMVSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYVDTERIMTEKLHNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFVQVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDQTVQEHLIEKYMLLPNQVWDSIIQQATKNVDILKDPETVKQLGSILKTNVRACKAVGHPFVIQLGRIYLDMLNVYKCLSENISAAIQANGEMVTKQPLIRSMRTVKRETLKLISGWVSRSNDPQMVAENFVPPLLDAVLIDYQRNVPAAREPEVLSTMAIIVNKLGGHITAEIPQIFDAVFECTLNMINKDFEEYPEHRTNFFLLLQAVNSHCFPAFLAIPPTQFKLVLDSIIWAFKHTMRNVADTGLQILFTLLQNVAQEEAAAQSFYQTYFCDILQHIFSVVTDTSHTAGICG", "length": 941, "header": "tr|A0A7I2V3P3-1|A0A7I2V3P3_HUMAN Computationally mapped isoform of Exportin 1 OS=Homo sapiens OX=9606 GN=XPO1 PE=1 SV=1 CANONICAL=O14980-1" }, "locus": { "chromosome": "2", "start_pos": 61533897, "end_pos": 61482416, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000678741.1", "url": "https://www.ensembl.org/id/ENST00000678741.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503395.1", "url": "https://www.ensembl.org/id/ENSP00000503395.1" } ] } }, { "isoform_ac": "A0A7I2V3W6-1", "url": "", "sequence": { "sequence": "MNTKYYGLQILENVIKTRWKILPRNQCEGIKKYVVGLIIKTSSDPTCVEKEKVYIGKLNMILVQILKQEWPKHWPTFISDIVGASRTSESLCQNNMVILKLLSEEVFDFSSGQITQVKSKHLKDSMCNEFSQIFQLCQFVMENSQNAPLVHATLETLLRFLNWIPLGYIFETKLISTLIYKFLNVPMFRNVSLKCLTEIAGVSVSQYEEQFVTLFTLTMMQLKQMLPLNTNIRLAYSNGKDDEQNFIQNLSLFLCTFLKEHDQLIEKRLNLRETLMEALHYMLLVSEVEETEIFKICLEYWNHLAAELYRESPFSTSASPLLSGSQHFDVPPRRQLYLPMLFKVRLLMVSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYVDTERIMTEKLHNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFVQVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDQTVQEHLIEKYMLLPNQVWDSIIQQATKNVDILKDPETVKQLGSILKTNVRACKAVGHPFVIQLGRIYLDMLNVYKCLSENISAAIQANGEMVTKQPLIRSMRTVKRETLKLISGWVSRSNDPQMVAENFVPPLLDAVLIDYQRNVPAAREPEVLSTMAIIVNKLGGHITAEIPQIFDAVFECTLNMINKDFEEYPEHRTNFFLLLQAVNSHCFPAFLAIPPTQFKLVLDSIIWAFKHTMRNVADTGLQILFTLLQNVAQEEAAAQSFYQTYFCDILQHIFSVVTDTSHTAGLTMHASILAYMFNLVEEGKISTSLNPGNPVNNQIFLQEYVANLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLVQIKEFAGEDTSDLFLEEREIALRQADEEKHKRQMSVPGIFNPHEIPEEMCD", "length": 999, "header": "tr|A0A7I2V3W6-1|A0A7I2V3W6_HUMAN Computationally mapped isoform of Exportin 1 OS=Homo sapiens OX=9606 GN=XPO1 PE=1 SV=1 CANONICAL=O14980-1" }, "locus": { "chromosome": "2", "start_pos": 61526431, "end_pos": 61478823, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000677803.1", "url": "https://www.ensembl.org/id/ENST00000677803.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503702.1", "url": "https://www.ensembl.org/id/ENSP00000503702.1" } ] } }, { "isoform_ac": "A0A7I2V461-1", "url": "", "sequence": { "sequence": "MPAIMTMLADHAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAWTRVDTILEFSQNMNTKYYGLQILENVIKTRWKILPRNQCEGIKKYVVGLIIKTSSDPTCVEILKQEWPKHWPTFISDIVGASRTSESLCQNNMVILKLLSEEVFDFSSGQITQVKSKHLKDSMCNEFSQIFQLCQFVMENSQNAPLVHATLETLLRFLNWIPLGYIFETKLISTLIYKFLNVPMFRNVSLKCLTEIAGVSVSQYEEQFVTLFTLTMMQLKQMLPLNTNIRLAYSNGKDDEQNFIQNLSLFLCTFLKEHDQLIEKRLNLRETLMEALHYMLLVSEVEETEIFKICLEYWNHLAAELYRESPFSTSASPLLSGSQHFDVPPRRQLYLPMLFKVRLLMVSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYVDTERIMTEKLHNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFVQVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDQTVQEHLIEKYMLLPNQVWDSIIQQATKNVDILKDPETVKQLGSILKTNVRACKAVGHPFVIQLGRIYLDMLNVYKCLSENISAAIQANGEMVTKQPLIRSMRTVKRETLKLISGWVSRSNDPQMVAENFVPPLLDAVLIDYQRNVPAAREPEVLSTMAIIVNKLGGHITAEIPQIFDAVFECTLNMINKDFEEYPEHRTNFFLLLQAVNSHCFPAFLAIPPTQFKLVLDSIIWAFKHTMRNVADTGLQILFTLLQNVAQEEAAAQSFYQTYFCDILQHIFSVVTDTSHTAGLTMHASILAYMFNLVEEGKISTSLNPGNPVNNQIFLQEYVANLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLVQIKEFAGEDTSDLFLEEREIALRQADEEKHKRQMSVPGIFNPHEIPEEMCD", "length": 1056, "header": "tr|A0A7I2V461-1|A0A7I2V461_HUMAN Computationally mapped isoform of Exportin 1 OS=Homo sapiens OX=9606 GN=XPO1 PE=1 SV=1 CANONICAL=O14980-1" }, "locus": { "chromosome": "2", "start_pos": 61533897, "end_pos": 61478823, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000676771.1", "url": "https://www.ensembl.org/id/ENST00000676771.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503808.1", "url": "https://www.ensembl.org/id/ENSP00000503808.1" } ] } }, { "isoform_ac": "A0A7I2V488-1", "url": "", "sequence": { "sequence": "MVILKLLSEEVFDFSSGQITQVKSKHLKDSMCNEFSQIFQLCQFVMENSQNAPLVHATLETLLRFLNWIPLGYIFETKLISTLIYKFLNVPMFRNVSLKCLTEIAGVSVSQYEEQFVTLFTLTMMQLKQMLPLNTNIRLAYSNGKDDEQNFIQNLSLFLCTFLKEHDQLIEKRLNLRETLMEALHYMLLVSEVEETEIFKICLEYWNHLAAELYRESPFSTSASPLLSGSQHFDVPPRRQLYLPMLFKVRLLMVSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYVDTERIMTEKLHNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFVQVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDQTVQEHLIEKYMLLPNQVWDSIIQQATKNVDILKDPETVKQLGSILKTNVRACKAVGHPFVIQLGRIYLDMLNVYKCLSENISAAIQANGEMVTKQPLIRSMRTVKRETLKLISGWVSRSNDPQMVAENFVPPLLDAVLIDYQRNVPAAREPEVLSTMAIIVNKLGGHITAEIPQIFDAVFECTLNMINKDFEEYPEHRTNFFLLLQAVNSHCFPAFLAIPPTQFKLVLDSIIWAFKHTMRNVADTGLQILFTLLQNVAQEEAAAQSFYQTYFCDILQHIFSVVTDTSHTAGLTMHASILAYMFNLVEEGKISTSLNPGNPVNNQIFLQEYVANLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLVQIKEFAGEDTSDLFLEEREIALRQADEEKHKRQMSVPGIFNPHEIPEEMCD", "length": 904, "header": "tr|A0A7I2V488-1|XPO1_HUMAN Computationally mapped isoform of Exportin-1 OS=Homo sapiens OX=9606 GN=XPO1 PE=1 SV=1 CANONICAL=O14980-1" }, "locus": { "chromosome": "2", "start_pos": 61499801, "end_pos": 61478823, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000677476.1", "url": "https://www.ensembl.org/id/ENST00000677476.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503789.1", "url": "https://www.ensembl.org/id/ENSP00000503789.1" } ] } }, { "isoform_ac": "A0A7I2V4A3-1", "url": "", "sequence": { "sequence": "MPAIMTMLADHAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAWTRVDTILEFSQNMNTKYYGLQILENVIKTRWKILPRNQCEGIKKYVVGLIIKTSSDPTCVEKEKVYIGKLNMILVQILKQEWPKHWPTFISDIVGASRTSESLCQNNMVILKLLSEEVFDFSSGQITQVKSKHLKDSMCNEFSQIFQLCQFVMENSQNAPLVHATLETLLRFLNWIPLGYIFETKLISTLIYKFLNVPMFRNVSLKCLTEIAGVSVSQYEEQFVTLFTLTMMQLKQMLPLNTNIRLAYSNGKDDEQNFIQNLSLFLCTFLKEHDQLIEKRLNLRETLMEALHYMLLVSEVEETEIFKICLEYWNHLAAELYRESPFSTSASPLLSGSQHFDVPPRRQLYLPMLFKVRLLMVSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYVDTERIMTEKLHNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFVQVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDQTVQEHLIEKYMLLPNQVWDSIIQQATKRRGFTVLSRMVPIS", "length": 688, "header": "tr|A0A7I2V4A3-1|A0A7I2V4A3_HUMAN Computationally mapped isoform of Exportin 1 OS=Homo sapiens OX=9606 GN=XPO1 PE=1 SV=1 CANONICAL=O14980-1" }, "locus": { "chromosome": "2", "start_pos": 61533897, "end_pos": 61488891, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000678360.1", "url": "https://www.ensembl.org/id/ENST00000678360.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000503638.1", "url": "https://www.ensembl.org/id/ENSP00000503638.1" } ] } }, { "isoform_ac": "A0A7I2V531-1", "url": "", "sequence": { "sequence": "NFGIFSEYEYEILWTTNFGKCDKNKVEDSSKEPVRRDGVSLCCPCCWLLGLSNPPTLACQSAGIE", "length": 65, "header": "tr|A0A7I2V531-1|A0A7I2V531_HUMAN Computationally mapped isoform of Exportin 1 OS=Homo sapiens OX=9606 GN=XPO1 PE=4 SV=1 CANONICAL=O14980-1" }, "locus": { "chromosome": "2", "start_pos": 61526453, "end_pos": 61502308, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000677289.1", "url": "https://www.ensembl.org/id/ENST00000677289.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504286.1", "url": "https://www.ensembl.org/id/ENSP00000504286.1" } ] } }, { "isoform_ac": "A0A7I2V6B9-1", "url": "", "sequence": { "sequence": "MILVQILKQEWPKHWPTFISDIVGASRTSESLCQNNMVILKLLSEEVFDFSSGQITQVKSKHLKDSMCNEFSQIFQLCQFVMENSQNAPLVHATLETLLRFLNWIPLGYIFETKLISTLIYKFLNVPMFRNVSLKCLTEIAGVSVSQYEEQFVTLFTLTMMQLKQMLPLNTNIRLAYSNGKDDEQNFIQNLSLFLCTFLKEHDQLIEKRLNLRETLMEALHYMLLVSEVEETEIFKICLEYWNHLAAELYRESPFSTSASPLLSGSQHFDVPPRRQLYLPMLFKVRLLMVSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYVDTERIMTEKLHNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFVQVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDQTVQEHLIEKYMLLPNQVWDSIIQQATKNVDILKDPETVKQLGSILKTNVRACKAVGHPFVIQLGRIYLDMLNVYKCLSENISAAIQANGEMVTKQPLIRSMRTVKRETLKLISGWVSRSNDPQMVAENFVPPLLDAVLIDYQRNVPAAREPEVLSTMAIIVNKLGGHITAEIPQIFDAVFECTLNMINKDFEEYPEHRTNFFLLLQAVNSHCFPAFLAIPPTQFKLVLDSIIWAFKHTMRNVADTGLQILFTLLQNVAQEEAAAQSFYQTYFCDILQHIFSVVTDTSHTAGLTMHASILAYMFNLVEEGKISTSLNPGNPVNNQIFLQEYVANLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLVQIKEFAGEDTSDLFLEEREIALRQADEEKHKRQMSVPGIFNPHEIPEEMCD", "length": 940, "header": "tr|A0A7I2V6B9-1|A0A7I2V6B9_HUMAN Computationally mapped isoform of Exportin 1 OS=Homo sapiens OX=9606 GN=XPO1 PE=1 SV=1 CANONICAL=O14980-1" }, "locus": { "chromosome": "2", "start_pos": 61502010, "end_pos": 61478823, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000677556.1", "url": "https://www.ensembl.org/id/ENST00000677556.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504749.1", "url": "https://www.ensembl.org/id/ENSP00000504749.1" } ] } }, { "isoform_ac": "A0A7I2YQP1-1", "url": "", "sequence": { "sequence": "MPAIMTMLADHAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAWTRVDTILEFSQNMNTKYYGLQILENVIKTRWKILPRNQCEDTETRMAQTLANFYQ", "length": 115, "header": "tr|A0A7I2YQP1-1|A0A7I2YQP1_HUMAN Computationally mapped isoform of Exportin 1 OS=Homo sapiens OX=9606 GN=XPO1 PE=1 SV=1 CANONICAL=O14980-1" }, "locus": { "chromosome": "2", "start_pos": 61533897, "end_pos": 61499851, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000678263.1", "url": "https://www.ensembl.org/id/ENST00000678263.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504172.1", "url": "https://www.ensembl.org/id/ENSP00000504172.1" } ] } }, { "isoform_ac": "A0A7I2YQV4-1", "url": "", "sequence": { "sequence": "MPAIMTMLADHAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAWTRVDTILEFSQNMNTKYYGLQILENVIKTRWKILPRNQCEGIKKYVVGLIIKTSSDPTCVEKEKVYIGKLNMILVQILKQEWPKHWPTFISDIVGASRTSESLCQNNMVILKLLSEEVFDFSSGQITQVKSKHLKDSMCNEFSQIFQLCQFVMENSQNAPLVHATLETLLRFLNWIPLGYIFETKLISTLIYKFLNVPMFRNVSLKCLTEIAGVSVSQYEEQFVTLFTLTMMQLKQMLPLNTNIRLAYSNGKDDEQNFIQNLSLFLCTFLKEHDQLIEKRLNLRETLMEALHYMLLVSEVEETEIFKICLEYWNHLAAELYRESPFSTSASPLLSGSQHFDVPPRRQLYLPMLFKVRLLMVSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYVDTERIMTEKLHNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFVQVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDQTVQEHLIEKYMLLPNQVWDSIIQQATKNVDILKDPETVKQLGSILKTNVRACKAVGHPFVIQLGRIYLDMLNVYKCLSENISAAIQANGEMVTKQPLIRSMRTVKRETLKLISGWVSRSNDPQMVAENFVPPLLDAVLIDYQRNVPAAREPEVLSTMAIIVNKLGGHITAEIPQIFDAVFECTLNMINKDFEEYPEHRTNFFLLLQAVNSHCFPAFLAIPPTQFKLVLDSIIWAFKHTMRNVADTGLQILFTLLQNVAQEEAAAQSFYQTYFCDILQHIFSVVTDTSHTAGLTMHASILAYMFNLVEEGKISTSLNPGNPVNNQIFLQEYVANLLKSAFPHLQENLQVKTLLICFWKREK", "length": 1007, "header": "tr|A0A7I2YQV4-1|A0A7I2YQV4_HUMAN Computationally mapped isoform of Exportin 1 OS=Homo sapiens OX=9606 GN=XPO1 PE=1 SV=1 CANONICAL=O14980-1" }, "locus": { "chromosome": "2", "start_pos": 61533897, "end_pos": 61478918, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000676789.1", "url": "https://www.ensembl.org/id/ENST00000676789.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504617.1", "url": "https://www.ensembl.org/id/ENSP00000504617.1" } ] } }, { "isoform_ac": "A0A7I2YQX3-1", "url": "", "sequence": { "sequence": "MPAIMTMLADHAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAWTRVDTILEFSQNMNTKYYGLQILENVIKTRWKILPRNQCEGIKKYVVGLIIKTSSDPTCVEKEKVYIGKLNMILVQILKQEWPKHWPTFISDIVGASRTSESLCQNNMVILKLLSEEVFDFSSGQITQVKSKHLKDSMCNEFSQIFQLCQFVMENSQNAPLVHATLETLLRFLNWIPLGYIFETKLISTLIYKFLNVPMFRNVSLKCLTEIAGVSVSQYEEQFVTLFTLTMMQLKQMLPLNTNIRLAYSNGKDDEQNFIQNLSLFLCTFLKEHDQLIEKRLNLRETLMEALHYMLLVSEVEETEIFKICLEYWNHLAAELYRESPFSTSASPLLSGSQHFDVPPRRQLYLPMLFKVRLLMVSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYVDTERIMTEKLHNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFVQVQVGEVMPFIDEILNNINTIICDLQPQQEFAGEDTSDLFLEEREIALRQADEEKHKRQMSVPGIFNPHEIPEEMCD", "length": 677, "header": "tr|A0A7I2YQX3-1|A0A7I2YQX3_HUMAN Computationally mapped isoform of Exportin 1 OS=Homo sapiens OX=9606 GN=XPO1 PE=1 SV=1 CANONICAL=O14980-1" }, "locus": { "chromosome": "2", "start_pos": 61533897, "end_pos": 61478823, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000677850.1", "url": "https://www.ensembl.org/id/ENST00000677850.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000504771.1", "url": "https://www.ensembl.org/id/ENSP00000504771.1" } ] } }, { "isoform_ac": "A0A7P0Z4B7-1", "url": "", "sequence": { "sequence": "MPAIMTMLADHAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAWTRVDTILEFSQNMNTKEEKGCLPVQLTQLGFDGRPPQVLWTTNFGKCDKNKVEDSSKEPVRRNKKIRCWPHYQDVI", "length": 136, "header": "tr|A0A7P0Z4B7-1|A0A7P0Z4B7_HUMAN Computationally mapped isoform of Exportin 1 OS=Homo sapiens OX=9606 GN=XPO1 PE=1 SV=1 CANONICAL=O14980-1" }, "locus": { "chromosome": "2", "start_pos": 61533897, "end_pos": 61502268, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000680228.1", "url": "https://www.ensembl.org/id/ENST00000680228.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000505574.1", "url": "https://www.ensembl.org/id/ENSP00000505574.1" } ] } }, { "isoform_ac": "C9IYM2-1", "url": "", "sequence": { "sequence": "MPAIMTMLADHAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAWTR", "length": 62, "header": "tr|C9IYM2-1|C9IYM2_HUMAN Computationally mapped isoform of Exportin 1 OS=Homo sapiens OX=9606 GN=XPO1 PE=1 SV=1 CANONICAL=O14980-1" }, "locus": { "chromosome": "2", "start_pos": 61533897, "end_pos": 61526462, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000449444.5", "url": "https://www.ensembl.org/id/ENST00000449444.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000406819.1", "url": "https://www.ensembl.org/id/ENSP00000406819.1" } ] } }, { "isoform_ac": "C9J673-1", "url": "", "sequence": { "sequence": "MPAIMTMLADHAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAWTRVDTILEFSQNMNTKYYGLQILENVIKTRWKILPRNQCEGIKKYVVGLIIKTSSDPTCVEKEKVYIGKLNM", "length": 132, "header": "tr|C9J673-1|C9J673_HUMAN Computationally mapped isoform of Exportin 1 OS=Homo sapiens OX=9606 GN=XPO1 PE=1 SV=1 CANONICAL=O14980-1" }, "locus": { "chromosome": "2", "start_pos": 61533897, "end_pos": 61502008, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000443240.5", "url": "https://www.ensembl.org/id/ENST00000443240.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000406428.1", "url": "https://www.ensembl.org/id/ENSP00000406428.1" } ] } }, { "isoform_ac": "C9JKM9-1", "url": "", "sequence": { "sequence": "MPAIMTMLADHAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAWTRVDTILEFSQNMNTKYYGLQILENVIKTRWKILPRNQCEGIKKYVVGLIIKTSSDPTCVEKEKVYIGKLNMILVQILKQEWPKHWPTFISDIVGASRTSESLCQNNMVILKLLSEEVFDFSSGQITQVKSKHLKDSMCNEFSQIFQLCQFVMENSQNAPLVHATLETLLRFLNWIPLGYIFETKLISTLIYKFLNVPMFRNVSLKCLTEIAGVSVSQYEEQFVTLFTLTMMQLKQMLPLNTNIRLAYSNGKDDEQNFIQNLSLFLCTFLKEHDQLIEKRLNLRETLMEALHYMLLVSEVEETEIFKICLEYWNHLAAELYRESPFSTSASPLLSGSQHFDVPPRRQLYLPMLFKCSSKALCDRAFQLKSRYSCFQGTFKRFPSSNKGICR", "length": 451, "header": "tr|C9JKM9-1|C9JKM9_HUMAN Computationally mapped isoform of Exportin 1 OS=Homo sapiens OX=9606 GN=XPO1 PE=1 SV=2 CANONICAL=O14980-1" }, "locus": { "chromosome": "2", "start_pos": 61533897, "end_pos": 61478956, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000451765.6", "url": "https://www.ensembl.org/id/ENST00000451765.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000413853.2", "url": "https://www.ensembl.org/id/ENSP00000413853.2" } ] } }, { "isoform_ac": "F8WF71-1", "url": "", "sequence": { "sequence": "MPAIMTMLADHAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAWTRVDTILEFSQNMNTKVSKWWF", "length": 82, "header": "tr|F8WF71-1|XPO1_HUMAN Computationally mapped isoform of Exportin-1 OS=Homo sapiens OX=9606 GN=XPO1 PE=1 SV=1 CANONICAL=O14980-1" }, "locus": { "chromosome": "2", "start_pos": 61533897, "end_pos": 61526402, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000428210.5", "url": "https://www.ensembl.org/id/ENST00000428210.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000407170.1", "url": "https://www.ensembl.org/id/ENSP00000407170.1" } ] } }, { "isoform_ac": "O14980-1", "url": "", "sequence": { "sequence": "MPAIMTMLADHAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAWTRVDTILEFSQNMNTKYYGLQILENVIKTRWKILPRNQCEGIKKYVVGLIIKTSSDPTCVEKEKVYIGKLNMILVQILKQEWPKHWPTFISDIVGASRTSESLCQNNMVILKLLSEEVFDFSSGQITQVKSKHLKDSMCNEFSQIFQLCQFVMENSQNAPLVHATLETLLRFLNWIPLGYIFETKLISTLIYKFLNVPMFRNVSLKCLTEIAGVSVSQYEEQFVTLFTLTMMQLKQMLPLNTNIRLAYSNGKDDEQNFIQNLSLFLCTFLKEHDQLIEKRLNLRETLMEALHYMLLVSEVEETEIFKICLEYWNHLAAELYRESPFSTSASPLLSGSQHFDVPPRRQLYLPMLFKVRLLMVSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYVDTERIMTEKLHNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFVQVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDQTVQEHLIEKYMLLPNQVWDSIIQQATKNVDILKDPETVKQLGSILKTNVRACKAVGHPFVIQLGRIYLDMLNVYKCLSENISAAIQANGEMVTKQPLIRSMRTVKRETLKLISGWVSRSNDPQMVAENFVPPLLDAVLIDYQRNVPAAREPEVLSTMAIIVNKLGGHITAEIPQIFDAVFECTLNMINKDFEEYPEHRTNFFLLLQAVNSHCFPAFLAIPPTQFKLVLDSIIWAFKHTMRNVADTGLQILFTLLQNVAQEEAAAQSFYQTYFCDILQHIFSVVTDTSHTAGLTMHASILAYMFNLVEEGKISTSLNPGNPVNNQIFLQEYVANLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLVQIKEFAGEDTSDLFLEEREIALRQADEEKHKRQMSVPGIFNPHEIPEEMCD", "length": 1071, "header": "sp|O14980-1|XPO1_HUMAN Isoform 1 of Exportin-1 OS=Homo sapiens OX=9606 GN=XPO1 PE=1 SV=1 CANONICAL=O14980-1" }, "locus": { "chromosome": "2", "start_pos": 61533897, "end_pos": 61478823, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000404992.6", "url": "https://www.ensembl.org/id/ENST00000404992.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000385942.2", "url": "https://www.ensembl.org/id/ENSP00000385942.2" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "O-GlcNAcylation", "start_pos": 89, "start_aa": "Thr", "end_pos": 89, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr89", "evidence": [ { "id": "O14980", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14980" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" }, { "id": "33214551", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/33214551" }, { "id": "35138101", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35138101" }, { "id": "30397120", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30397120" }, { "id": "30379171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30379171" }, { "id": "34725712", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34725712" }, { "id": "26853435", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/26853435" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" }, { "id": "34019948", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/34019948" }, { "id": "35083852", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35083852" }, { "id": "32119511", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32119511" }, { "id": "22121020", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/22121020" }, { "id": "O14980", "database": "O-GlcNAc Atlas", "url": "https://oglcnac.org/atlas/detail/O14980" } ] } ], "phosphorylation": [ { "start_pos": 1030, "end_pos": 1030, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O14980", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14980" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" } ], "site_lbl": "Thr1030" }, { "start_pos": 1031, "end_pos": 1031, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O14980", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14980" }, { "database": "PubMed", "id": "17322306", "url": "https://glygen.org/publication/PubMed/17322306" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "phospho.ELM", "id": "O14980", "url": "http://phospho.elm.eu.org/byAccession/O14980.html" } ], "site_lbl": "Ser1031" }, { "start_pos": 1055, "end_pos": 1055, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O14980", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14980" }, { "database": "PubMed", "id": "15302935", "url": "https://glygen.org/publication/PubMed/15302935" }, { "database": "phospho.ELM", "id": "O14980", "url": "http://phospho.elm.eu.org/byAccession/O14980.html" }, { "database": "PubMed", "id": "33017560", "url": "https://glygen.org/publication/PubMed/33017560" } ], "site_lbl": "Ser1055" }, { "start_pos": 387, "end_pos": 387, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O14980", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14980" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser387" }, { "start_pos": 389, "end_pos": 389, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O14980", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14980" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" } ], "site_lbl": "Ser389" }, { "start_pos": 391, "end_pos": 391, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O14980", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14980" }, { "database": "PubMed", "id": "17322306", "url": "https://glygen.org/publication/PubMed/17322306" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "phospho.ELM", "id": "O14980", "url": "http://phospho.elm.eu.org/byAccession/O14980.html" }, { "database": "PubMed", "id": "23729730", "url": "https://glygen.org/publication/PubMed/23729730" } ], "site_lbl": "Ser391" }, { "start_pos": 395, "end_pos": 395, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O14980", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14980" }, { "database": "PubMed", "id": "17322306", "url": "https://glygen.org/publication/PubMed/17322306" } ], "site_lbl": "Ser395" }, { "start_pos": 397, "end_pos": 397, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O14980", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14980" }, { "database": "PubMed", "id": "17525332", "url": "https://glygen.org/publication/PubMed/17525332" }, { "database": "phospho.ELM", "id": "O14980", "url": "http://phospho.elm.eu.org/byAccession/O14980.html" } ], "site_lbl": "Ser397" }, { "start_pos": 448, "end_pos": 448, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "site_lbl": "Thr448" }, { "start_pos": 450, "end_pos": 450, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "site_lbl": "Ser450" }, { "start_pos": 454, "end_pos": 454, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "Phosphotyrosine", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "site_lbl": "Tyr454" }, { "start_pos": 65, "end_pos": 65, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O14980", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14980" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Thr65" }, { "start_pos": 764, "end_pos": 764, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O14980", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14980" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser764" }, { "start_pos": 78, "end_pos": 78, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O14980", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14980" }, { "database": "PubMed", "id": "31440228", "url": "" } ], "site_lbl": "Tyr78" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Akt promotes cell survival by phosphorylating and inhibiting a Forkhead transcription factor.", "journal": "Cell", "date": "1999", "authors": "Brunet A, Bonni A, Zigmond MJ, Lin MZ, Juo P, Hu LS, Anderson MJ, Arden KC, Blenis J, Greenberg ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "10102273", "url": "https://glygen.org/publication/PubMed/10102273" } ] }, { "title": "CRM1-mediated recycling of snurportin 1 to the cytoplasm.", "journal": "J. Cell Biol.", "date": "1999", "authors": "Paraskeva E, Izaurralde E, Bischoff FR, Huber J, Kutay U, Hartmann E, Luhrmann R, Gorlich D", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "reference": [ { "type": "PubMed", "id": "10209022", "url": "https://glygen.org/publication/PubMed/10209022" } ] }, { "title": "Non-transcriptional action of oestradiol and progestin triggers DNA synthesis.", "journal": "The EMBO journal", "date": "1999", "authors": "Castoria G, Barone MV, Di Domenico M, Bilancio A, Ametrano D, Migliaccio A, Auricchio F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "10228164", "url": "https://glygen.org/publication/PubMed/10228164" } ] }, { "title": "A new nucleoporin-like protein interacts with both HIV-1 Rev nuclear export signal and CRM-1.", "journal": "J. Biol. Chem.", "date": "1999", "authors": "Farjot G, Sergeant A, Mikaelian I", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "reference": [ { "type": "PubMed", "id": "10358091", "url": "https://glygen.org/publication/PubMed/10358091" } ] }, { "title": "Kinetics of hemin distribution in plasma reveals its role in lipoprotein oxidation.", "journal": "Biochimica et biophysica acta", "date": "1999", "authors": "Miller YI, Shaklai N", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616" } ], "reference": [ { "type": "PubMed", "id": "10381560", "url": "https://glygen.org/publication/PubMed/10381560" } ] }, { "title": "Ran-independent nuclear import of cyclin B1-Cdc2 by importin beta.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Takizawa CG, Weis K, Morgan DO", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "10393926", "url": "https://glygen.org/publication/PubMed/10393926" } ] }, { "title": "Translocation of cyclin B1 to the nucleus at prophase requires a phosphorylation-dependent nuclear import signal.", "journal": "Current biology : CB", "date": "1999", "authors": "Hagting A, Jackman M, Simpson K, Pines J", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "10395539", "url": "https://glygen.org/publication/PubMed/10395539" } ] }, { "title": "Association with the cellular export receptor CRM 1 mediates function and intracellular localization of Epstein-Barr virus SM protein, a regulator of gene expression.", "journal": "J. Virol.", "date": "1999", "authors": "Boyle S M, Ruvolo V, Gupta A K, Swaminathan S", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "reference": [ { "type": "PubMed", "id": "10400785", "url": "https://glygen.org/publication/PubMed/10400785" } ] }, { "title": "Identification of a vertebrate sister-chromatid separation inhibitor involved in transformation and tumorigenesis.", "journal": "Science (New York, N.Y.)", "date": "1999", "authors": "Zou H, McGarry TJ, Bernal T, Kirschner MW", "evidence": [ { "database": "Reactome", "id": "R-HSA-2467813", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2467813" } ], "reference": [ { "type": "PubMed", "id": "10411507", "url": "https://glygen.org/publication/PubMed/10411507" } ] }, { "title": "Leptomycin B inactivates CRM1/exportin 1 by covalent modification at a cysteine residue in the central conserved region.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "1999", "authors": "Kudo N, Matsumori N, Taoka H, Fujiwara D, Schreiner E P, Wolff B, Yoshida M, Horinouchi S", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "reference": [ { "type": "PubMed", "id": "10430904", "url": "https://glygen.org/publication/PubMed/10430904" } ] }, { "title": "p21-activated protein kinase: a crucial component of morphological signaling?", "journal": "Trends in biochemical sciences", "date": "1999", "authors": "Daniels RH, Bokoch GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "10470034", "url": "https://glygen.org/publication/PubMed/10470034" } ] }, { "title": "Silencing of TGF-beta signalling by the pseudoreceptor BAMBI.", "journal": "Nature", "date": "1999", "authors": "Onichtchouk D, Chen YG, Dosch R, Gawantka V, Delius H, Massague J, Niehrs C", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173788", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173788" } ], "reference": [ { "type": "PubMed", "id": "10519551", "url": "https://glygen.org/publication/PubMed/10519551" } ] }, { "title": "Mechanisms of transcriptional activation of bcl-2 gene expression by 17beta-estradiol in breast cancer cells.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Dong L, Wang W, Wang F, Stoner M, Reed JC, Harigai M, Samudio I, Kladde MP, Vyhlidal C, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "10542244", "url": "https://glygen.org/publication/PubMed/10542244" } ] }, { "title": "Regulation of Wnt signaling by Sox proteins: XSox17 alpha/beta and XSox3 physically interact with beta-catenin.", "journal": "Molecular cell", "date": "1999", "authors": "Zorn AM, Barish GD, Williams BO, Lavender P, Klymkowsky MW, Varmus HE", "evidence": [ { "database": "Reactome", "id": "R-HSA-3769402", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3769402" } ], "reference": [ { "type": "PubMed", "id": "10549281", "url": "https://glygen.org/publication/PubMed/10549281" } ] }, { "title": "Purification of porcine brain protein phosphatase 2A leucine carboxyl methyltransferase and cloning of the human homologue.", "journal": "Biochemistry", "date": "1999", "authors": "De Baere I, Derua R, Janssens V, Van Hoof C, Waelkens E, Merlevede W, Goris J", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "10600115", "url": "https://glygen.org/publication/PubMed/10600115" } ] }, { "title": "X-ray structure determination of human profilin II: A comparative structural analysis of human profilins.", "journal": "Journal of molecular biology", "date": "1999", "authors": "Nodelman IM, Bowman GD, Lindberg U, Schutt CE", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "10600384", "url": "https://glygen.org/publication/PubMed/10600384" } ] }, { "title": "Diaphanous-related formins bridge Rho GTPase and Src tyrosine kinase signaling.", "journal": "Molecular cell", "date": "2000", "authors": "Tominaga T, Sahai E, Chardin P, McCormick F, Courtneidge SA, Alberts AS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "10678165", "url": "https://glygen.org/publication/PubMed/10678165" } ] }, { "title": "STRAP and Smad7 synergize in the inhibition of transforming growth factor beta signaling.", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Datta PK, Moses HL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173788", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173788" } ], "reference": [ { "type": "PubMed", "id": "10757800", "url": "https://glygen.org/publication/PubMed/10757800" } ] }, { "title": "Rapid destruction of human Cdc25A in response to DNA damage.", "journal": "Science (New York, N.Y.)", "date": "2000", "authors": "Mailand N, Falck J, Lukas C, Syljuasen RG, Welcker M, Bartek J, Lukas J", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "10827953", "url": "https://glygen.org/publication/PubMed/10827953" } ] }, { "title": "Phosphorylation at serine 10, a major phosphorylation site of p27(Kip1), increases its protein stability.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Ishida N, Kitagawa M, Hatakeyama S, Nakayama K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "10831586", "url": "https://glygen.org/publication/PubMed/10831586" } ] }, { "title": "Inhibition of Wnt signaling by ICAT, a novel beta-catenin-interacting protein.", "journal": "Genes & development", "date": "2000", "authors": "Tago K, Nakamura T, Nishita M, Hyodo J, Nagai S, Murata Y, Adachi S, Ohwada S, Morishita Y, Shibuya H, Akiyama T", "evidence": [ { "database": "Reactome", "id": "R-HSA-3769402", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3769402" } ], "reference": [ { "type": "PubMed", "id": "10898789", "url": "https://glygen.org/publication/PubMed/10898789" } ] }, { "title": "A novel beta-catenin-binding protein inhibits beta-catenin-dependent Tcf activation and axis formation.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Sakamoto I, Kishida S, Fukui A, Kishida M, Yamamoto H, Hino S, Michiue T, Takada S, Asashima M, Kikuchi A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3769402", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3769402" } ], "reference": [ { "type": "PubMed", "id": "10921920", "url": "https://glygen.org/publication/PubMed/10921920" } ] }, { "title": "Inhibition of Wnt signaling pathway by a novel axin-binding protein.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Kadoya T, Kishida S, Fukui A, Hinoi T, Michiue T, Asashima M, Kikuchi A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3769402", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3769402" } ], "reference": [ { "type": "PubMed", "id": "10944533", "url": "https://glygen.org/publication/PubMed/10944533" } ] }, { "title": "FRL, a novel formin-related protein, binds to Rac and regulates cell motility and survival of macrophages.", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Yayoshi-Yamamoto S, Taniuchi I, Watanabe T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "10958683", "url": "https://glygen.org/publication/PubMed/10958683" } ] }, { "title": "Structure of PAK1 in an autoinhibited conformation reveals a multistage activation switch.", "journal": "Cell", "date": "2000", "authors": "Lei M, Lu W, Meng W, Parrini MC, Eck MJ, Mayer BJ, Harrison SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "10975528", "url": "https://glygen.org/publication/PubMed/10975528" } ] }, { "title": "Protein ligands to HuR modulate its interaction with target mRNAs in vivo.", "journal": "The Journal of cell biology", "date": "2000", "authors": "Brennan CM, Gallouzi IE, Steitz JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-450520", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-450520" } ], "reference": [ { "type": "PubMed", "id": "11018049", "url": "https://glygen.org/publication/PubMed/11018049" } ] }, { "title": "Control of mitosis by changes in the subcellular location of cyclin-B1-Cdk1 and Cdc25C.", "journal": "Current opinion in cell biology", "date": "2000", "authors": "Takizawa CG, Morgan DO", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "11063929", "url": "https://glygen.org/publication/PubMed/11063929" } ] }, { "title": "Two distinct pathways remove mammalian cohesin from chromosome arms in prophase and from centromeres in anaphase.", "journal": "Cell", "date": "2000", "authors": "Waizenegger IC, Hauf S, Meinke A, Peters JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2467813", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2467813" } ], "reference": [ { "type": "PubMed", "id": "11081627", "url": "https://glygen.org/publication/PubMed/11081627" } ] }, { "title": "Influenza A virus NS2 protein mediates vRNP nuclear export through NES-independent interaction with hCRM1.", "journal": "The EMBO journal", "date": "2000", "authors": "Neumann G, Hughes MT, Kawaoka Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-168333", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168333" } ], "reference": [ { "type": "PubMed", "id": "11118210", "url": "https://glygen.org/publication/PubMed/11118210" } ] }, { "title": "Interaction of the influenza virus nucleoprotein with the cellular CRM1-mediated nuclear export pathway.", "journal": "J. Virol.", "date": "2001", "authors": "Elton D, Simpson-Holley M, Archer K, Medcalf L, Hallam R, McCauley J, Digard P", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "reference": [ { "type": "PubMed", "id": "11119609", "url": "https://glygen.org/publication/PubMed/11119609" } ] }, { "title": "A role for the basic patch and the C terminus of RanGTP in regulating the dynamic interactions with importin beta, CRM1 and RanBP1.", "journal": "Journal of molecular biology", "date": "2001", "authors": "Nilsson J, Askjaer P, Kjems J", "evidence": [ { "database": "Reactome", "id": "R-HSA-168333", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168333" } ], "reference": [ { "type": "PubMed", "id": "11124902", "url": "https://glygen.org/publication/PubMed/11124902" } ] }, { "title": "Estrogen receptor-mediated activation of the serum response element in MCF-7 cells through MAPK-dependent phosphorylation of Elk-1.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Duan R, Xie W, Burghardt RC, Safe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "11145955", "url": "https://glygen.org/publication/PubMed/11145955" } ] }, { "title": "Regulation of Smad degradation and activity by Smurf2, an E3 ubiquitin ligase.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "Zhang Y, Chang C, Gehling DJ, Hemmati-Brivanlou A, Derynck R", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173788", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173788" } ], "reference": [ { "type": "PubMed", "id": "11158580", "url": "https://glygen.org/publication/PubMed/11158580" } ] }, { "title": "Smad7 binds to Smurf2 to form an E3 ubiquitin ligase that targets the TGF beta receptor for degradation.", "journal": "Molecular cell", "date": "2000", "authors": "Kavsak P, Rasmussen RK, Causing CG, Bonni S, Zhu H, Thomsen GH, Wrana JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173788", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173788" } ], "reference": [ { "type": "PubMed", "id": "11163210", "url": "https://glygen.org/publication/PubMed/11163210" } ] }, { "title": "Mitotic checkpoint proteins HsMAD1 and HsMAD2 are associated with nuclear pore complexes in interphase.", "journal": "Journal of cell science", "date": "2001", "authors": "Campbell MS, Chan GK, Yen TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-141444", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-141444" } ], "reference": [ { "type": "PubMed", "id": "11181178", "url": "https://glygen.org/publication/PubMed/11181178" } ] }, { "title": "Influenza virus propagation is impaired by inhibition of the Raf/MEK/ERK signalling cascade.", "journal": "Nature cell biology", "date": "2001", "authors": "Pleschka S, Wolff T, Ehrhardt C, Hobom G, Planz O, Rapp UR, Ludwig S", "evidence": [ { "database": "Reactome", "id": "R-HSA-168333", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168333" } ], "reference": [ { "type": "PubMed", "id": "11231581", "url": "https://glygen.org/publication/PubMed/11231581" } ] }, { "title": "The localization of human cyclins B1 and B2 determines CDK1 substrate specificity and neither enzyme requires MEK to disassemble the Golgi apparatus.", "journal": "The Journal of cell biology", "date": "2001", "authors": "Draviam VM, Orrechia S, Lowe M, Pardi R, Pines J", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "11238451", "url": "https://glygen.org/publication/PubMed/11238451" } ] }, { "title": "Reduction in cyclin D1/Cdk4/retinoblastoma protein signaling by CRE-decoy oligonucleotide.", "journal": "Biochemical and biophysical research communications", "date": "2001", "authors": "Park YG, Park S, Lim SO, Lee MS, Ryu CK, Kim I, Cho-Chung YS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "11243864", "url": "https://glygen.org/publication/PubMed/11243864" } ] }, { "title": "Smurf1 interacts with transforming growth factor-beta type I receptor through Smad7 and induces receptor degradation.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Ebisawa T, Fukuchi M, Murakami G, Chiba T, Tanaka K, Imamura T, Miyazono K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173788", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173788" } ], "reference": [ { "type": "PubMed", "id": "11278251", "url": "https://glygen.org/publication/PubMed/11278251" } ] }, { "title": "Nuclear export of influenza virus ribonucleoproteins: identification of an export intermediate at the nuclear periphery.", "journal": "Virology", "date": "2001", "authors": "Ma K, Roy AM, Whittaker GR", "evidence": [ { "database": "Reactome", "id": "R-HSA-168333", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168333" } ], "reference": [ { "type": "PubMed", "id": "11289803", "url": "https://glygen.org/publication/PubMed/11289803" } ] }, { "title": "Localization of human Cdc25C is regulated both by nuclear export and 14-3-3 protein binding.", "journal": "Oncogene", "date": "2001", "authors": "Graves PR, Lovly CM, Uy GL, Piwnica-Worms H", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "11313932", "url": "https://glygen.org/publication/PubMed/11313932" } ] }, { "title": "Securin is required for chromosomal stability in human cells.", "journal": "Cell", "date": "2001", "authors": "Jallepalli PV, Waizenegger IC, Bunz F, Langer S, Speicher MR, Peters JM, Kinzler KW, Vogelstein B, Lengauer C", "evidence": [ { "database": "Reactome", "id": "R-HSA-2467813", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2467813" } ], "reference": [ { "type": "PubMed", "id": "11371342", "url": "https://glygen.org/publication/PubMed/11371342" } ] }, { "title": "Heme mediates derepression of Maf recognition element through direct binding to transcription repressor Bach1.", "journal": "The EMBO journal", "date": "2001", "authors": "Ogawa K, Sun J, Taketani S, Nakajima O, Nishitani C, Sassa S, Hayashi N, Yamamoto M, Shibahara S, Fujita H, Igarashi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616" } ], "reference": [ { "type": "PubMed", "id": "11387216", "url": "https://glygen.org/publication/PubMed/11387216" } ] }, { "title": "Ran-binding protein 3 is a cofactor for Crm1-mediated nuclear protein export.", "journal": "J. Cell Biol.", "date": "2001", "authors": "Lindsay ME, Holaska JM, Welch K, Paschal BM, Macara IG", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "reference": [ { "type": "PubMed", "id": "11425870", "url": "https://glygen.org/publication/PubMed/11425870" } ] }, { "title": "Inhibition of nuclear export of ribonucleoprotein complexes of influenza virus by leptomycin B.", "journal": "Virus research", "date": "2001", "authors": "Watanabe K, Takizawa N, Katoh M, Hoshida K, Kobayashi N, Nagata K", "evidence": [ { "database": "Reactome", "id": "R-HSA-168333", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168333" } ], "reference": [ { "type": "PubMed", "id": "11451485", "url": "https://glygen.org/publication/PubMed/11451485" } ] }, { "title": "Cohesin cleavage by separase required for anaphase and cytokinesis in human cells.", "journal": "Science (New York, N.Y.)", "date": "2001", "authors": "Hauf S, Waizenegger IC, Peters JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2500257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2500257" } ], "reference": [ { "type": "PubMed", "id": "11509732", "url": "https://glygen.org/publication/PubMed/11509732" } ] }, { "title": "Checkpoint inhibition of the APC/C in HeLa cells is mediated by a complex of BUBR1, BUB3, CDC20, and MAD2.", "journal": "The Journal of cell biology", "date": "2001", "authors": "Sudakin V, Chan GK, Yen TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-141430", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-141430" } ], "reference": [ { "type": "PubMed", "id": "11535616", "url": "https://glygen.org/publication/PubMed/11535616" } ] }, { "title": "RanBP3 influences interactions between CRM1 and its nuclear protein export substrates.", "journal": "EMBO Rep.", "date": "2001", "authors": "Englmeier L, Fornerod M, Bischoff FR, Petosa C, Mattaj IW, Kutay U", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "reference": [ { "type": "PubMed", "id": "11571268", "url": "https://glygen.org/publication/PubMed/11571268" } ] }, { "title": "Borg proteins control septin organization and are negatively regulated by Cdc42.", "journal": "Nature cell biology", "date": "2001", "authors": "Joberty G, Perlungher RR, Sheffield PJ, Kinoshita M, Noda M, Haystead T, Macara IG", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "11584266", "url": "https://glygen.org/publication/PubMed/11584266" } ] }, { "title": "PI3-kinase in concert with Src promotes the S-phase entry of oestradiol-stimulated MCF-7 cells.", "journal": "The EMBO journal", "date": "2001", "authors": "Castoria G, Migliaccio A, Bilancio A, Di Domenico M, de Falco A, Lombardi M, Fiorentino R, Varricchio L, Barone MV, Auricchio F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "11689445", "url": "https://glygen.org/publication/PubMed/11689445" } ] }, { "title": "SOX7 transcription factor: sequence, chromosomal localisation, expression, transactivation and interference with Wnt signalling.", "journal": "Nucleic acids research", "date": "2001", "authors": "Takash W, Canizares J, Bonneaud N, Poulat F, Mattei MG, Jay P, Berta P", "evidence": [ { "database": "Reactome", "id": "R-HSA-3769402", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3769402" } ], "reference": [ { "type": "PubMed", "id": "11691915", "url": "https://glygen.org/publication/PubMed/11691915" } ] }, { "title": "p27 cytoplasmic localization is regulated by phosphorylation on Ser10 and is not a prerequisite for its proteolysis.", "journal": "The EMBO journal", "date": "2001", "authors": "Rodier G, Montagnoli A, Di Marcotullio L, Coulombe P, Draetta GF, Pagano M, Meloche S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "11726503", "url": "https://glygen.org/publication/PubMed/11726503" } ] }, { "title": "The Mad2 spindle checkpoint protein undergoes similar major conformational changes upon binding to either Mad1 or Cdc20.", "journal": "Molecular cell", "date": "2002", "authors": "Luo X, Tang Z, Rizo J, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-141444", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-141444" } ], "reference": [ { "type": "PubMed", "id": "11804586", "url": "https://glygen.org/publication/PubMed/11804586" } ] }, { "title": "Pak1 kinase homodimers are autoinhibited in trans and dissociated upon activation by Cdc42 and Rac1.", "journal": "Molecular cell", "date": "2002", "authors": "Parrini MC, Lei M, Harrison SC, Mayer BJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "11804587", "url": "https://glygen.org/publication/PubMed/11804587" } ] }, { "title": "A 40-bp RNA element that mediates stabilization of vascular endothelial growth factor mRNA by HuR.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Goldberg-Cohen I, Furneauxb H, Levy AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-450520", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-450520" } ], "reference": [ { "type": "PubMed", "id": "11834731", "url": "https://glygen.org/publication/PubMed/11834731" } ] }, { "title": "Recruitment of the Crm1 nuclear export factor is sufficient to induce cytoplasmic expression of incompletely spliced human immunodeficiency virus mRNAs.", "journal": "Journal of virology", "date": "2002", "authors": "Yi R, Bogerd HP, Cullen BR", "evidence": [ { "database": "Reactome", "id": "R-HSA-165054", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-165054" } ], "reference": [ { "type": "PubMed", "id": "11836381", "url": "https://glygen.org/publication/PubMed/11836381" } ] }, { "title": "Expression of FKHR, FKHRL1, and AFX genes in the rodent ovary: evidence for regulation by IGF-I, estrogen, and the gonadotropins.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2002", "authors": "Richards JS, Sharma SC, Falender AE, Lo YH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "11875118", "url": "https://glygen.org/publication/PubMed/11875118" } ] }, { "title": "Phosphorylation of p27Kip1 on serine 10 is required for its binding to CRM1 and nuclear export.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Ishida N, Hara T, Kamura T, Yoshida M, Nakayama K, Nakayama KI", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "11889117", "url": "https://glygen.org/publication/PubMed/11889117" } ] }, { "title": "Plk1 promotes nuclear translocation of human Cdc25C during prophase.", "journal": "EMBO reports", "date": "2002", "authors": "Toyoshima-Morimoto F, Taniguchi E, Nishida E", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "11897663", "url": "https://glygen.org/publication/PubMed/11897663" } ] }, { "title": "Ran-binding protein 3 links Crm1 to the Ran guanine nucleotide exchange factor.", "journal": "J. Biol. Chem.", "date": "2002", "authors": "Nemergut ME, Lindsay ME, Brownawell AM, Macara IG", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" }, { "database": "Reactome", "id": "R-HSA-168333", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168333" } ], "reference": [ { "type": "PubMed", "id": "11932251", "url": "https://glygen.org/publication/PubMed/11932251" } ] }, { "title": "AP-1 as a regulator of cell life and death.", "journal": "Nature cell biology", "date": "2002", "authors": "Shaulian E, Karin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "11988758", "url": "https://glygen.org/publication/PubMed/11988758" } ] }, { "title": "Crystal structure of the tetrameric Mad1-Mad2 core complex: implications of a 'safety belt' binding mechanism for the spindle checkpoint.", "journal": "The EMBO journal", "date": "2002", "authors": "Sironi L, Mapelli M, Knapp S, De Antoni A, Jeang KT, Musacchio A", "evidence": [ { "database": "Reactome", "id": "R-HSA-141430", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-141430" } ], "reference": [ { "type": "PubMed", "id": "12006501", "url": "https://glygen.org/publication/PubMed/12006501" } ] }, { "title": "Estrogen alters thresholds for B cell apoptosis and activation.", "journal": "The Journal of clinical investigation", "date": "2002", "authors": "Grimaldi CM, Cleary J, Dagtas AS, Moussai D, Diamond B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "12070310", "url": "https://glygen.org/publication/PubMed/12070310" } ] }, { "title": "A growth factor-dependent nuclear kinase phosphorylates p27(Kip1) and regulates cell cycle progression.", "journal": "The EMBO journal", "date": "2002", "authors": "Boehm M, Yoshimoto T, Crook MF, Nallamshetty S, True A, Nabel GJ, Nabel EG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "12093740", "url": "https://glygen.org/publication/PubMed/12093740" } ] }, { "title": "Pro-oxidant and cytotoxic effects of circulating heme.", "journal": "Blood", "date": "2002", "authors": "Jeney V, Balla J, Yachie A, Varga Z, Vercellotti GM, Eaton JW, Balla G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616" } ], "reference": [ { "type": "PubMed", "id": "12130498", "url": "https://glygen.org/publication/PubMed/12130498" } ] }, { "title": "The carboxy-terminal region of the human immunodeficiency virus type 1 protein Rev has multiple roles in mediating CRM1-related Rev functions.", "journal": "J. Virol.", "date": "2002", "authors": "Hakata Yoshiyuki, Yamada Masami, Mabuchi Naoto, Shida Hisatoshi", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "reference": [ { "type": "PubMed", "id": "12134013", "url": "https://glygen.org/publication/PubMed/12134013" } ] }, { "title": "Smurf1 regulates the inhibitory activity of Smad7 by targeting Smad7 to the plasma membrane.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Suzuki C, Murakami G, Fukuchi M, Shimanuki T, Shikauchi Y, Imamura T, Miyazono K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173788", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173788" } ], "reference": [ { "type": "PubMed", "id": "12151385", "url": "https://glygen.org/publication/PubMed/12151385" } ] }, { "title": "Regulation of human separase by securin binding and autocleavage.", "journal": "Current biology : CB", "date": "2002", "authors": "Waizenegger I, Gimenez-Abian JF, Wernic D, Peters JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2467813", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2467813" } ], "reference": [ { "type": "PubMed", "id": "12194817", "url": "https://glygen.org/publication/PubMed/12194817" } ] }, { "title": "Hemoprotein Bach1 regulates enhancer availability of heme oxygenase-1 gene.", "journal": "The EMBO journal", "date": "2002", "authors": "Sun J, Hoshino H, Takaku K, Nakajima O, Muto A, Suzuki H, Tashiro S, Takahashi S, Shibahara S, Alam J, Taketo MM, Yamamoto M, Igarashi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616" } ], "reference": [ { "type": "PubMed", "id": "12356737", "url": "https://glygen.org/publication/PubMed/12356737" } ] }, { "title": "The crystal structure of the beta-catenin/ICAT complex reveals the inhibitory mechanism of ICAT.", "journal": "Molecular cell", "date": "2002", "authors": "Graham TA, Clements WK, Kimelman D, Xu W", "evidence": [ { "database": "Reactome", "id": "R-HSA-3769402", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3769402" } ], "reference": [ { "type": "PubMed", "id": "12408824", "url": "https://glygen.org/publication/PubMed/12408824" } ] }, { "title": "ICAT inhibits beta-catenin binding to Tcf/Lef-family transcription factors and the general coactivator p300 using independent structural modules.", "journal": "Molecular cell", "date": "2002", "authors": "Daniels DL, Weis WI", "evidence": [ { "database": "Reactome", "id": "R-HSA-3769402", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3769402" } ], "reference": [ { "type": "PubMed", "id": "12408825", "url": "https://glygen.org/publication/PubMed/12408825" } ] }, { "title": "Regulation of G(2)/M events by Cdc25A through phosphorylation-dependent modulation of its stability.", "journal": "The EMBO journal", "date": "2002", "authors": "Mailand N, Podtelejnikov AV, Groth A, Mann M, Bartek J, Lukas J", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "12411508", "url": "https://glygen.org/publication/PubMed/12411508" } ] }, { "title": "The diaphanous-related formin mDia1 controls serum response factor activity through its effects on actin polymerization.", "journal": "Molecular biology of the cell", "date": "2002", "authors": "Copeland JW, Treisman R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "12429848", "url": "https://glygen.org/publication/PubMed/12429848" } ] }, { "title": "Bach1 functions as a hypoxia-inducible repressor for the heme oxygenase-1 gene in human cells.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Kitamuro T, Takahashi K, Ogawa K, Udono-Fujimori R, Takeda K, Furuyama K, Nakayama M, Sun J, Fujita H, Hida W, Hattori T, Shirato K, Igarashi K, Shibahara S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616" } ], "reference": [ { "type": "PubMed", "id": "12511571", "url": "https://glygen.org/publication/PubMed/12511571" } ] }, { "title": "Chromosomal region maintenance 1 (CRM1)-dependent nuclear export of Smad ubiquitin regulatory factor 1 (Smurf1) is essential for negative regulation of transforming growth factor-beta signaling by Smad7.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Tajima Y, Goto K, Yoshida M, Shinomiya K, Sekimoto T, Yoneda Y, Miyazono K, Imamura T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173788", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173788" } ], "reference": [ { "type": "PubMed", "id": "12519765", "url": "https://glygen.org/publication/PubMed/12519765" } ] }, { "title": "Rapid induction of dendritic spine morphogenesis by trans-synaptic ephrinB-EphB receptor activation of the Rho-GEF kalirin.", "journal": "Neuron", "date": "2003", "authors": "Penzes P, Beeser A, Chernoff J, Schiller MR, Eipper BA, Mains RE, Huganir RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "12546821", "url": "https://glygen.org/publication/PubMed/12546821" } ] }, { "title": "RhoD regulates endosome dynamics through Diaphanous-related Formin and Src tyrosine kinase.", "journal": "Nature cell biology", "date": "2003", "authors": "Gasman S, Kalaidzidis Y, Zerial M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "12577064", "url": "https://glygen.org/publication/PubMed/12577064" } ] }, { "title": "Role for NudC, a dynein-associated nuclear movement protein, in mitosis and cytokinesis.", "journal": "Journal of cell science", "date": "2003", "authors": "Aumais JP, Williams SN, Luo W, Nishino M, Caldwell KA, Caldwell GA, Lin SH, Yu-Lee LY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648025", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648025" } ], "reference": [ { "type": "PubMed", "id": "12679384", "url": "https://glygen.org/publication/PubMed/12679384" } ] }, { "title": "Chibby, a nuclear beta-catenin-associated antagonist of the Wnt/Wingless pathway.", "journal": "Nature", "date": "2003", "authors": "Takemaru K, Yamaguchi S, Lee YS, Zhang Y, Carthew RW, Moon RT", "evidence": [ { "database": "Reactome", "id": "R-HSA-3769402", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3769402" } ], "reference": [ { "type": "PubMed", "id": "12712206", "url": "https://glygen.org/publication/PubMed/12712206" } ] }, { "title": "Biogenesis and nuclear export of ribosomal subunits in higher eukaryotes depend on the CRM1 export pathway.", "journal": "J. Cell Sci.", "date": "2003", "authors": "Thomas F, Kutay U", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "reference": [ { "type": "PubMed", "id": "12724356", "url": "https://glygen.org/publication/PubMed/12724356" } ] }, { "title": "Actin dynamics control SRF activity by regulation of its coactivator MAL.", "journal": "Cell", "date": "2003", "authors": "Miralles F, Posern G, Zaromytidou AI, Treisman R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "12732141", "url": "https://glygen.org/publication/PubMed/12732141" } ] }, { "title": "The RRASK motif in Xenopus cyclin B2 is required for the substrate recognition of Cdc25C by the cyclin B-Cdc2 complex.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Goda T, Ishii T, Nakajo N, Sagata N, Kobayashi H", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "12754270", "url": "https://glygen.org/publication/PubMed/12754270" } ] }, { "title": "A role for VASP in RhoA-Diaphanous signalling to actin dynamics and SRF activity.", "journal": "The EMBO journal", "date": "2003", "authors": "Grosse R, Copeland JW, Newsome TP, Way M, Treisman R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "12805219", "url": "https://glygen.org/publication/PubMed/12805219" } ] }, { "title": "Rapid turnover of extracellular signal-regulated kinase 3 by the ubiquitin-proteasome pathway defines a novel paradigm of mitogen-activated protein kinase regulation during cellular differentiation.", "journal": "Molecular and cellular biology", "date": "2003", "authors": "Coulombe P, Rodier G, Pelletier S, Pellerin J, Meloche S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "12808096", "url": "https://glygen.org/publication/PubMed/12808096" } ] }, { "title": "Hydrogen peroxide triggers nuclear export of telomerase reverse transcriptase via Src kinase family-dependent phosphorylation of tyrosine 707.", "journal": "Mol. Cell. Biol.", "date": "2003", "authors": "Haendeler J, Hoffmann J, Brandes RP, Zeiher AM, Dimmeler S", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "reference": [ { "type": "PubMed", "id": "12808100", "url": "https://glygen.org/publication/PubMed/12808100" } ] }, { "title": "The cell cycle: a review of regulation, deregulation and therapeutic targets in cancer.", "journal": "Cell proliferation", "date": "2003", "authors": "Vermeulen K, Van Bockstaele DR, Berneman ZN", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "12814430", "url": "https://glygen.org/publication/PubMed/12814430" } ] }, { "title": "A role for Plk1 phosphorylation of NudC in cytokinesis.", "journal": "Developmental cell", "date": "2003", "authors": "Zhou T, Aumais JP, Liu X, Yu-Lee LY, Erikson RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648025", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648025" } ], "reference": [ { "type": "PubMed", "id": "12852857", "url": "https://glygen.org/publication/PubMed/12852857" } ] }, { "title": "Estrogens down-regulate p27Kip1 in breast cancer cells through Skp2 and through nuclear export mediated by the ERK pathway.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Foster JS, Fernando RI, Ishida N, Nakayama KI, Wimalasena J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "12904306", "url": "https://glygen.org/publication/PubMed/12904306" } ] }, { "title": "Nuclear export of ERK3 by a CRM1-dependent mechanism regulates its inhibitory action on cell cycle progression.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Julien C, Coulombe P, Meloche S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "12915405", "url": "https://glygen.org/publication/PubMed/12915405" } ] }, { "title": "Inactivation of the p34cdc2-cyclin B complex by the human WEE1 tyrosine kinase.", "journal": "Science (New York, N.Y.)", "date": "1992", "authors": "Parker LL, Piwnica-Worms H", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "1384126", "url": "https://glygen.org/publication/PubMed/1384126" } ] }, { "title": "Crystal structure of a beta-catenin/axin complex suggests a mechanism for the beta-catenin destruction complex.", "journal": "Genes & development", "date": "2003", "authors": "Xing Y, Clements WK, Kimelman D, Xu W", "evidence": [ { "database": "Reactome", "id": "R-HSA-3769402", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3769402" } ], "reference": [ { "type": "PubMed", "id": "14600025", "url": "https://glygen.org/publication/PubMed/14600025" } ] }, { "title": "A multifunctional domain in human CRM1 (exportin 1) mediates RanBP3 binding and multimerization of human T-cell leukemia virus type 1 Rex protein.", "journal": "Molecular and cellular biology", "date": "2003", "authors": "Hakata Y, Yamada M, Shida H", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "reference": [ { "type": "PubMed", "id": "14612415", "url": "https://glygen.org/publication/PubMed/14612415" } ] }, { "title": "17beta-estradiol inhibits oxidative stress-induced apoptosis in keratinocytes by promoting Bcl-2 expression.", "journal": "The Journal of investigative dermatology", "date": "2003", "authors": "Kanda N, Watanabe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "14675202", "url": "https://glygen.org/publication/PubMed/14675202" } ] }, { "title": "A novel role for XIAP in copper homeostasis through regulation of MURR1.", "journal": "The EMBO journal", "date": "2004", "authors": "Burstein E, Ganesh L, Dick RD, van De Sluis B, Wilkinson JC, Klomp LW, Wijmenga C, Brewer GJ, Nabel GJ, Duckett CS", "evidence": [ { "database": "Reactome", "id": "R-HSA-3769402", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3769402" } ], "reference": [ { "type": "PubMed", "id": "14685266", "url": "https://glygen.org/publication/PubMed/14685266" } ] }, { "title": "Identification of a novel basic helix-loop-helix-PAS factor, NXF, reveals a Sim2 competitive, positive regulatory role in dendritic-cytoskeleton modulator drebrin gene expression.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Ooe N, Saito K, Mikami N, Nakatuka I, Kaneko H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9768919", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9768919" } ], "reference": [ { "type": "PubMed", "id": "14701734", "url": "https://glygen.org/publication/PubMed/14701734" } ] }, { "title": "CHIP mediates degradation of Smad proteins and potentially regulates Smad-induced transcription.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Li L, Xin H, Xu X, Huang M, Zhang X, Chen Y, Zhang S, Fu XY, Chang Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173788", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173788" } ], "reference": [ { "type": "PubMed", "id": "14701756", "url": "https://glygen.org/publication/PubMed/14701756" } ] }, { "title": "GADD34-PP1c recruited by Smad7 dephosphorylates TGFbeta type I receptor.", "journal": "The Journal of cell biology", "date": "2004", "authors": "Shi W, Sun C, He B, Xiong W, Shi X, Yao D, Cao X", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173788", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173788" } ], "reference": [ { "type": "PubMed", "id": "14718519", "url": "https://glygen.org/publication/PubMed/14718519" } ] }, { "title": "The conserved kinetochore protein shugoshin protects centromeric cohesion during meiosis.", "journal": "Nature", "date": "2004", "authors": "Kitajima TS, Kawashima SA, Watanabe Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-2500257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2500257" } ], "reference": [ { "type": "PubMed", "id": "14730319", "url": "https://glygen.org/publication/PubMed/14730319" } ] }, { "title": "Identification of a target RNA motif for RNA-binding protein HuR.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Lopez de Silanes I, Zhan M, Lal A, Yang X, Gorospe M", "evidence": [ { "database": "Reactome", "id": "R-HSA-450520", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-450520" } ], "reference": [ { "type": "PubMed", "id": "14981256", "url": "https://glygen.org/publication/PubMed/14981256" } ] }, { "title": "Crystal structures of a Formin Homology-2 domain reveal a tethered dimer architecture.", "journal": "Cell", "date": "2004", "authors": "Xu Y, Moseley JB, Sagot I, Poy F, Pellman D, Goode BL, Eck MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "15006353", "url": "https://glygen.org/publication/PubMed/15006353" } ] }, { "title": "Forkhead box M1B transcriptional activity requires binding of Cdk-cyclin complexes for phosphorylation-dependent recruitment of p300/CBP coactivators.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Major ML, Lepe R, Costa RH", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "15024056", "url": "https://glygen.org/publication/PubMed/15024056" } ] }, { "title": "Cdc42 and mDia3 regulate microtubule attachment to kinetochores.", "journal": "Nature", "date": "2004", "authors": "Yasuda S, Oceguera-Yanez F, Kato T, Okamoto M, Yonemura S, Terada Y, Ishizaki T, Narumiya S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "15085137", "url": "https://glygen.org/publication/PubMed/15085137" } ] }, { "title": "The G protein-coupled receptor GPR30 mediates c-fos up-regulation by 17beta-estradiol and phytoestrogens in breast cancer cells.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Maggiolini M, Vivacqua A, Fasanella G, Recchia AG, Sisci D, Pezzi V, Montanaro D, Musti AM, Picard D, Ando S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "15090535", "url": "https://glygen.org/publication/PubMed/15090535" } ] }, { "title": "Interactions between Sox9 and beta-catenin control chondrocyte differentiation.", "journal": "Genes & development", "date": "2004", "authors": "Akiyama H, Lyons JP, Mori-Akiyama Y, Yang X, Zhang R, Zhang Z, Deng JM, Taketo MM, Nakamura T, Behringer RR, McCrea PD, de Crombrugghe B", "evidence": [ { "database": "Reactome", "id": "R-HSA-3769402", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3769402" } ], "reference": [ { "type": "PubMed", "id": "15132997", "url": "https://glygen.org/publication/PubMed/15132997" } ] }, { "title": "Heme regulates gene expression by triggering Crm1-dependent nuclear export of Bach1.", "journal": "The EMBO journal", "date": "2004", "authors": "Suzuki H, Tashiro S, Hira S, Sun J, Yamazaki C, Zenke Y, Ikeda-Saito M, Yoshida M, Igarashi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616" } ], "reference": [ { "type": "PubMed", "id": "15175654", "url": "https://glygen.org/publication/PubMed/15175654" } ] }, { "title": "N-Terminal ubiquitination of extracellular signal-regulated kinase 3 and p21 directs their degradation by the proteasome.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Coulombe P, Rodier G, Bonneil E, Thibault P, Meloche S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "15226418", "url": "https://glygen.org/publication/PubMed/15226418" } ] }, { "title": "17beta-estradiol stimulates the growth of human keratinocytes by inducing cyclin D2 expression.", "journal": "The Journal of investigative dermatology", "date": "2004", "authors": "Kanda N, Watanabe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "15245432", "url": "https://glygen.org/publication/PubMed/15245432" } ] }, { "title": "Concurrent versus individual binding of HuR and AUF1 to common labile target mRNAs.", "journal": "The EMBO journal", "date": "2004", "authors": "Lal A, Mazan-Mamczarz K, Kawai T, Yang X, Martindale JL, Gorospe M", "evidence": [ { "database": "Reactome", "id": "R-HSA-450520", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-450520" } ], "reference": [ { "type": "PubMed", "id": "15257295", "url": "https://glygen.org/publication/PubMed/15257295" } ] }, { "title": "Large-scale characterization of HeLa cell nuclear phosphoproteins.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Beausoleil SA, Jedrychowski M, Schwartz D, Elias JE, Villen J, Li J, Cohn MA, Cantley LC, Gygi SP", "evidence": [ { "database": "iPTMnet", "id": "O14980", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14980" } ], "reference": [ { "type": "PubMed", "id": "15302935", "url": "https://glygen.org/publication/PubMed/15302935" } ] }, { "title": "Role of atypical protein kinase C in estradiol-triggered G1/S progression of MCF-7 cells.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Castoria G, Migliaccio A, Di Domenico M, Lombardi M, de Falco A, Varricchio L, Bilancio A, Barone MV, Auricchio F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "15314172", "url": "https://glygen.org/publication/PubMed/15314172" } ] }, { "title": "Crystal structure of a beta-catenin/APC complex reveals a critical role for APC phosphorylation in APC function.", "journal": "Molecular cell", "date": "2004", "authors": "Xing Y, Clements WK, Le Trong I, Hinds TR, Stenkamp R, Kimelman D, Xu W", "evidence": [ { "database": "Reactome", "id": "R-HSA-3769402", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3769402" } ], "reference": [ { "type": "PubMed", "id": "15327769", "url": "https://glygen.org/publication/PubMed/15327769" } ] }, { "title": "Vertebrate shugoshin links sister centromere cohesion and kinetochore microtubule stability in mitosis.", "journal": "Cell", "date": "2004", "authors": "Salic A, Waters JC, Mitchison TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2500257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2500257" } ], "reference": [ { "type": "PubMed", "id": "15339662", "url": "https://glygen.org/publication/PubMed/15339662" } ] }, { "title": "Characterisation of Cdc25B localisation and nuclear export during the cell cycle and in response to stress.", "journal": "Journal of cell science", "date": "2004", "authors": "Lindqvist A, Kallstrom H, Karlsson Rosenthal C", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "15456846", "url": "https://glygen.org/publication/PubMed/15456846" } ] }, { "title": "NEDD4-2 (neural precursor cell expressed, developmentally down-regulated 4-2) negatively regulates TGF-beta (transforming growth factor-beta) signalling by inducing ubiquitin-mediated degradation of Smad2 and TGF-beta type I receptor.", "journal": "The Biochemical journal", "date": "2005", "authors": "Kuratomi G, Komuro A, Goto K, Shinozaki M, Miyazawa K, Miyazono K, Imamura T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173788", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173788" } ], "reference": [ { "type": "PubMed", "id": "15496141", "url": "https://glygen.org/publication/PubMed/15496141" } ] }, { "title": "Requirement of DDX3 DEAD box RNA helicase for HIV-1 Rev-RRE export function.", "journal": "Cell", "date": "2004", "authors": "Yedavalli VS, Neuveut C, Chi YH, Kleiman L, Jeang KT", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "reference": [ { "type": "PubMed", "id": "15507209", "url": "https://glygen.org/publication/PubMed/15507209" } ] }, { "title": "Formin is a processive motor that requires profilin to accelerate actin assembly and associated ATP hydrolysis.", "journal": "Cell", "date": "2004", "authors": "Romero S, Le Clainche C, Didry D, Egile C, Pantaloni D, Carlier MF", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "15507212", "url": "https://glygen.org/publication/PubMed/15507212" } ] }, { "title": "The APC tumor suppressor binds to C-terminal binding protein to divert nuclear beta-catenin from TCF.", "journal": "Developmental cell", "date": "2004", "authors": "Hamada F, Bienz M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3769402", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3769402" } ], "reference": [ { "type": "PubMed", "id": "15525529", "url": "https://glygen.org/publication/PubMed/15525529" } ] }, { "title": "Scaffolding by ERK3 regulates MK5 in development.", "journal": "The EMBO journal", "date": "2004", "authors": "Schumacher S, Laass K, Kant S, Shi Y, Visel A, Gruber AD, Kotlyarov A, Gaestel M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "15538386", "url": "https://glygen.org/publication/PubMed/15538386" } ] }, { "title": "AP-1 subunits: quarrel and harmony among siblings.", "journal": "Journal of cell science", "date": "2004", "authors": "Hess J, Angel P, Schorpp-Kistner M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "15564374", "url": "https://glygen.org/publication/PubMed/15564374" } ] }, { "title": "Cdc25A localisation and shuttling: characterisation of sequences mediating nuclear export and import.", "journal": "Experimental cell research", "date": "2005", "authors": "Kallstrom H, Lindqvist A, Pospisil V, Lundgren A, Rosenthal CK", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "15572030", "url": "https://glygen.org/publication/PubMed/15572030" } ] }, { "title": "Architecture of CRM1/Exportin1 suggests how cooperativity is achieved during formation of a nuclear export complex.", "journal": "Molecular cell", "date": "2004", "authors": "Petosa C, Schoehn G, Askjaer P, Bauer U, Moulin M, Steuerwald U, Soler-Lopez M, Baudin F, Mattaj IW, Muller CW", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" }, { "database": "Reactome", "id": "R-HSA-168333", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168333" } ], "reference": [ { "type": "PubMed", "id": "15574331", "url": "https://glygen.org/publication/PubMed/15574331" } ] }, { "title": "PHAX and CRM1 are required sequentially to transport U3 snoRNA to nucleoli.", "journal": "Molecular cell", "date": "2004", "authors": "Boulon S, Verheggen C, Jady BE, Girard C, Pescia C, Paul C, Ospina JK, Kiss T, Matera AG, Bordonne R, Bertrand E", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "reference": [ { "type": "PubMed", "id": "15574332", "url": "https://glygen.org/publication/PubMed/15574332" } ] }, { "title": "Activation of MK5/PRAK by the atypical MAP kinase ERK3 defines a novel signal transduction pathway.", "journal": "The EMBO journal", "date": "2004", "authors": "Seternes OM, Mikalsen T, Johansen B, Michaelsen E, Armstrong CG, Morrice NA, Turgeon B, Meloche S, Moens U, Keyse SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "15577943", "url": "https://glygen.org/publication/PubMed/15577943" } ] }, { "title": "Kinetic and molecular analysis of nuclear export factor CRM1 association with its cargo in vivo.", "journal": "Mol. Cell. Biol.", "date": "2005", "authors": "Daelemans Dirk, Costes Sylvain V, Lockett Stephen, Pavlakis George N", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "reference": [ { "type": "PubMed", "id": "15632073", "url": "https://glygen.org/publication/PubMed/15632073" } ] }, { "title": "Integration of the extranuclear and nuclear actions of estrogen.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2005", "authors": "Levin ER", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "15705661", "url": "https://glygen.org/publication/PubMed/15705661" } ] }, { "title": "Human Bub1 defines the persistent cohesion site along the mitotic chromosome by affecting Shugoshin localization.", "journal": "Current biology : CB", "date": "2005", "authors": "Kitajima TS, Hauf S, Ohsugi M, Yamamoto T, Watanabe Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-2500257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2500257" } ], "reference": [ { "type": "PubMed", "id": "15723797", "url": "https://glygen.org/publication/PubMed/15723797" } ] }, { "title": "Dissociation of cohesin from chromosome arms and loss of arm cohesion during early mitosis depends on phosphorylation of SA2.", "journal": "PLoS biology", "date": "2005", "authors": "Hauf S, Roitinger E, Koch B, Dittrich CM, Mechtler K, Peters JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2500257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2500257" } ], "reference": [ { "type": "PubMed", "id": "15737063", "url": "https://glygen.org/publication/PubMed/15737063" } ] }, { "title": "CHIP controls the sensitivity of transforming growth factor-beta signaling by modulating the basal level of Smad3 through ubiquitin-mediated degradation.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Xin H, Xu X, Li L, Ning H, Rong Y, Shang Y, Wang Y, Fu XY, Chang Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173788", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173788" } ], "reference": [ { "type": "PubMed", "id": "15781469", "url": "https://glygen.org/publication/PubMed/15781469" } ] }, { "title": "Structural and mechanistic insights into the interaction between Rho and mammalian Dia.", "journal": "Nature", "date": "2005", "authors": "Rose R, Weyand M, Lammers M, Ishizaki T, Ahmadian MR, Wittinghofer A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "15864301", "url": "https://glygen.org/publication/PubMed/15864301" } ] }, { "title": "Structural basis of Rho GTPase-mediated activation of the formin mDia1.", "journal": "Molecular cell", "date": "2005", "authors": "Otomo T, Otomo C, Tomchick DR, Machius M, Rosen MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "15866170", "url": "https://glygen.org/publication/PubMed/15866170" } ] }, { "title": "Estrogen-induced G1/S transition of G0-arrested estrogen-dependent breast cancer cells is regulated by mitochondrial oxidant signaling.", "journal": "Oncogene", "date": "2005", "authors": "Felty Q, Singh KP, Roy D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "15897899", "url": "https://glygen.org/publication/PubMed/15897899" } ] }, { "title": "RhoB regulates endosome transport by promoting actin assembly on endosomal membranes through Dia1.", "journal": "Journal of cell science", "date": "2005", "authors": "Fernandez-Borja M, Janssen L, Verwoerd D, Hordijk P, Neefjes J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "15944396", "url": "https://glygen.org/publication/PubMed/15944396" } ] }, { "title": "The deubiquitinating enzyme UCH37 interacts with Smads and regulates TGF-beta signalling.", "journal": "Oncogene", "date": "2005", "authors": "Wicks SJ, Haros K, Maillard M, Song L, Cohen RE, Dijke PT, Chantry A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173788", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173788" } ], "reference": [ { "type": "PubMed", "id": "16027725", "url": "https://glygen.org/publication/PubMed/16027725" } ] }, { "title": "Regulation of Smurf2 ubiquitin ligase activity by anchoring the E2 to the HECT domain.", "journal": "Molecular cell", "date": "2005", "authors": "Ogunjimi AA, Briant DJ, Pece-Barbara N, Le Roy C, Di Guglielmo GM, Kavsak P, Rasmussen RK, Seet BT, Sicheri F, Wrana JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173788", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173788" } ], "reference": [ { "type": "PubMed", "id": "16061177", "url": "https://glygen.org/publication/PubMed/16061177" } ] }, { "title": "Drosophila caliban, a nuclear export mediator, can function as a tumor suppressor in human lung cancer cells.", "journal": "Oncogene", "date": "2005", "authors": "Bi X, Jones T, Abbasi F, Lee H, Stultz B, Hursh DA, Mortin MA", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "reference": [ { "type": "PubMed", "id": "16103875", "url": "https://glygen.org/publication/PubMed/16103875" } ] }, { "title": "The Fos family of transcription factors and their role in tumourigenesis.", "journal": "European journal of cancer (Oxford, England : 1990)", "date": "2005", "authors": "Milde-Langosch K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "16199154", "url": "https://glygen.org/publication/PubMed/16199154" } ] }, { "title": "The G protein-coupled receptor GPR30 mediates the proliferative effects induced by 17beta-estradiol and hydroxytamoxifen in endometrial cancer cells.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2006", "authors": "Vivacqua A, Bonofiglio D, Recchia AG, Musti AM, Picard D, Ando S, Maggiolini M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "16239258", "url": "https://glygen.org/publication/PubMed/16239258" } ] }, { "title": "The regulation of mDia1 by autoinhibition and its release by Rho*GTP.", "journal": "The EMBO journal", "date": "2005", "authors": "Lammers M, Rose R, Scrima A, Wittinghofer A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "16292343", "url": "https://glygen.org/publication/PubMed/16292343" } ] }, { "title": "Nuclear translocation of the pro-apoptotic Bcl-2 family member Bok induces apoptosis.", "journal": "Mol. Carcinog.", "date": "2006", "authors": "Bartholomeusz G, Wu Y, Ali Seyed M, Xia W, Kwong KY, Hortobagyi G, Hung MC", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "reference": [ { "type": "PubMed", "id": "16302269", "url": "https://glygen.org/publication/PubMed/16302269" } ] }, { "title": "Identification of extracellular signal-regulated kinase 3 as a new interaction partner of cyclin D3.", "journal": "Biochemical and biophysical research communications", "date": "2006", "authors": "Sun M, Wei Y, Yao L, Xie J, Chen X, Wang H, Jiang J, Gu J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "16360641", "url": "https://glygen.org/publication/PubMed/16360641" } ] }, { "title": "Here come the septins: novel polymers that coordinate intracellular functions and organization.", "journal": "Journal of cell science", "date": "2006", "authors": "Spiliotis ET, Nelson WJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "16371649", "url": "https://glygen.org/publication/PubMed/16371649" } ] }, { "title": "Control of the assembly of ATP- and ADP-actin by formins and profilin.", "journal": "Cell", "date": "2006", "authors": "Kovar DR, Harris ES, Mahaffy R, Higgs HN, Pollard TD", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "16439214", "url": "https://glygen.org/publication/PubMed/16439214" } ] }, { "title": "Expression of CD83 is regulated by HuR via a novel cis-active coding region RNA element.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Prechtel AT, Chemnitz J, Schirmer S, Ehlers C, Langbein-Detsch I, Stulke J, Dabauvalle MC, Kehlenbach RH, Hauber J", "evidence": [ { "database": "Reactome", "id": "R-HSA-450520", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-450520" } ], "reference": [ { "type": "PubMed", "id": "16484227", "url": "https://glygen.org/publication/PubMed/16484227" } ] }, { "title": "The APC tumor suppressor counteracts beta-catenin activation and H3K4 methylation at Wnt target genes.", "journal": "Genes & development", "date": "2006", "authors": "Sierra J, Yoshida T, Joazeiro CA, Jones KA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3769402", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3769402" } ], "reference": [ { "type": "PubMed", "id": "16510874", "url": "https://glygen.org/publication/PubMed/16510874" } ] }, { "title": "Shugoshin collaborates with protein phosphatase 2A to protect cohesin.", "journal": "Nature", "date": "2006", "authors": "Kitajima TS, Sakuno T, Ishiguro K, Iemura S, Natsume T, Kawashima SA, Watanabe Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-2500257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2500257" } ], "reference": [ { "type": "PubMed", "id": "16541025", "url": "https://glygen.org/publication/PubMed/16541025" } ] }, { "title": "Membrane accumulation of influenza A virus hemagglutinin triggers nuclear export of the viral genome via protein kinase Calpha-mediated activation of ERK signaling.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Marjuki H, Alam MI, Ehrhardt C, Wagner R, Planz O, Klenk HD, Ludwig S, Pleschka S", "evidence": [ { "database": "Reactome", "id": "R-HSA-168333", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168333" } ], "reference": [ { "type": "PubMed", "id": "16608852", "url": "https://glygen.org/publication/PubMed/16608852" } ] }, { "title": "The human CENP-A centromeric nucleosome-associated complex.", "journal": "Nature cell biology", "date": "2006", "authors": "Foltz DR, Jansen LE, Black BE, Bailey AO, Yates JR 3rd, Cleveland DW", "evidence": [ { "database": "Reactome", "id": "R-HSA-68877", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68877" } ], "reference": [ { "type": "PubMed", "id": "16622419", "url": "https://glygen.org/publication/PubMed/16622419" } ] }, { "title": "The CENP-H-I complex is required for the efficient incorporation of newly synthesized CENP-A into centromeres.", "journal": "Nature cell biology", "date": "2006", "authors": "Okada M, Cheeseman IM, Hori T, Okawa K, McLeod IX, Yates JR 3rd, Desai A, Fukagawa T", "evidence": [ { "database": "Reactome", "id": "R-HSA-68877", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68877" } ], "reference": [ { "type": "PubMed", "id": "16622420", "url": "https://glygen.org/publication/PubMed/16622420" } ] }, { "title": "Human Scc4 is required for cohesin binding to chromatin, sister-chromatid cohesion, and mitotic progression.", "journal": "Current biology : CB", "date": "2006", "authors": "Watrin E, Schleiffer A, Tanaka K, Eisenhaber F, Nasmyth K, Peters JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2500257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2500257" } ], "reference": [ { "type": "PubMed", "id": "16682347", "url": "https://glygen.org/publication/PubMed/16682347" } ] }, { "title": "17beta-estradiol, genistein, and 4-hydroxytamoxifen induce the proliferation of thyroid cancer cells through the g protein-coupled receptor GPR30.", "journal": "Molecular pharmacology", "date": "2006", "authors": "Vivacqua A, Bonofiglio D, Albanito L, Madeo A, Rago V, Carpino A, Musti AM, Picard D, Ando S, Maggiolini M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "16835357", "url": "https://glygen.org/publication/PubMed/16835357" } ] }, { "title": "Human EML4, a novel member of the EMAP family, is essential for microtubule formation.", "journal": "Experimental cell research", "date": "2006", "authors": "Pollmann M, Parwaresch R, Adam-Klages S, Kruse ML, Buck F, Heidebrecht HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648025", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648025" } ], "reference": [ { "type": "PubMed", "id": "16890222", "url": "https://glygen.org/publication/PubMed/16890222" } ] }, { "title": "Autoinhibition regulates cellular localization and actin assembly activity of the diaphanous-related formins FRLalpha and mDia1.", "journal": "The Journal of cell biology", "date": "2006", "authors": "Seth A, Otomo C, Rosen MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "16943183", "url": "https://glygen.org/publication/PubMed/16943183" } ] }, { "title": "A probability-based approach for high-throughput protein phosphorylation analysis and site localization.", "journal": "Nat. Biotechnol.", "date": "2006", "authors": "Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "reference": [ { "type": "PubMed", "id": "16964243", "url": "https://glygen.org/publication/PubMed/16964243" } ] }, { "title": "Regulation of MAPK-activated protein kinase 5 activity and subcellular localization by the atypical MAPK ERK4/MAPK4.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Aberg E, Perander M, Johansen B, Julien C, Meloche S, Keyse SM, Seternes OM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "16971392", "url": "https://glygen.org/publication/PubMed/16971392" } ] }, { "title": "Characterization of the atypical MAPK ERK4 and its activation of the MAPK-activated protein kinase MK5.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Kant S, Schumacher S, Singh MK, Kispert A, Kotlyarov A, Gaestel M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "16973613", "url": "https://glygen.org/publication/PubMed/16973613" } ] }, { "title": "Mapping the assembly pathways that specify formation of the trilaminar kinetochore plates in human cells.", "journal": "The Journal of cell biology", "date": "2006", "authors": "Liu ST, Rattner JB, Jablonski SA, Yen TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-68877", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68877" } ], "reference": [ { "type": "PubMed", "id": "17030981", "url": "https://glygen.org/publication/PubMed/17030981" } ] }, { "title": "Nuclear traffic of influenza virus proteins and ribonucleoprotein complexes.", "journal": "Virus research", "date": "2007", "authors": "Boulo S, Akarsu H, Ruigrok RW, Baudin F", "evidence": [ { "database": "Reactome", "id": "R-HSA-168333", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168333" } ], "reference": [ { "type": "PubMed", "id": "17081640", "url": "https://glygen.org/publication/PubMed/17081640" } ] }, { "title": "Human Wapl is a cohesin-binding protein that promotes sister-chromatid resolution in mitotic prophase.", "journal": "Current biology : CB", "date": "2006", "authors": "Gandhi R, Gillespie PJ, Hirano T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2500257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2500257" } ], "reference": [ { "type": "PubMed", "id": "17112726", "url": "https://glygen.org/publication/PubMed/17112726" } ] }, { "title": "Wapl controls the dynamic association of cohesin with chromatin.", "journal": "Cell", "date": "2006", "authors": "Kueng S, Hegemann B, Peters BH, Lipp JJ, Schleiffer A, Mechtler K, Peters JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2500257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2500257" } ], "reference": [ { "type": "PubMed", "id": "17113138", "url": "https://glygen.org/publication/PubMed/17113138" } ] }, { "title": "The conserved KMN network constitutes the core microtubule-binding site of the kinetochore.", "journal": "Cell", "date": "2006", "authors": "Cheeseman IM, Chappie JS, Wilson-Kubalek EM, Desai A", "evidence": [ { "database": "Reactome", "id": "R-HSA-68877", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68877" } ], "reference": [ { "type": "PubMed", "id": "17129783", "url": "https://glygen.org/publication/PubMed/17129783" } ] }, { "title": "Atypical mitogen-activated protein kinases: structure, regulation and functions.", "journal": "Biochimica et biophysica acta", "date": "2007", "authors": "Coulombe P, Meloche S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "17161475", "url": "https://glygen.org/publication/PubMed/17161475" } ] }, { "title": "Human cyclins A and B1 are differentially located in the cell and undergo cell cycle-dependent nuclear transport.", "journal": "The Journal of cell biology", "date": "1991", "authors": "Pines J, Hunter T", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "1717476", "url": "https://glygen.org/publication/PubMed/1717476" } ] }, { "title": "Analysis of nucleocytoplasmic trafficking of the HuR ligand APRIL and its influence on CD83 expression.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Fries B, Heukeshoven J, Hauber I, Gruttner C, Stocking C, Kehlenbach RH, Hauber J, Chemnitz J", "evidence": [ { "database": "Reactome", "id": "R-HSA-450520", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-450520" } ], "reference": [ { "type": "PubMed", "id": "17178712", "url": "https://glygen.org/publication/PubMed/17178712" } ] }, { "title": "Echinoderm microtubule-associated protein like protein 4, a member of the echinoderm microtubule-associated protein family, stabilizes microtubules.", "journal": "Neuroscience", "date": "2007", "authors": "Houtman SH, Rutteman M, De Zeeuw CI, French PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648025", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648025" } ], "reference": [ { "type": "PubMed", "id": "17196341", "url": "https://glygen.org/publication/PubMed/17196341" } ] }, { "title": "RhoB and the mammalian Diaphanous-related formin mDia2 in endosome trafficking.", "journal": "Experimental cell research", "date": "2007", "authors": "Wallar BJ, Deward AD, Resau JH, Alberts AS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "17198702", "url": "https://glygen.org/publication/PubMed/17198702" } ] }, { "title": "Regulation of gammadelta versus alphabeta T lymphocyte differentiation by the transcription factor SOX13.", "journal": "Science (New York, N.Y.)", "date": "2007", "authors": "Melichar HJ, Narayan K, Der SD, Hiraoka Y, Gardiol N, Jeannet G, Held W, Chambers CA, Kang J", "evidence": [ { "database": "Reactome", "id": "R-HSA-3769402", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3769402" } ], "reference": [ { "type": "PubMed", "id": "17218525", "url": "https://glygen.org/publication/PubMed/17218525" } ] }, { "title": "PRAK is essential for ras-induced senescence and tumor suppression.", "journal": "Cell", "date": "2007", "authors": "Sun P, Yoshizuka N, New L, Moser BA, Li Y, Liao R, Xie C, Chen J, Deng Q, Yamout M, Dong MQ, Frangou CG, Yates JR 3rd, Wright PE, Han J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "17254968", "url": "https://glygen.org/publication/PubMed/17254968" } ] }, { "title": "G protein-coupled receptor 30 (GPR30) mediates gene expression changes and growth response to 17beta-estradiol and selective GPR30 ligand G-1 in ovarian cancer cells.", "journal": "Cancer research", "date": "2007", "authors": "Albanito L, Madeo A, Lappano R, Vivacqua A, Rago V, Carpino A, Oprea TI, Prossnitz ER, Musti AM, Ando S, Maggiolini M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "17308128", "url": "https://glygen.org/publication/PubMed/17308128" } ] }, { "title": "Phosphopeptide enrichment by aliphatic hydroxy acid-modified metal oxide chromatography for nano-LC-MS/MS in proteomics applications.", "journal": "Molecular & cellular proteomics : MCP", "date": "2007", "authors": "Sugiyama N, Masuda T, Shinoda K, Nakamura A, Tomita M, Ishihama Y", "evidence": [ { "database": "iPTMnet", "id": "O14980", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14980" } ], "reference": [ { "type": "PubMed", "id": "17322306", "url": "https://glygen.org/publication/PubMed/17322306" } ] }, { "title": "Profilin-actin complexes directly elongate actin filaments at the barbed end.", "journal": "Biochemistry", "date": "1992", "authors": "Pring M, Weber A, Bubb MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "1737036", "url": "https://glygen.org/publication/PubMed/1737036" } ] }, { "title": "Protein kinase C alpha-dependent phosphorylation of the mRNA-stabilizing factor HuR: implications for posttranscriptional regulation of cyclooxygenase-2.", "journal": "Molecular biology of the cell", "date": "2007", "authors": "Doller A, Huwiler A, Muller R, Radeke HH, Pfeilschifter J, Eberhardt W", "evidence": [ { "database": "Reactome", "id": "R-HSA-450520", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-450520" } ], "reference": [ { "type": "PubMed", "id": "17392515", "url": "https://glygen.org/publication/PubMed/17392515" } ] }, { "title": "Endothelial cell migration during angiogenesis.", "journal": "Circulation research", "date": "2007", "authors": "Lamalice L, Le Boeuf F, Huot J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "17395884", "url": "https://glygen.org/publication/PubMed/17395884" } ] }, { "title": "SOX6 suppresses cyclin D1 promoter activity by interacting with beta-catenin and histone deacetylase 1, and its down-regulation induces pancreatic beta-cell proliferation.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Iguchi H, Urashima Y, Inagaki Y, Ikeda Y, Okamura M, Tanaka T, Uchida A, Yamamoto TT, Kodama T, Sakai J", "evidence": [ { "database": "Reactome", "id": "R-HSA-3769402", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3769402" } ], "reference": [ { "type": "PubMed", "id": "17412698", "url": "https://glygen.org/publication/PubMed/17412698" } ] }, { "title": "Specific protein domains mediate cooperative assembly of HuR oligomers on AU-rich mRNA-destabilizing sequences.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Fialcowitz-White EJ, Brewer BY, Ballin JD, Willis CD, Toth EA, Wilson GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-450520", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-450520" } ], "reference": [ { "type": "PubMed", "id": "17517897", "url": "https://glygen.org/publication/PubMed/17517897" } ] }, { "title": "ATM and ATR substrate analysis reveals extensive protein networks responsive to DNA damage.", "journal": "Science (New York, N.Y.)", "date": "2007", "authors": "Matsuoka S, Ballif BA, Smogorzewska A, McDonald ER 3rd, Hurov KE, Luo J, Bakalarski CE, Zhao Z, Solimini N, Lerenthal Y, Shiloh Y, Gygi SP, Elledge SJ", "evidence": [ { "database": "iPTMnet", "id": "O14980", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14980" } ], "reference": [ { "type": "PubMed", "id": "17525332", "url": "https://glygen.org/publication/PubMed/17525332" } ] }, { "title": "Cyclin B2 suppresses mitotic failure and DNA re-replication in human somatic cells knocked down for both cyclins B1 and B2.", "journal": "Oncogene", "date": "2007", "authors": "Bellanger S, de Gramont A, Sobczak-Thepot J", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "17533373", "url": "https://glygen.org/publication/PubMed/17533373" } ] }, { "title": "Sox9 regulates cell proliferation and is required for Paneth cell differentiation in the intestinal epithelium.", "journal": "The Journal of cell biology", "date": "2007", "authors": "Bastide P, Darido C, Pannequin J, Kist R, Robine S, Marty-Double C, Bibeau F, Scherer G, Joubert D, Hollande F, Blache P, Jay P", "evidence": [ { "database": "Reactome", "id": "R-HSA-3769402", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3769402" } ], "reference": [ { "type": "PubMed", "id": "17698607", "url": "https://glygen.org/publication/PubMed/17698607" } ] }, { "title": "14-3-3epsilon inhibits MK5-mediated cell migration by disrupting F-actin polymerization.", "journal": "Cellular signalling", "date": "2007", "authors": "Tak H, Jang E, Kim SB, Park J, Suk J, Yoon YS, Ahn JK, Lee JH, Joe CO", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "17728103", "url": "https://glygen.org/publication/PubMed/17728103" } ] }, { "title": "Sox17 and Sox4 differentially regulate beta-catenin/T-cell factor activity and proliferation of colon carcinoma cells.", "journal": "Molecular and cellular biology", "date": "2007", "authors": "Sinner D, Kordich JJ, Spence JR, Opoka R, Rankin S, Lin SC, Jonatan D, Zorn AM, Wells JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-3769402", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3769402" } ], "reference": [ { "type": "PubMed", "id": "17875931", "url": "https://glygen.org/publication/PubMed/17875931" } ] }, { "title": "Modulation of F-actin rearrangement by the cyclic AMP/cAMP-dependent protein kinase (PKA) pathway is mediated by MAPK-activated protein kinase 5 and requires PKA-induced nuclear export of MK5.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Gerits N, Mikalsen T, Kostenko S, Shiryaev A, Johannessen M, Moens U", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "17947239", "url": "https://glygen.org/publication/PubMed/17947239" } ] }, { "title": "High-resolution structural analysis of mammalian profilin 2a complex formation with two physiological ligands: the formin homology 1 domain of mDia1 and the proline-rich domain of VASP.", "journal": "Journal of molecular biology", "date": "2008", "authors": "Kursula P, Kursula I, Massimi M, Song YH, Downer J, Stanley WA, Witke W, Wilmanns M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "18001770", "url": "https://glygen.org/publication/PubMed/18001770" } ] }, { "title": "Kalirin-7 controls activity-dependent structural and functional plasticity of dendritic spines.", "journal": "Neuron", "date": "2007", "authors": "Xie Z, Srivastava DP, Photowala H, Kai L, Cahill ME, Woolfrey KM, Shum CY, Surmeier DJ, Penzes P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "18031682", "url": "https://glygen.org/publication/PubMed/18031682" } ] }, { "title": "Molecular architecture of the kinetochore-microtubule interface.", "journal": "Nature reviews. Molecular cell biology", "date": "2008", "authors": "Cheeseman IM, Desai A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2500257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2500257" } ], "reference": [ { "type": "PubMed", "id": "18097444", "url": "https://glygen.org/publication/PubMed/18097444" } ] }, { "title": "Proto-oncogene ACTR/AIB1 promotes cancer cell invasion by up-regulating specific matrix metalloproteinase expression.", "journal": "Cancer letters", "date": "2008", "authors": "Li LB, Louie MC, Chen HW, Zou JX", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "18162290", "url": "https://glygen.org/publication/PubMed/18162290" } ] }, { "title": "A functional link between the human cell cycle-regulatory phosphatase Cdc14A and the atypical mitogen-activated kinase Erk3.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2008", "authors": "Hansen CA, Bartek J, Jensen S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "18235225", "url": "https://glygen.org/publication/PubMed/18235225" } ] }, { "title": "The Ser(186) phospho-acceptor site within ERK4 is essential for its ability to interact with and activate PRAK/MK5.", "journal": "The Biochemical journal", "date": "2008", "authors": "Perander M, Aberg E, Johansen B, Dreyer B, Guldvik IJ, Outzen H, Keyse SM, Seternes OM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "18248330", "url": "https://glygen.org/publication/PubMed/18248330" } ] }, { "title": "Dephosphorylation and activation of a p34cdc2/cyclin B complex in vitro by human CDC25 protein.", "journal": "Nature", "date": "1991", "authors": "Strausfeld U, Labbe JC, Fesquet D, Cavadore JC, Picard A, Sadhu K, Russell P, Doree M", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "1828290", "url": "https://glygen.org/publication/PubMed/1828290" } ] }, { "title": "Activation of FoxM1 during G2 requires cyclin A/Cdk-dependent relief of autorepression by the FoxM1 N-terminal domain.", "journal": "Molecular and cellular biology", "date": "2008", "authors": "Laoukili J, Alvarez M, Meijer LA, Stahl M, Mohammed S, Kleij L, Heck AJ, Medema RH", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "18285455", "url": "https://glygen.org/publication/PubMed/18285455" } ] }, { "title": "Posttranslational modification of the AU-rich element binding protein HuR by protein kinase Cdelta elicits angiotensin II-induced stabilization and nuclear export of cyclooxygenase 2 mRNA.", "journal": "Molecular and cellular biology", "date": "2008", "authors": "Doller A, Akool el-S, Huwiler A, Muller R, Radeke HH, Pfeilschifter J, Eberhardt W", "evidence": [ { "database": "Reactome", "id": "R-HSA-450520", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-450520" } ], "reference": [ { "type": "PubMed", "id": "18285462", "url": "https://glygen.org/publication/PubMed/18285462" } ] }, { "title": "CRM1-mediated nuclear export is required for 26 S proteasome-dependent degradation of the TRIP-Br2 proto-oncoprotein.", "journal": "J. Biol. Chem.", "date": "2008", "authors": "Cheong JK, Gunaratnam L, Hsu SI", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "reference": [ { "type": "PubMed", "id": "18316374", "url": "https://glygen.org/publication/PubMed/18316374" } ] }, { "title": "Specific activation of cdc25 tyrosine phosphatases by B-type cyclins: evidence for multiple roles of mitotic cyclins.", "journal": "Cell", "date": "1991", "authors": "Galaktionov K, Beach D", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "1836978", "url": "https://glygen.org/publication/PubMed/1836978" } ] }, { "title": "CHD8 is an ATP-dependent chromatin remodeling factor that regulates beta-catenin target genes.", "journal": "Molecular and cellular biology", "date": "2008", "authors": "Thompson BA, Tremblay V, Lin G, Bochar DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3769402", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3769402" } ], "reference": [ { "type": "PubMed", "id": "18378692", "url": "https://glygen.org/publication/PubMed/18378692" } ] }, { "title": "Differential phosphorylation of Cdc25C phosphatase in mitosis.", "journal": "Biochemical and biophysical research communications", "date": "2008", "authors": "Bonnet J, Mayonove P, Morris MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "18384749", "url": "https://glygen.org/publication/PubMed/18384749" } ] }, { "title": "A brief introduction to FOXOlogy.", "journal": "Oncogene", "date": "2008", "authors": "Burgering BM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "18391968", "url": "https://glygen.org/publication/PubMed/18391968" } ] }, { "title": "Structural mechanism of demethylation and inactivation of protein phosphatase 2A.", "journal": "Cell", "date": "2008", "authors": "Xing Y, Li Z, Chen Y, Stock JB, Jeffrey PD, Shi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "18394995", "url": "https://glygen.org/publication/PubMed/18394995" } ] }, { "title": "The molecular mechanism governing the oncogenic potential of SOX2 in breast cancer.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Chen Y, Shi L, Zhang L, Li R, Liang J, Yu W, Sun L, Yang X, Wang Y, Zhang Y, Shang Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-3769402", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3769402" } ], "reference": [ { "type": "PubMed", "id": "18456656", "url": "https://glygen.org/publication/PubMed/18456656" } ] }, { "title": "Epidermal growth factor induces G protein-coupled receptor 30 expression in estrogen receptor-negative breast cancer cells.", "journal": "Endocrinology", "date": "2008", "authors": "Albanito L, Sisci D, Aquila S, Brunelli E, Vivacqua A, Madeo A, Lappano R, Pandey DP, Picard D, Mauro L, Ando S, Maggiolini M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "18467441", "url": "https://glygen.org/publication/PubMed/18467441" } ] }, { "title": "Chibby cooperates with 14-3-3 to regulate beta-catenin subcellular distribution and signaling activity.", "journal": "The Journal of cell biology", "date": "2008", "authors": "Li FQ, Mofunanya A, Harris K, Takemaru K", "evidence": [ { "database": "Reactome", "id": "R-HSA-3769402", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3769402" } ], "reference": [ { "type": "PubMed", "id": "18573912", "url": "https://glygen.org/publication/PubMed/18573912" } ] }, { "title": "Steroid receptor coactivator-3/AIB1 promotes cell migration and invasiveness through focal adhesion turnover and matrix metalloproteinase expression.", "journal": "Cancer research", "date": "2008", "authors": "Yan J, Erdem H, Li R, Cai Y, Ayala G, Ittmann M, Yu-Lee LY, Tsai SY, Tsai MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "18593949", "url": "https://glygen.org/publication/PubMed/18593949" } ] }, { "title": "Human SRY inhibits beta-catenin-mediated transcription.", "journal": "The international journal of biochemistry & cell biology", "date": "2008", "authors": "Bernard P, Sim H, Knower K, Vilain E, Harley V", "evidence": [ { "database": "Reactome", "id": "R-HSA-3769402", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3769402" } ], "reference": [ { "type": "PubMed", "id": "18598779", "url": "https://glygen.org/publication/PubMed/18598779" } ] }, { "title": "The AIB1 oncogene promotes breast cancer metastasis by activation of PEA3-mediated matrix metalloproteinase 2 (MMP2) and MMP9 expression.", "journal": "Molecular and cellular biology", "date": "2008", "authors": "Qin L, Liao L, Redmond A, Young L, Yuan Y, Chen H, O'Malley BW, Xu J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "18644862", "url": "https://glygen.org/publication/PubMed/18644862" } ] }, { "title": "A quantitative atlas of mitotic phosphorylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP", "evidence": [ { "database": "iPTMnet", "id": "O14980", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14980" } ], "reference": [ { "type": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ] }, { "title": "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.", "journal": "Mol. Cell", "date": "2008", "authors": "Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" }, { "database": "iPTMnet", "id": "O14980", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14980" } ], "reference": [ { "type": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" } ] }, { "title": "Heterochromatin links to centromeric protection by recruiting shugoshin.", "journal": "Nature", "date": "2008", "authors": "Yamagishi Y, Sakuno T, Shimura M, Watanabe Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-2500257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2500257" } ], "reference": [ { "type": "PubMed", "id": "18716626", "url": "https://glygen.org/publication/PubMed/18716626" } ] }, { "title": "Activation loop phosphorylation of the atypical MAP kinases ERK3 and ERK4 is required for binding, activation and cytoplasmic relocalization of MK5.", "journal": "Journal of cellular physiology", "date": "2008", "authors": "Deleris P, Rousseau J, Coulombe P, Rodier G, Tanguay PL, Meloche S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "18720373", "url": "https://glygen.org/publication/PubMed/18720373" } ] }, { "title": "Estrogen-induced Bcl-2 expression after spinal cord injury is mediated through phosphoinositide-3-kinase/Akt-dependent CREB activation.", "journal": "Journal of neurotrauma", "date": "2008", "authors": "Yune TY, Park HG, Lee JY, Oh TH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "18785877", "url": "https://glygen.org/publication/PubMed/18785877" } ] }, { "title": "Sox7 Is an independent checkpoint for beta-catenin function in prostate and colon epithelial cells.", "journal": "Molecular cancer research : MCR", "date": "2008", "authors": "Guo L, Zhong D, Lau S, Liu X, Dong XY, Sun X, Yang VW, Vertino PM, Moreno CS, Varma V, Dong JT, Zhou W", "evidence": [ { "database": "Reactome", "id": "R-HSA-3769402", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3769402" } ], "reference": [ { "type": "PubMed", "id": "18819930", "url": "https://glygen.org/publication/PubMed/18819930" } ] }, { "title": "Clustering of VASP actively drives processive, WH2 domain-mediated actin filament elongation.", "journal": "The EMBO journal", "date": "2008", "authors": "Breitsprecher D, Kiesewetter AK, Linkner J, Urbanke C, Resch GP, Small JV, Faix J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "18923426", "url": "https://glygen.org/publication/PubMed/18923426" } ] }, { "title": "Sox9 inhibits Wnt signaling by promoting beta-catenin phosphorylation in the nucleus.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Topol L, Chen W, Song H, Day TF, Yang Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-3769402", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3769402" } ], "reference": [ { "type": "PubMed", "id": "19047045", "url": "https://glygen.org/publication/PubMed/19047045" } ] }, { "title": "Phosphorylation of the HuR ligand APRIL by casein kinase 2 regulates CD83 expression.", "journal": "European journal of immunology", "date": "2009", "authors": "Chemnitz J, Pieper D, Gruttner C, Hauber J", "evidence": [ { "database": "Reactome", "id": "R-HSA-450520", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-450520" } ], "reference": [ { "type": "PubMed", "id": "19130553", "url": "https://glygen.org/publication/PubMed/19130553" } ] }, { "title": "Plk1-dependent phosphorylation of FoxM1 regulates a transcriptional programme required for mitotic progression.", "journal": "Nature cell biology", "date": "2008", "authors": "Fu Z, Malureanu L, Huang J, Wang W, Li H, van Deursen JM, Tindall DJ, Chen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "19160488", "url": "https://glygen.org/publication/PubMed/19160488" } ] }, { "title": "PKA-induced F-actin rearrangement requires phosphorylation of Hsp27 by the MAPKAP kinase MK5.", "journal": "Cellular signalling", "date": "2009", "authors": "Kostenko S, Johannessen M, Moens U", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "19166925", "url": "https://glygen.org/publication/PubMed/19166925" } ] }, { "title": "Human Cdc25A phosphatase has a non-redundant function in G2 phase by activating Cyclin A-dependent kinases.", "journal": "FEBS letters", "date": "2009", "authors": "Timofeev O, Cizmecioglu O, Hu E, Orlik T, Hoffmann I", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "19192479", "url": "https://glygen.org/publication/PubMed/19192479" } ] }, { "title": "SCAI acts as a suppressor of cancer cell invasion through the transcriptional control of beta1-integrin.", "journal": "Nature cell biology", "date": "2009", "authors": "Brandt DT, Baarlink C, Kitzing TM, Kremmer E, Ivaska J, Nollau P, Grosse R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "19350017", "url": "https://glygen.org/publication/PubMed/19350017" } ] }, { "title": "Inactivation of Chibby affects function of motile airway cilia.", "journal": "The Journal of cell biology", "date": "2009", "authors": "Voronina VA, Takemaru K, Treuting P, Love D, Grubb BR, Hajjar AM, Adams A, Li FQ, Moon RT", "evidence": [ { "database": "Reactome", "id": "R-HSA-3769402", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3769402" } ], "reference": [ { "type": "PubMed", "id": "19364920", "url": "https://glygen.org/publication/PubMed/19364920" } ] }, { "title": "Catalysis of guanine nucleotide exchange on Ran by the mitotic regulator RCC1.", "journal": "Nature", "date": "1991", "authors": "Bischoff FR, Ponstingl H", "evidence": [ { "database": "Reactome", "id": "R-HSA-165054", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-165054" } ], "reference": [ { "type": "PubMed", "id": "1944575", "url": "https://glygen.org/publication/PubMed/1944575" } ] }, { "title": "Docking of PRAK/MK5 to the atypical MAPKs ERK3 and ERK4 defines a novel MAPK interaction motif.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Aberg E, Torgersen KM, Johansen B, Keyse SM, Perander M, Seternes OM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "19473979", "url": "https://glygen.org/publication/PubMed/19473979" } ] }, { "title": "Involvement of Rac/Cdc42/PAK pathway in cytoskeletal rearrangements.", "journal": "Acta biochimica Polonica", "date": "2009", "authors": "Szczepanowska J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "19513348", "url": "https://glygen.org/publication/PubMed/19513348" } ] }, { "title": "Stimulating the GPR30 estrogen receptor with a novel tamoxifen analogue activates SF-1 and promotes endometrial cell proliferation.", "journal": "Cancer research", "date": "2009", "authors": "Lin BC, Suzawa M, Blind RD, Tobias SC, Bulun SE, Scanlan TS, Ingraham HA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "19549922", "url": "https://glygen.org/publication/PubMed/19549922" } ] }, { "title": "XIAP as a ubiquitin ligase in cellular signaling.", "journal": "Cell death and differentiation", "date": "2010", "authors": "Galban S, Duckett CS", "evidence": [ { "database": "Reactome", "id": "R-HSA-3769402", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3769402" } ], "reference": [ { "type": "PubMed", "id": "19590513", "url": "https://glygen.org/publication/PubMed/19590513" } ] }, { "title": "Heat shock protein 27 phosphorylation: kinases, phosphatases, functions and pathology.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2009", "authors": "Kostenko S, Moens U", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "19593530", "url": "https://glygen.org/publication/PubMed/19593530" } ] }, { "title": "Lysine acetylation targets protein complexes and co-regulates major cellular functions.", "journal": "Science (New York, N.Y.)", "date": "2009", "authors": "Choudhary C, Kumar C, Gnad F, Nielsen ML, Rehman M, Walther TC, Olsen JV, Mann M", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "reference": [ { "type": "PubMed", "id": "19608861", "url": "https://glygen.org/publication/PubMed/19608861" } ] }, { "title": "Releasing cohesin from chromosome arms in early mitosis: opposing actions of Wapl-Pds5 and Sgo1.", "journal": "Genes & development", "date": "2009", "authors": "Shintomi K, Hirano T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2500257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2500257" } ], "reference": [ { "type": "PubMed", "id": "19696148", "url": "https://glygen.org/publication/PubMed/19696148" } ] }, { "title": "Human BAMBI cooperates with Smad7 to inhibit transforming growth factor-beta signaling.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Yan X, Lin Z, Chen F, Zhao X, Chen H, Ning Y, Chen YG", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173788", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173788" } ], "reference": [ { "type": "PubMed", "id": "19758997", "url": "https://glygen.org/publication/PubMed/19758997" } ] }, { "title": "Formin-like 1 (FMNL1) is regulated by N-terminal myristoylation and induces polarized membrane blebbing.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Han Y, Eppinger E, Schuster IG, Weigand LU, Liang X, Kremmer E, Peschel C, Krackhardt AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "19815554", "url": "https://glygen.org/publication/PubMed/19815554" } ] }, { "title": "Cell proliferation regulated by estradiol receptor: Therapeutic implications.", "journal": "Steroids", "date": "2010", "authors": "Castoria G, Migliaccio A, Giovannelli P, Auricchio F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "19879889", "url": "https://glygen.org/publication/PubMed/19879889" } ] }, { "title": "Nuclear APC.", "journal": "Advances in experimental medicine and biology", "date": "2009", "authors": "Neufeld KL", "evidence": [ { "database": "Reactome", "id": "R-HSA-3769402", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3769402" } ], "reference": [ { "type": "PubMed", "id": "19928349", "url": "https://glygen.org/publication/PubMed/19928349" } ] }, { "title": "Nuclear-cytoplasmic shuttling of Chibby controls beta-catenin signaling.", "journal": "Molecular biology of the cell", "date": "2010", "authors": "Li FQ, Mofunanya A, Fischer V, Hall J, Takemaru K", "evidence": [ { "database": "Reactome", "id": "R-HSA-3769402", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3769402" } ], "reference": [ { "type": "PubMed", "id": "19940019", "url": "https://glygen.org/publication/PubMed/19940019" } ] }, { "title": "Phosphorylation of H2A by Bub1 prevents chromosomal instability through localizing shugoshin.", "journal": "Science (New York, N.Y.)", "date": "2010", "authors": "Kawashima SA, Yamagishi Y, Honda T, Ishiguro K, Watanabe Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-2500257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2500257" } ], "reference": [ { "type": "PubMed", "id": "19965387", "url": "https://glygen.org/publication/PubMed/19965387" } ] }, { "title": "[PI3-kinase mediates activity of RhoA and interaction of RhoA with mDia1 in thrombin-induced platelet aggregation].", "journal": "Zhongguo shi yan xue ye xue za zhi", "date": "2009", "authors": "Gao GX, Dong HJ, Gu HT, Gao Y, Pan YZ, Yang Y, Chen XQ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "20030946", "url": "https://glygen.org/publication/PubMed/20030946" } ] }, { "title": "MTMR4 attenuates transforming growth factor beta (TGFbeta) signaling by dephosphorylating R-Smads in endosomes.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Yu J, Pan L, Qin X, Chen H, Xu Y, Chen Y, Tang H", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173788", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173788" } ], "reference": [ { "type": "PubMed", "id": "20061380", "url": "https://glygen.org/publication/PubMed/20061380" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" }, { "database": "iPTMnet", "id": "O14980", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14980" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "Tandem phosphorylation of serines 221 and 318 by protein kinase Cdelta coordinates mRNA binding and nucleocytoplasmic shuttling of HuR.", "journal": "Molecular and cellular biology", "date": "2010", "authors": "Doller A, Schlepckow K, Schwalbe H, Pfeilschifter J, Eberhardt W", "evidence": [ { "database": "Reactome", "id": "R-HSA-450520", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-450520" } ], "reference": [ { "type": "PubMed", "id": "20086103", "url": "https://glygen.org/publication/PubMed/20086103" } ] }, { "title": "The G protein-coupled receptor GPR30 inhibits proliferation of estrogen receptor-positive breast cancer cells.", "journal": "Cancer research", "date": "2010", "authors": "Ariazi EA, Brailoiu E, Yerrum S, Shupp HA, Slifker MJ, Cunliffe HE, Black MA, Donato AL, Arterburn JB, Oprea TI, Prossnitz ER, Dun NJ, Jordan VC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "20086172", "url": "https://glygen.org/publication/PubMed/20086172" } ] }, { "title": "Formin-like 2 drives amoeboid invasive cell motility downstream of RhoC.", "journal": "Oncogene", "date": "2010", "authors": "Kitzing TM, Wang Y, Pertz O, Copeland JW, Grosse R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "20101212", "url": "https://glygen.org/publication/PubMed/20101212" } ] }, { "title": "TMEPAI, a transmembrane TGF-beta-inducible protein, sequesters Smad proteins from active participation in TGF-beta signaling.", "journal": "Molecular cell", "date": "2010", "authors": "Watanabe Y, Itoh S, Goto T, Ohnishi E, Inamitsu M, Itoh F, Satoh K, Wiercinska E, Yang W, Shi L, Tanaka A, Nakano N, Mommaas AM, Shibuya H, Ten Dijke P, Kato M", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173788", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173788" } ], "reference": [ { "type": "PubMed", "id": "20129061", "url": "https://glygen.org/publication/PubMed/20129061" } ] }, { "title": "Venezuelan equine encephalitis virus capsid protein forms a tetrameric complex with CRM1 and importin alpha/beta that obstructs nuclear pore complex function.", "journal": "J. Virol.", "date": "2010", "authors": "Atasheva Svetlana, Fish Alexander, Fornerod Maarten, Frolova Elena I", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "reference": [ { "type": "PubMed", "id": "20147401", "url": "https://glygen.org/publication/PubMed/20147401" } ] }, { "title": "C-terminal domain phosphorylation of ERK3 controlled by Cdk1 and Cdc14 regulates its stability in mitosis.", "journal": "The Biochemical journal", "date": "2010", "authors": "Tanguay PL, Rodier G, Meloche S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "20236090", "url": "https://glygen.org/publication/PubMed/20236090" } ] }, { "title": "Cdc25 phosphatases are required for timely assembly of CDK1-cyclin B at the G2/M transition.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Timofeev O, Cizmecioglu O, Settele F, Kempf T, Hoffmann I", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "20360007", "url": "https://glygen.org/publication/PubMed/20360007" } ] }, { "title": "HSPB1, actin filament dynamics, and aging cells.", "journal": "Annals of the New York Academy of Sciences", "date": "2010", "authors": "Doshi BM, Hightower LE, Lee J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "20536836", "url": "https://glygen.org/publication/PubMed/20536836" } ] }, { "title": "A global network of transcription factors, involving E2A, EBF1 and Foxo1, that orchestrates B cell fate.", "journal": "Nature immunology", "date": "2010", "authors": "Lin YC, Jhunjhunwala S, Benner C, Heinz S, Welinder E, Mansson R, Sigvardsson M, Hagman J, Espinoza CA, Dutkowski J, Ideker T, Glass CK, Murre C", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "20543837", "url": "https://glygen.org/publication/PubMed/20543837" } ] }, { "title": "RhoA and DIAPH1 mediate adrenocorticotropin-stimulated cortisol biosynthesis by regulating mitochondrial trafficking.", "journal": "Endocrinology", "date": "2010", "authors": "Li D, Sewer MB", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "20591975", "url": "https://glygen.org/publication/PubMed/20591975" } ] }, { "title": "Serine residue 115 of MAPK-activated protein kinase MK5 is crucial for its PKA-regulated nuclear export and biological function.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2011", "authors": "Kostenko S, Shiryaev A, Gerits N, Dumitriu G, Klenow H, Johannessen M, Moens U", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "20734105", "url": "https://glygen.org/publication/PubMed/20734105" } ] }, { "title": "Acetylation directs survivin nuclear localization to repress STAT3 oncogenic activity.", "journal": "J. Biol. Chem.", "date": "2010", "authors": "Wang H, Holloway MP, Ma L, Cooper ZA, Riolo M, Samkari A, Elenitoba-Johnson KS, Chin YE, Altura RA", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "reference": [ { "type": "PubMed", "id": "20826784", "url": "https://glygen.org/publication/PubMed/20826784" } ] }, { "title": "Cross-talk between protein kinase A and the MAPK-activated protein kinases RSK1 and MK5.", "journal": "Journal of receptor and signal transduction research", "date": "2011", "authors": "Kostenko S, Shiryaev A, Dumitriu G, Gerits N, Moens U", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "20849292", "url": "https://glygen.org/publication/PubMed/20849292" } ] }, { "title": "Nucleocytoplasmic shuttling of dysbindin-1, a schizophrenia-related protein, regulates synapsin I expression.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Fei E, Ma X, Zhu C, Xue T, Yan J, Xu Y, Zhou J, Wang G", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "reference": [ { "type": "PubMed", "id": "20921223", "url": "https://glygen.org/publication/PubMed/20921223" } ] }, { "title": "Coupling of tandem Smad ubiquitination regulatory factor (Smurf) WW domains modulates target specificity.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Chong PA, Lin H, Wrana JL, Forman-Kay JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173788", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173788" } ], "reference": [ { "type": "PubMed", "id": "20937913", "url": "https://glygen.org/publication/PubMed/20937913" } ] }, { "title": "Structural basis for cooperative RNA binding and export complex assembly by HIV Rev.", "journal": "Nature structural & molecular biology", "date": "2010", "authors": "Daugherty MD, Liu B, Frankel AD", "evidence": [ { "database": "Reactome", "id": "R-HSA-165054", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-165054" } ], "reference": [ { "type": "PubMed", "id": "20953181", "url": "https://glygen.org/publication/PubMed/20953181" } ] }, { "title": "Variants in RET associated with Hirschsprung's disease affect binding of transcription factors and gene expression.", "journal": "Gastroenterology", "date": "2011", "authors": "Sribudiani Y, Metzger M, Osinga J, Rey A, Burns AJ, Thapar N, Hofstra RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9768919", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9768919" } ], "reference": [ { "type": "PubMed", "id": "20977903", "url": "https://glygen.org/publication/PubMed/20977903" } ] }, { "title": "Sororin mediates sister chromatid cohesion by antagonizing Wapl.", "journal": "Cell", "date": "2010", "authors": "Nishiyama T, Ladurner R, Schmitz J, Kreidl E, Schleiffer A, Bhaskara V, Bando M, Shirahige K, Hyman AA, Mechtler K, Peters JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2500257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2500257" } ], "reference": [ { "type": "PubMed", "id": "21111234", "url": "https://glygen.org/publication/PubMed/21111234" } ] }, { "title": "Bi-modal regulation of a formin by srGAP2.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Mason FM, Heimsath EG, Higgs HN, Soderling SH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "21148482", "url": "https://glygen.org/publication/PubMed/21148482" } ] }, { "title": "Activation loop phosphorylation of ERK3/ERK4 by group I p21-activated kinases (PAKs) defines a novel PAK-ERK3/4-MAPK-activated protein kinase 5 signaling pathway.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Deleris P, Trost M, Topisirovic I, Tanguay PL, Borden KL, Thibault P, Meloche S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "21177870", "url": "https://glygen.org/publication/PubMed/21177870" } ] }, { "title": "Identification of the atypical MAPK Erk3 as a novel substrate for p21-activated kinase (Pak) activity.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "De la Mota-Peynado A, Chernoff J, Beeser A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "21317288", "url": "https://glygen.org/publication/PubMed/21317288" } ] }, { "title": "More, more, more: downregulation of a MK5-FoxO3a-mir34b/c pathway further increases c-Myc levels in colorectal cancer.", "journal": "Molecular cell", "date": "2011", "authors": "Myant K, Sansom OJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "21329875", "url": "https://glygen.org/publication/PubMed/21329875" } ] }, { "title": "The MK5/PRAK kinase and Myc form a negative feedback loop that is disrupted during colorectal tumorigenesis.", "journal": "Molecular cell", "date": "2011", "authors": "Kress TR, Cannell IG, Brenkman AB, Samans B, Gaestel M, Roepman P, Burgering BM, Bushell M, Rosenwald A, Eilers M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "21329882", "url": "https://glygen.org/publication/PubMed/21329882" } ] }, { "title": "Identification of cis-elements and transcription factors regulating neuronal activity-dependent transcription of human BDNF gene.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2011", "authors": "Pruunsild P, Sepp M, Orav E, Koppel I, Timmusk T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9768919", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9768919" } ], "reference": [ { "type": "PubMed", "id": "21368041", "url": "https://glygen.org/publication/PubMed/21368041" } ] }, { "title": "Activation and function of the MAPKs and their substrates, the MAPK-activated protein kinases.", "journal": "Microbiology and molecular biology reviews : MMBR", "date": "2011", "authors": "Cargnello M, Roux PP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "21372320", "url": "https://glygen.org/publication/PubMed/21372320" } ] }, { "title": "Aurora B regulates formin mDia3 in achieving metaphase chromosome alignment.", "journal": "Developmental cell", "date": "2011", "authors": "Cheng L, Zhang J, Ahmad S, Rozier L, Yu H, Deng H, Mao Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "21397845", "url": "https://glygen.org/publication/PubMed/21397845" } ] }, { "title": "RhoA and RhoC have distinct roles in migration and invasion by acting through different targets.", "journal": "The Journal of cell biology", "date": "2011", "authors": "Vega FM, Fruhwirth G, Ng T, Ridley AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "21576392", "url": "https://glygen.org/publication/PubMed/21576392" } ] }, { "title": "SARS-CoV 9b protein diffuses into nucleus, undergoes active Crm1 mediated nucleocytoplasmic export and triggers apoptosis when retained in the nucleus.", "journal": "PLoS ONE", "date": "2011", "authors": "Sharma Kulbhushan, \u00c5kerstr\u00f6m Sara, Sharma Anuj Kumar, Chow Vincent T K, Teow Shumein, Abrenica Bernard, Booth Stephanie A, Booth Timothy F, Mirazimi Ali, Lal Sunil K", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "reference": [ { "type": "PubMed", "id": "21637748", "url": "https://glygen.org/publication/PubMed/21637748" } ] }, { "title": "Protein phosphatase 2A (B55alpha) prevents premature activation of forkhead transcription factor FoxM1 by antagonizing cyclin A/cyclin-dependent kinase-mediated phosphorylation.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Alvarez-Fernandez M, Halim VA, Aprelia M, Laoukili J, Mohammed S, Medema RH", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "21813648", "url": "https://glygen.org/publication/PubMed/21813648" } ] }, { "title": "Dynamic remodeling of the actin cytoskeleton by FMNL1gamma is required for structural maintenance of the Golgi complex.", "journal": "Journal of cell science", "date": "2011", "authors": "Colon-Franco JM, Gomez TS, Billadeau DD", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "21868368", "url": "https://glygen.org/publication/PubMed/21868368" } ] }, { "title": "Regulation of sororin by Cdk1-mediated phosphorylation.", "journal": "Journal of cell science", "date": "2011", "authors": "Dreier MR, Bekier ME 2nd, Taylor WR", "evidence": [ { "database": "Reactome", "id": "R-HSA-2500257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2500257" } ], "reference": [ { "type": "PubMed", "id": "21878504", "url": "https://glygen.org/publication/PubMed/21878504" } ] }, { "title": "Interaction of Sororin protein with polo-like kinase 1 mediates resolution of chromosomal arm cohesion.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Zhang N, Panigrahi AK, Mao Q, Pati D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2500257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2500257" } ], "reference": [ { "type": "PubMed", "id": "21987589", "url": "https://glygen.org/publication/PubMed/21987589" } ] }, { "title": "An interaction network predicted from public data as a discovery tool: application to the Hsp90 molecular chaperone machine.", "journal": "PLoS ONE", "date": "2011", "authors": "Echeverr\u00eda Pablo C, Bernthaler Andreas, Dupuis Pierre, Mayer Bernd, Picard Didier", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "reference": [ { "type": "PubMed", "id": "22022502", "url": "https://glygen.org/publication/PubMed/22022502" } ] }, { "title": "Ablation of Smurf2 reveals an inhibition in TGF-beta signalling through multiple mono-ubiquitination of Smad3.", "journal": "The EMBO journal", "date": "2011", "authors": "Tang LY, Yamashita M, Coussens NP, Tang Y, Wang X, Li C, Deng CX, Cheng SY, Zhang YE", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173788", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173788" } ], "reference": [ { "type": "PubMed", "id": "22045334", "url": "https://glygen.org/publication/PubMed/22045334" } ] }, { "title": "POST, partner of stromal interaction molecule 1 (STIM1), targets STIM1 to multiple transporters.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2011", "authors": "Krapivinsky G, Krapivinsky L, Stotz SC, Manasian Y, Clapham DE", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "reference": [ { "type": "PubMed", "id": "22084111", "url": "https://glygen.org/publication/PubMed/22084111" } ] }, { "title": "The C terminus of formin FMNL3 accelerates actin polymerization and contains a WH2 domain-like sequence that binds both monomers and filament barbed ends.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Heimsath EG Jr, Higgs HN", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "22094460", "url": "https://glygen.org/publication/PubMed/22094460" } ] }, { "title": "GlcNAcylation of histone H2B facilitates its monoubiquitination.", "journal": "Nature", "date": "2011", "authors": "Fujiki R, Hashiba W, Sekine H, Yokoyama A, Chikanishi T, Ito S, Imai Y, Kim J, He HH, Igarashi K, Kanno J, Ohtake F, Kitagawa H, Roeder RG, Brown M, Kato S", "evidence": [ { "database": "O-GlcNAc Database", "id": "O14980", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14980" } ], "reference": [ { "type": "PubMed", "id": "22121020", "url": "https://glygen.org/publication/PubMed/22121020" } ] }, { "title": "Tyrosine phosphorylation of estradiol receptor by Src regulates its hormone-dependent nuclear export and cell cycle progression in breast cancer cells.", "journal": "Oncogene", "date": "2012", "authors": "Castoria G, Giovannelli P, Lombardi M, De Rosa C, Giraldi T, de Falco A, Barone MV, Abbondanza C, Migliaccio A, Auricchio F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "22266855", "url": "https://glygen.org/publication/PubMed/22266855" } ] }, { "title": "A self-reinforcing regulatory network triggered by limiting IL-7 activates pre-BCR signaling and differentiation.", "journal": "Nature immunology", "date": "2012", "authors": "Ochiai K, Maienschein-Cline M, Mandal M, Triggs JR, Bertolino E, Sciammas R, Dinner AR, Clark MR, Singh H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "22267219", "url": "https://glygen.org/publication/PubMed/22267219" } ] }, { "title": "Critical role of N-terminal end-localized nuclear export signal in regulation of activating transcription factor 2 (ATF2) subcellular localization and transcriptional activity.", "journal": "J. Biol. Chem.", "date": "2012", "authors": "Hsu Chih-Chao, Hu Chang-Deng", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "reference": [ { "type": "PubMed", "id": "22275354", "url": "https://glygen.org/publication/PubMed/22275354" } ] }, { "title": "The formin FMNL3 is a cytoskeletal regulator of angiogenesis.", "journal": "Journal of cell science", "date": "2012", "authors": "Hetheridge C, Scott AN, Swain RK, Copeland JW, Higgs HN, Bicknell R, Mellor H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "22275430", "url": "https://glygen.org/publication/PubMed/22275430" } ] }, { "title": "IGF2BP1 promotes cell migration by regulating MK5 and PTEN signaling.", "journal": "Genes & development", "date": "2012", "authors": "Stohr N, Kohn M, Lederer M, Glass M, Reinke C, Singer RH, Huttelmaier S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "22279049", "url": "https://glygen.org/publication/PubMed/22279049" } ] }, { "title": "XIAP monoubiquitylates Groucho/TLE to promote canonical Wnt signaling.", "journal": "Molecular cell", "date": "2012", "authors": "Hanson AJ, Wallace HA, Freeman TJ, Beauchamp RD, Lee LA, Lee E", "evidence": [ { "database": "Reactome", "id": "R-HSA-3769402", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3769402" } ], "reference": [ { "type": "PubMed", "id": "22304967", "url": "https://glygen.org/publication/PubMed/22304967" } ] }, { "title": "USP15 stabilizes TGF-beta receptor I and promotes oncogenesis through the activation of TGF-beta signaling in glioblastoma.", "journal": "Nature medicine", "date": "2012", "authors": "Eichhorn PJ, Rodon L, Gonzalez-Junca A, Dirac A, Gili M, Martinez-Saez E, Aura C, Barba I, Peg V, Prat A, Cuartas I, Jimenez J, Garcia-Dorado D, Sahuquillo J, Bernards R, Baselga J, Seoane J", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173788", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173788" } ], "reference": [ { "type": "PubMed", "id": "22344298", "url": "https://glygen.org/publication/PubMed/22344298" } ] }, { "title": "Characterization of nuclear import and export signals determining the subcellular localization of WD repeat-containing protein 42A (WDR42A).", "journal": "FEBS Lett.", "date": "2012", "authors": "Wu F, Wang S, Xing J, Li M, Zheng C", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "reference": [ { "type": "PubMed", "id": "22500989", "url": "https://glygen.org/publication/PubMed/22500989" } ] }, { "title": "ERK3 signals through SRC-3 coactivator to promote human lung cancer cell invasion.", "journal": "The Journal of clinical investigation", "date": "2012", "authors": "Long W, Foulds CE, Qin J, Liu J, Ding C, Lonard DM, Solis LM, Wistuba II, Qin J, Tsai SY, Tsai MJ, O'Malley BW", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "22505454", "url": "https://glygen.org/publication/PubMed/22505454" } ] }, { "title": "The extracellular signal-regulated kinase 3 (mitogen-activated protein kinase 6 [MAPK6])-MAPK-activated protein kinase 5 signaling complex regulates septin function and dendrite morphology.", "journal": "Molecular and cellular biology", "date": "2012", "authors": "Brand F, Schumacher S, Kant S, Menon MB, Simon R, Turgeon B, Britsch S, Meloche S, Gaestel M, Kotlyarov A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "22508986", "url": "https://glygen.org/publication/PubMed/22508986" } ] }, { "title": "FMNL2 drives actin-based protrusion and migration downstream of Cdc42.", "journal": "Current biology : CB", "date": "2012", "authors": "Block J, Breitsprecher D, Kuhn S, Winterhoff M, Kage F, Geffers R, Duwe P, Rohn JL, Baum B, Brakebusch C, Geyer M, Stradal TE, Faix J, Rottner K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "22608513", "url": "https://glygen.org/publication/PubMed/22608513" } ] }, { "title": "NMDAR signaling facilitates the IPO5-mediated nuclear import of CPEB3.", "journal": "Nucleic Acids Res.", "date": "2012", "authors": "Chao HW, Lai YT, Lu YL, Lin CL, Mai W, Huang YS", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "reference": [ { "type": "PubMed", "id": "22730302", "url": "https://glygen.org/publication/PubMed/22730302" } ] }, { "title": "Protein N-myristoylation is required for cellular morphological changes induced by two formin family proteins, FMNL2 and FMNL3.", "journal": "Bioscience, biotechnology, and biochemistry", "date": "2012", "authors": "Moriya K, Yamamoto T, Takamitsu E, Matsunaga Y, Kimoto M, Fukushige D, Kimoto C, Suzuki T, Utsumi T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "22790947", "url": "https://glygen.org/publication/PubMed/22790947" } ] }, { "title": "Tumour promoting and suppressing roles of the atypical MAP kinase signalling pathway ERK3/4-MK5.", "journal": "Journal of molecular signaling", "date": "2012", "authors": "Kostenko S, Dumitriu G, Moens U", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "22800433", "url": "https://glygen.org/publication/PubMed/22800433" } ] }, { "title": "HDAC8 mutations in Cornelia de Lange syndrome affect the cohesin acetylation cycle.", "journal": "Nature", "date": "2012", "authors": "Deardorff MA, Bando M, Nakato R, Watrin E, Itoh T, Minamino M, Saitoh K, Komata M, Katou Y, Clark D, Cole KE, De Baere E, Decroos C, Di Donato N, Ernst S, Francey LJ, Gyftodimou Y, Hirashima K, Hullings M, Ishikawa Y, Jaulin C, Kaur M, Kiyono T, Lombardi PM, Magnaghi-Jaulin L, Mortier GR, Nozaki N, Petersen MB, Seimiya H, Siu VM, Suzuki Y, Takagaki K, Wilde JJ, Willems PJ, Prigent C, Gillessen-Kaesbach G, Christianson DW, Kaiser FJ, Jackson LG, Hirota T, Krantz ID, Shirahige K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2500257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2500257" } ], "reference": [ { "type": "PubMed", "id": "22885700", "url": "https://glygen.org/publication/PubMed/22885700" } ] }, { "title": "Insulin-like growth factor 2 mRNA-binding proteins (IGF2BPs): post-transcriptional drivers of cancer progression?", "journal": "Cellular and molecular life sciences : CMLS", "date": "2013", "authors": "Bell JL, Wachter K, Muhleck B, Pazaitis N, Kohn M, Lederer M, Huttelmaier S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "23069990", "url": "https://glygen.org/publication/PubMed/23069990" } ] }, { "title": "HAX-1 is a nucleocytoplasmic shuttling protein with a possible role in mRNA processing.", "journal": "FEBS J.", "date": "2013", "authors": "Grzybowska Ewa A, Zayat Valery, Konopi\u0144ski Ryszard, Tr\u0119bi\u0144ska Alicja, Szwarc Maria, Sarnowska El\u017cbieta, Macech Ewelina, Korczy\u0144ski Jaros\u0142aw, Knapp Anna, Siedlecki Janusz A", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "reference": [ { "type": "PubMed", "id": "23164465", "url": "https://glygen.org/publication/PubMed/23164465" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" }, { "database": "iPTMnet", "id": "O14980", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14980" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "FMNL3 FH2-actin structure gives insight into formin-mediated actin nucleation and elongation.", "journal": "Nature structural & molecular biology", "date": "2013", "authors": "Thompson ME, Heimsath EG, Gauvin TJ, Higgs HN, Kull FJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "23222643", "url": "https://glygen.org/publication/PubMed/23222643" } ] }, { "title": "Proteome wide purification and identification of O-GlcNAc-modified proteins using click chemistry and mass spectrometry.", "journal": "Journal of proteome research", "date": "2013", "authors": "Hahne H, Sobotzki N, Nyberg T, Helm D, Borodkin VS, van Aalten DM, Agnew B, Kuster B", "evidence": [ { "database": "O-GlcNAc Database", "id": "O14980", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14980" } ], "reference": [ { "type": "PubMed", "id": "23301498", "url": "https://glygen.org/publication/PubMed/23301498" } ] }, { "title": "Phosphorylation of Crm1 by CDK1-cyclin-B promotes Ran-dependent mitotic spindle assembly.", "journal": "Journal of cell science", "date": "2013", "authors": "Wu Z, Jiang Q, Clarke PR, Zhang C", "evidence": [ { "database": "iPTMnet", "id": "O14980", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14980" } ], "reference": [ { "type": "PubMed", "id": "23729730", "url": "https://glygen.org/publication/PubMed/23729730" } ] }, { "title": "FMNL1 promotes proliferation and migration of leukemia cells.", "journal": "Journal of leukocyte biology", "date": "2013", "authors": "Favaro P, Traina F, Machado-Neto JA, Lazarini M, Lopes MR, Pereira JK, Costa FF, Infante E, Ridley AJ, Saad ST", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "23801653", "url": "https://glygen.org/publication/PubMed/23801653" } ] }, { "title": "MK5 activates Rag transcription via Foxo1 in developing B cells.", "journal": "The Journal of experimental medicine", "date": "2013", "authors": "Chow KT, Timblin GA, McWhirter SM, Schlissel MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "23878308", "url": "https://glygen.org/publication/PubMed/23878308" } ] }, { "title": "Estradiol and tamoxifen induce cell migration through GPR30 and activation of focal adhesion kinase (FAK) in endometrial cancers with low or without nuclear estrogen receptor alpha (ERalpha).", "journal": "PloS one", "date": "2013", "authors": "Tsai CL, Wu HM, Lin CY, Lin YJ, Chao A, Wang TH, Hsueh S, Lai CH, Wang HS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "24039841", "url": "https://glygen.org/publication/PubMed/24039841" } ] }, { "title": "beta-Catenin, a Sox2 binding partner, regulates the DNA binding and transcriptional activity of Sox2 in breast cancer cells.", "journal": "Cellular signalling", "date": "2014", "authors": "Ye X, Wu F, Wu C, Wang P, Jung K, Gopal K, Ma Y, Li L, Lai R", "evidence": [ { "database": "Reactome", "id": "R-HSA-3769402", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3769402" } ], "reference": [ { "type": "PubMed", "id": "24291232", "url": "https://glygen.org/publication/PubMed/24291232" } ] }, { "title": "Regulation of the neuronal transcription factor NPAS4 by REST and microRNAs.", "journal": "Biochimica et biophysica acta", "date": "2014", "authors": "Bersten DC, Wright JA, McCarthy PJ, Whitelaw ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-9768919", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9768919" } ], "reference": [ { "type": "PubMed", "id": "24291638", "url": "https://glygen.org/publication/PubMed/24291638" } ] }, { "title": "Phosphorylation of heat shock protein 40 (Hsp40/DnaJB1) by mitogen-activated protein kinase-activated protein kinase 5 (MK5/PRAK).", "journal": "The international journal of biochemistry & cell biology", "date": "2014", "authors": "Kostenko S, Jensen KL, Moens U", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "24309468", "url": "https://glygen.org/publication/PubMed/24309468" } ] }, { "title": "Human variants in the neuronal basic helix-loop-helix/Per-Arnt-Sim (bHLH/PAS) transcription factor complex NPAS4/ARNT2 disrupt function.", "journal": "PloS one", "date": "2014", "authors": "Bersten DC, Bruning JB, Peet DJ, Whitelaw ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-9768919", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9768919" } ], "reference": [ { "type": "PubMed", "id": "24465693", "url": "https://glygen.org/publication/PubMed/24465693" } ] }, { "title": "ERK3 promotes endothelial cell functions by upregulating SRC-3/SP1-mediated VEGFR2 expression.", "journal": "Journal of cellular physiology", "date": "2014", "authors": "Wang W, Bian K, Vallabhaneni S, Zhang B, Wu RC, O'Malley BW, Long W", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "24585635", "url": "https://glygen.org/publication/PubMed/24585635" } ] }, { "title": "Formins as effector proteins of Rho GTPases.", "journal": "Small GTPases", "date": "2014", "authors": "Kuhn S, Geyer M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "24914801", "url": "https://glygen.org/publication/PubMed/24914801" } ] }, { "title": "Heat shock protein 27 phosphorylation state is associated with cancer progression.", "journal": "Frontiers in genetics", "date": "2014", "authors": "Katsogiannou M, Andrieu C, Rocchi P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "25339975", "url": "https://glygen.org/publication/PubMed/25339975" } ] }, { "title": "The interaction of RNA helicase DDX3 with HIV-1 Rev-CRM1-RanGTP complex during the HIV replication cycle.", "journal": "PloS one", "date": "2015", "authors": "Mahboobi SH, Javanpour AA, Mofrad MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-165054", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-165054" } ], "reference": [ { "type": "PubMed", "id": "25723178", "url": "https://glygen.org/publication/PubMed/25723178" } ] }, { "title": "Microtubule association of EML proteins and the EML4-ALK variant 3 oncoprotein require an N-terminal trimerization domain.", "journal": "The Biochemical journal", "date": "2015", "authors": "Richards MW, O'Regan L, Roth D, Montgomery JM, Straube A, Fry AM, Bayliss R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648025", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648025" } ], "reference": [ { "type": "PubMed", "id": "25740311", "url": "https://glygen.org/publication/PubMed/25740311" } ] }, { "title": "EML4 promotes the loading of NUDC to the spindle for mitotic progression.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2015", "authors": "Chen D, Ito S, Yuan H, Hyodo T, Kadomatsu K, Hamaguchi M, Senga T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648025", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648025" } ], "reference": [ { "type": "PubMed", "id": "25789526", "url": "https://glygen.org/publication/PubMed/25789526" } ] }, { "title": "p27(Kip1) signaling: Transcriptional and post-translational regulation.", "journal": "The international journal of biochemistry & cell biology", "date": "2015", "authors": "Hnit SS, Xie C, Yao M, Holst J, Bensoussan A, De Souza P, Li Z, Dong Q", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "26279144", "url": "https://glygen.org/publication/PubMed/26279144" } ] }, { "title": "Comparative analysis of Cu (I)-catalyzed alkyne-azide cycloaddition (CuAAC) and strain-promoted alkyne-azide cycloaddition (SPAAC) in O-GlcNAc proteomics.", "journal": "Electrophoresis", "date": "2016", "authors": "Li S, Zhu H, Wang J, Wang X, Li X, Ma C, Wen L, Yu B, Wang Y, Li J, Wang PG", "evidence": [ { "database": "O-GlcNAc Database", "id": "O14980", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14980" } ], "reference": [ { "type": "PubMed", "id": "26853435", "url": "https://glygen.org/publication/PubMed/26853435" } ] }, { "title": "MAGED1 is a novel regulator of a select subset of bHLH PAS transcription factors.", "journal": "The FEBS journal", "date": "2016", "authors": "Sullivan AE, Peet DJ, Whitelaw ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-9768919", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9768919" } ], "reference": [ { "type": "PubMed", "id": "27472814", "url": "https://glygen.org/publication/PubMed/27472814" } ] }, { "title": "Detection and prognostic value of recurrent exportin 1 mutations in tumor and cell-free circulating DNA of patients with classical Hodgkin lymphoma.", "journal": "Haematologica", "date": "2016", "authors": "Camus V, Stamatoullas A, Mareschal S, Viailly PJ, Sarafan-Vasseur N, Bohers E, Dubois S, Picquenot JM, Ruminy P, Maingonnat C, Bertrand P, Cornic M, Tallon-Simon V, Becker S, Veresezan L, Frebourg T, Vera P, Bastard C, Tilly H, Jardin F", "evidence": [ { "database": "Entrez", "id": "7514", "url": "https://www.ncbi.nlm.nih.gov/gene/7514" } ], "reference": [ { "type": "PubMed", "id": "27479820", "url": "https://glygen.org/publication/PubMed/27479820" } ] }, { "title": "The emerging role of estrogen in B cell malignancies.", "journal": "Leukemia & lymphoma", "date": "2017", "authors": "Ladikou EE, Kassi E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "27557932", "url": "https://glygen.org/publication/PubMed/27557932" } ] }, { "title": "Heterozygous mutation of cysteine528 in XPO1 is sufficient for resistance to selective inhibitors of nuclear export.", "journal": "Oncotarget", "date": "2016", "authors": "Neggers JE, Vanstreels E, Baloglu E, Shacham S, Landesman Y, Daelemans D", "evidence": [ { "database": "Entrez", "id": "7514", "url": "https://www.ncbi.nlm.nih.gov/gene/7514" } ], "reference": [ { "type": "PubMed", "id": "27634897", "url": "https://glygen.org/publication/PubMed/27634897" } ] }, { "title": "Identification of a novel putative interaction partner of the nucleoporin ALADIN.", "journal": "Biology open", "date": "2016", "authors": "Juhlen R, Landgraf D, Huebner A, Koehler K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616" } ], "reference": [ { "type": "PubMed", "id": "27754849", "url": "https://glygen.org/publication/PubMed/27754849" } ] }, { "title": "Resveratrol regulates gene transcription via activation of stimulus-responsive transcription factors.", "journal": "Pharmacological research", "date": "2017", "authors": "Thiel G, Rossler OG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "28012964", "url": "https://glygen.org/publication/PubMed/28012964" } ] }, { "title": "Ligand and Target Discovery by Fragment-Based Screening in Human Cells.", "journal": "Cell", "date": "2017", "authors": "Parker CG, Galmozzi A, Wang Y, Correia BE, Sasaki K, Joslyn CM, Kim AS, Cavallaro CL, Lawrence RM, Johnson SR, Narvaiza I, Saez E, Cravatt BF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616" } ], "reference": [ { "type": "PubMed", "id": "28111073", "url": "https://glygen.org/publication/PubMed/28111073" } ] }, { "title": "A biochemical framework for eIF4E-dependent mRNA export and nuclear recycling of the export machinery.", "journal": "RNA", "date": "2017", "authors": "Volpon Laurent, Culjkovic-Kraljacic Biljana, Sohn Hye Seon, Blanchet-Cohen Alexis, Osborne Michael J, Borden Katherine L B", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "reference": [ { "type": "PubMed", "id": "28325843", "url": "https://glygen.org/publication/PubMed/28325843" } ] }, { "title": "A role for G-protein coupled estrogen receptor (GPER) in estrogen-induced carcinogenesis: Dysregulated glandular homeostasis, survival and metastasis.", "journal": "The Journal of steroid biochemistry and molecular biology", "date": "2018", "authors": "Filardo EJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "28595943", "url": "https://glygen.org/publication/PubMed/28595943" } ] }, { "title": "A triarylphosphine-trimethylpiperidine reagent for the one-step derivatization and enrichment of protein post-translational modifications and identification by mass spectrometry.", "journal": "Chemical communications (Cambridge, England)", "date": "2018", "authors": "Huo B, Zhang W, Zhao X, Dong H, Yu Y, Wang J, Qian X, Qin W", "evidence": [ { "database": "O-GlcNAc Database", "id": "O14980", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14980" }, { "database": "O-GlcNAc Atlas", "id": "O14980", "url": "https://oglcnac.org/atlas/detail/O14980" } ], "reference": [ { "type": "PubMed", "id": "30379171", "url": "https://glygen.org/publication/PubMed/30379171" } ] }, { "title": "Combinatorial regulation of hepatic cytoplasmic signaling and nuclear transcriptional events by the OGT/REV-ERBalpha complex.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2018", "authors": "Berthier A, Vinod M, Porez G, Steenackers A, Alexandre J, Yamakawa N, Gheeraert C, Ploton M, Marechal X, Dubois-Chevalier J, Hovasse A, Schaeffer-Reiss C, Cianferani S, Rolando C, Bray F, Duez H, Eeckhoute J, Lefebvre T, Staels B, Lefebvre P", "evidence": [ { "database": "O-GlcNAc Database", "id": "O14980", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14980" } ], "reference": [ { "type": "PubMed", "id": "30397120", "url": "https://glygen.org/publication/PubMed/30397120" } ] }, { "title": "Mitotic phosphorylation by NEK6 and NEK7 reduces the microtubule affinity of EML4 to promote chromosome congression.", "journal": "Science signaling", "date": "2019", "authors": "Adib R, Montgomery JM, Atherton J, O'Regan L, Richards MW, Straatman KR, Roth D, Straube A, Bayliss R, Moores CA, Fry AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648025", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648025" } ], "reference": [ { "type": "PubMed", "id": "31409757", "url": "https://glygen.org/publication/PubMed/31409757" } ] }, { "title": "Genomic Decoding of Neuronal Depolarization by Stimulus-Specific NPAS4 Heterodimers.", "journal": "Cell", "date": "2019", "authors": "Brigidi GS, Hayes MGB, Delos Santos NP, Hartzell AL, Texari L, Lin PA, Bartlett A, Ecker JR, Benner C, Heinz S, Bloodgood BL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9768919", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9768919" } ], "reference": [ { "type": "PubMed", "id": "31585079", "url": "https://glygen.org/publication/PubMed/31585079" } ] }, { "title": "PGRMC2 is an intracellular haem chaperone critical for adipocyte function.", "journal": "Nature", "date": "2019", "authors": "Galmozzi A, Kok BP, Kim AS, Montenegro-Burke JR, Lee JY, Spreafico R, Mosure S, Albert V, Cintron-Colon R, Godio C, Webb WR, Conti B, Solt LA, Kojetin D, Parker CG, Peluso JJ, Pru JK, Siuzdak G, Cravatt BF, Saez E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616" } ], "reference": [ { "type": "PubMed", "id": "31748741", "url": "https://glygen.org/publication/PubMed/31748741" } ] }, { "title": "Engineering a Proximity-Directed O-GlcNAc Transferase for Selective Protein O-GlcNAcylation in Cells.", "journal": "ACS chemical biology", "date": "2020", "authors": "Ramirez DH, Aonbangkhen C, Wu HY, Naftaly JA, Tang S, O'Meara TR, Woo CM", "evidence": [ { "database": "O-GlcNAc Database", "id": "O14980", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14980" } ], "reference": [ { "type": "PubMed", "id": "32119511", "url": "https://glygen.org/publication/PubMed/32119511" } ] }, { "title": "Heme induces human and mouse platelet activation through C-type-lectin-like receptor-2.", "journal": "Haematologica", "date": "2021", "authors": "Bourne JH, Colicchia M, Di Y, Martin E, Slater A, Roumenina LT, Dimitrov JD, Watson SP, Rayes J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616" } ], "reference": [ { "type": "PubMed", "id": "32354867", "url": "https://glygen.org/publication/PubMed/32354867" } ] }, { "title": "Identification of a Heme Activation Site on the MD-2/TLR4 Complex.", "journal": "Frontiers in immunology", "date": "2020", "authors": "Belcher JD, Zhang P, Nguyen J, Kiser ZM, Nath KA, Hu J, Trent JO, Vercellotti GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616" } ], "reference": [ { "type": "PubMed", "id": "32695117", "url": "https://glygen.org/publication/PubMed/32695117" } ] }, { "title": "The hippo kinase STK38 ensures functionality of XPO1.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2020-11", "authors": "Martin Alexandre Pj, Camonis Jacques H", "evidence": [ { "database": "iPTMnet", "id": "O14980", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14980" } ], "reference": [ { "type": "PubMed", "id": "33017560", "url": "https://glygen.org/publication/PubMed/33017560" } ] }, { "title": "Proteomic profiling and genome-wide mapping of O-GlcNAc chromatin-associated proteins reveal an O-GlcNAc-regulated genotoxic stress response.", "journal": "Nature communications", "date": "2020", "authors": "Liu Y, Chen Q, Zhang N, Zhang K, Dou T, Cao Y, Liu Y, Li K, Hao X, Xie X, Li W, Ren Y, Zhang J", "evidence": [ { "database": "O-GlcNAc Database", "id": "O14980", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14980" } ], "reference": [ { "type": "PubMed", "id": "33214551", "url": "https://glygen.org/publication/PubMed/33214551" } ] }, { "title": "Human heme oxygenase cDNA and induction of its mRNA by hemin.", "journal": "European journal of biochemistry", "date": "1988", "authors": "Yoshida T, Biro P, Cohen T, Muller RM, Shibahara S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616" } ], "reference": [ { "type": "PubMed", "id": "3345742", "url": "https://glygen.org/publication/PubMed/3345742" } ] }, { "title": "O-GlcNAc modification regulates MTA1 transcriptional activity during breast cancer cell genotoxic adaptation.", "journal": "Biochimica et biophysica acta. General subjects", "date": "2021", "authors": "Xie X, Wu Q, Zhang K, Liu Y, Zhang N, Chen Q, Wang L, Li W, Zhang J, Liu Y", "evidence": [ { "database": "O-GlcNAc Database", "id": "O14980", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14980" } ], "reference": [ { "type": "PubMed", "id": "34019948", "url": "https://glygen.org/publication/PubMed/34019948" } ] }, { "title": "Truncation of the TPR domain of OGT alters substrate and glycosite selection.", "journal": "Analytical and bioanalytical chemistry", "date": "2021", "authors": "Ramirez DH, Yang B, D'Souza AK, Shen D, Woo CM", "evidence": [ { "database": "O-GlcNAc Database", "id": "O14980", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14980" } ], "reference": [ { "type": "PubMed", "id": "34725712", "url": "https://glygen.org/publication/PubMed/34725712" } ] }, { "title": "O-GlcNAcylation promotes fatty acid synthase activity under nutritional stress as a pro-survival mechanism in cancer cells.", "journal": "Proteomics", "date": "2022", "authors": "Wong YK, Wang J, Lim TK, Lin Q, Yap CT, Shen HM", "evidence": [ { "database": "O-GlcNAc Database", "id": "O14980", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14980" } ], "reference": [ { "type": "PubMed", "id": "35083852", "url": "https://glygen.org/publication/PubMed/35083852" } ] }, { "title": "Spatiotemporal Activation of Protein O-GlcNAcylation in Living Cells.", "journal": "Journal of the American Chemical Society", "date": "2022", "authors": "He J, Fan Z, Tian Y, Yang W, Zhou Y, Zhu Q, Zhang W, Qin W, Yi W", "evidence": [ { "database": "O-GlcNAc Database", "id": "O14980", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14980" } ], "reference": [ { "type": "PubMed", "id": "35138101", "url": "https://glygen.org/publication/PubMed/35138101" } ] }, { "title": "Differential impact of exportin-1-mediated nuclear export of RNAs on the RNA content of extracellular vesicle subpopulations.", "journal": "Biologia futura", "date": "2023-06", "authors": "P\u00e1l\u00f3czi Krisztina, Buzas Edit I, Falus Andr\u00e1s", "evidence": [ { "database": "RefSeq", "id": "NP_003391", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003391" } ], "reference": [ { "type": "PubMed", "id": "37097386", "url": "https://glygen.org/publication/PubMed/37097386" } ] }, { "title": "Nuclear export of BATF2 enhances colorectal cancer proliferation through binding to CRM1.", "journal": "Clinical and translational medicine", "date": "2023-05", "authors": "Zhou Jie, Lei Zengjie, Chen Jianfang, Liao Shengbo, Chen Yanrong, Liu Chengxiang, Huang Shuo, Li Liuli, Zhang Yan, Wang Pei, Huang Yinghui, Li Jianjun, Liang Houjie", "evidence": [ { "database": "RefSeq", "id": "NP_003391", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003391" } ], "reference": [ { "type": "PubMed", "id": "37151195", "url": "https://glygen.org/publication/PubMed/37151195" } ] }, { "title": "Extracellular arginine availability modulates eIF2\u03b1 O-GlcNAcylation and heme oxygenase 1 translation for cellular homeostasis.", "journal": "Journal of biomedical science", "date": "2023-05-22", "authors": "Hung Yu-Wen, Ouyang Ching, Ping Xiaoli, Qi Yue, Wang Yi-Chang, Kung Hsing-Jien, Ann David K", "evidence": [ { "database": "O-GlcNAc Database", "id": "O14980", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14980" } ], "reference": [ { "type": "PubMed", "id": "37217939", "url": "https://glygen.org/publication/PubMed/37217939" } ] }, { "title": "Exportin 1 inhibition prevents neuroendocrine transformation through SOX2 down-regulation in lung and prostate cancers.", "journal": "Science translational medicine", "date": "2023-08-02", "authors": "Quintanal-Villalonga Alvaro, Durani Vidushi, Sabet Amin, Redin Esther, Kawasaki Kenta, Shafer Moniquetta, Karthaus Wouter R, Zaidi Samir, Zhan Yingqian A, Manoj Parvathy, Sridhar Harsha, Shah Nisargbhai S, Chow Andrew, Bhanot Umesh K, Linkov Irina, Asher Marina, Yu Helena A, Qiu Juan, de Stanchina Elisa, Patel Radhika A, Morrissey Colm, Haffner Michael C, Koche Richard P, Sawyers Charles L, Rudin Charles M", "evidence": [ { "database": "RefSeq", "id": "NP_003391", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003391" } ], "reference": [ { "type": "PubMed", "id": "37531417", "url": "https://glygen.org/publication/PubMed/37531417" } ] }, { "title": "XPO1-Mediated mRNA Export of Genome Maintenance Regulators Drives Chemotherapy Resistance in Aggressive Lymphoma.", "journal": "Cancer research", "date": "2024-01-02", "authors": "Knittel Gero, Reinhardt Hans Christian", "evidence": [ { "database": "RefSeq", "id": "NP_003391", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003391" } ], "reference": [ { "type": "PubMed", "id": "37902414", "url": "https://glygen.org/publication/PubMed/37902414" } ] }, { "title": "CRM1 expression: association with high prognostic value in laryngeal cancer.", "journal": "Turkish journal of medical sciences", "date": "2023-08", "authors": "\u00d6zda\u015f Talih, \u00d6zda\u015f Sibel, Canatar \u0130pek, Co\u015fgun Erdal, \u015eenyurt Elif Burcu, G\u00f6rg\u00fcl\u00fc Orhan", "evidence": [ { "database": "RefSeq", "id": "NP_003391", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003391" } ], "reference": [ { "type": "PubMed", "id": "38031942", "url": "https://glygen.org/publication/PubMed/38031942" } ] }, { "title": "Molecular cloning of a new member of the p21-Cdc42/Rac-activated kinase (PAK) family.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Manser E, Chong C, Zhao ZS, Leung T, Michael G, Hall C, Lim L", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "7559638", "url": "https://glygen.org/publication/PubMed/7559638" } ] }, { "title": "Journey to the surface of the cell: Fos regulation and the SRE.", "journal": "The EMBO journal", "date": "1995", "authors": "Treisman R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "7588619", "url": "https://glygen.org/publication/PubMed/7588619" } ] }, { "title": "Human cyclins B1 and B2 are localized to strikingly different structures: B1 to microtubules, B2 primarily to the Golgi apparatus.", "journal": "The EMBO journal", "date": "1995", "authors": "Jackman M, Firth M, Pines J", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "7737117", "url": "https://glygen.org/publication/PubMed/7737117" } ] }, { "title": "Effects of phosphorylation by CAK on cyclin binding by CDC2 and CDK2.", "journal": "Molecular and cellular biology", "date": "1995", "authors": "Desai D, Wessling HC, Fisher RP, Morgan DO", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "7799941", "url": "https://glygen.org/publication/PubMed/7799941" } ] }, { "title": "Modulation of cellular thermoresistance and actin filament stability accompanies phosphorylation-induced changes in the oligomeric structure of heat shock protein 27.", "journal": "Molecular and cellular biology", "date": "1995", "authors": "Lavoie JN, Lambert H, Hickey E, Weber LA, Landry J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "7799959", "url": "https://glygen.org/publication/PubMed/7799959" } ] }, { "title": "Human RanGTPase-activating protein RanGAP1 is a homologue of yeast Rna1p involved in mRNA processing and transport.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Bischoff FR, Krebber H, Kempf T, Hermes I, Ponstingl H", "evidence": [ { "database": "Reactome", "id": "R-HSA-165054", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-165054" } ], "reference": [ { "type": "PubMed", "id": "7878053", "url": "https://glygen.org/publication/PubMed/7878053" } ] }, { "title": "ERK phosphorylation potentiates Elk-1-mediated ternary complex formation and transactivation.", "journal": "The EMBO journal", "date": "1995", "authors": "Gille H, Kortenjann M, Thomae O, Moomaw C, Slaughter C, Cobb MH, Shaw PE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "7889942", "url": "https://glygen.org/publication/PubMed/7889942" } ] }, { "title": "The HIV-1 Rev trans-activator shuttles between the nucleus and the cytoplasm.", "journal": "Genes & development", "date": "1994", "authors": "Meyer BE, Malim MH", "evidence": [ { "database": "Reactome", "id": "R-HSA-165054", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-165054" } ], "reference": [ { "type": "PubMed", "id": "7958838", "url": "https://glygen.org/publication/PubMed/7958838" } ] }, { "title": "A brain serine/threonine protein kinase activated by Cdc42 and Rac1.", "journal": "Nature", "date": "1994", "authors": "Manser E, Leung T, Salihuddin H, Zhao ZS, Lim L", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "8107774", "url": "https://glygen.org/publication/PubMed/8107774" } ] }, { "title": "A small percentage of influenza virus M1 protein contains zinc but zinc does not influence in vitro M1-RNA interaction.", "journal": "The Journal of general virology", "date": "1994", "authors": "Elster C, Fourest E, Baudin F, Larsen K, Cusack S, Ruigrok RW", "evidence": [ { "database": "Reactome", "id": "R-HSA-168333", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168333" } ], "reference": [ { "type": "PubMed", "id": "8113738", "url": "https://glygen.org/publication/PubMed/8113738" } ] }, { "title": "Activation of p34cdc2 protein kinase by microinjection of human cdc25C into mammalian cells. Requirement for prior phosphorylation of cdc25C by p34cdc2 on sites phosphorylated at mitosis.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Strausfeld U, Fernandez A, Capony JP, Girard F, Lautredou N, Derancourt J, Labbe JC, Lamb NJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "8119945", "url": "https://glygen.org/publication/PubMed/8119945" } ] }, { "title": "The SRF accessory protein Elk-1 contains a growth factor-regulated transcriptional activation domain.", "journal": "Cell", "date": "1993", "authors": "Marais R, Wynne J, Treisman R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "8386592", "url": "https://glygen.org/publication/PubMed/8386592" } ] }, { "title": "Endothelial-cell heme uptake from heme proteins: induction of sensitization and desensitization to oxidant damage.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1993", "authors": "Balla J, Jacob HS, Balla G, Nath K, Eaton JW, Vercellotti GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616" } ], "reference": [ { "type": "PubMed", "id": "8415693", "url": "https://glygen.org/publication/PubMed/8415693" } ] }, { "title": "Human Wee1 kinase inhibits cell division by phosphorylating p34cdc2 exclusively on Tyr15.", "journal": "The EMBO journal", "date": "1993", "authors": "McGowan CH, Russell P", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "8428596", "url": "https://glygen.org/publication/PubMed/8428596" } ] }, { "title": "Dephosphorylation of human p34cdc2 kinase on both Thr-14 and Tyr-15 by human cdc25B phosphatase.", "journal": "FEBS letters", "date": "1993", "authors": "Honda R, Ohba Y, Nagata A, Okayama H, Yasuda H", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "8440392", "url": "https://glygen.org/publication/PubMed/8440392" } ] }, { "title": "Tyrosine kinase/p21ras/MAP-kinase pathway activation by estradiol-receptor complex in MCF-7 cells.", "journal": "The EMBO journal", "date": "1996", "authors": "Migliaccio A, Di Domenico M, Castoria G, de Falco A, Bontempo P, Nola E, Auricchio F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "8635462", "url": "https://glygen.org/publication/PubMed/8635462" } ] }, { "title": "HIV Rev uses a conserved cellular protein export pathway for the nucleocytoplasmic transport of viral RNAs.", "journal": "Current biology : CB", "date": "1996", "authors": "Fritz CC, Green MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-165054", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-165054" } ], "reference": [ { "type": "PubMed", "id": "8805303", "url": "https://glygen.org/publication/PubMed/8805303" } ] }, { "title": "Bach proteins belong to a novel family of BTB-basic leucine zipper transcription factors that interact with MafK and regulate transcription through the NF-E2 site.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Oyake T, Itoh K, Motohashi H, Hayashi N, Hoshino H, Nishizawa M, Yamamoto M, Igarashi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9707616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616" } ], "reference": [ { "type": "PubMed", "id": "8887638", "url": "https://glygen.org/publication/PubMed/8887638" } ] }, { "title": "The human Myt1 kinase preferentially phosphorylates Cdc2 on threonine 14 and localizes to the endoplasmic reticulum and Golgi complex.", "journal": "Molecular and cellular biology", "date": "1997", "authors": "Liu F, Stanton JJ, Wu Z, Piwnica-Worms H", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "9001210", "url": "https://glygen.org/publication/PubMed/9001210" } ] }, { "title": "The subcellular locations of p15(Ink4b) and p27(Kip1) coordinate their inhibitory interactions with cdk4 and cdk2.", "journal": "Genes & development", "date": "1997", "authors": "Reynisdottir I, Massague J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "9042862", "url": "https://glygen.org/publication/PubMed/9042862" } ] }, { "title": "The human homologue of yeast CRM1 is in a dynamic subcomplex with CAN/Nup214 and the novel nuclear pore component Nup88.", "journal": "EMBO J.", "date": "1997", "authors": "Fornerod M, van Deursen J, van Baal S, Reynolds A, Davis D, Murti KG, Fransen J, Grosveld G", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "reference": [ { "type": "PubMed", "id": "9049309", "url": "https://glygen.org/publication/PubMed/9049309" } ] }, { "title": "Ras links growth factor signaling to the cell cycle machinery via regulation of cyclin D1 and the Cdk inhibitor p27KIP1.", "journal": "Molecular and cellular biology", "date": "1997", "authors": "Aktas H, Cai H, Cooper GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "9199319", "url": "https://glygen.org/publication/PubMed/9199319" } ] }, { "title": "The MAD-related protein Smad7 associates with the TGFbeta receptor and functions as an antagonist of TGFbeta signaling.", "journal": "Cell", "date": "1997", "authors": "Hayashi H, Abdollah S, Qiu Y, Cai J, Xu YY, Grinnell BW, Richardson MA, Topper JN, Gimbrone MA Jr, Wrana JL, Falb D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173788", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173788" } ], "reference": [ { "type": "PubMed", "id": "9215638", "url": "https://glygen.org/publication/PubMed/9215638" } ] }, { "title": "Induction of p27Kip1 degradation and anchorage independence by Ras through the MAP kinase signaling pathway.", "journal": "Oncogene", "date": "1997", "authors": "Kawada M, Yamagoe S, Murakami Y, Suzuki K, Mizuno S, Uehara Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "9264403", "url": "https://glygen.org/publication/PubMed/9264403" } ] }, { "title": "Evidence for a role of CRM1 in signal-mediated nuclear protein export.", "journal": "Science (New York, N.Y.)", "date": "1997-10-03", "authors": "Ossareh-Nazari B, Bachelerie F, Dargemont C", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "reference": [ { "type": "PubMed", "id": "9311922", "url": "https://glygen.org/publication/PubMed/9311922" } ] }, { "title": "CRM1 is an export receptor for leucine-rich nuclear export signals.", "journal": "Cell", "date": "1997-09-19", "authors": "Fornerod M, Ohno M, Yoshida M, Mattaj I W", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "reference": [ { "type": "PubMed", "id": "9323133", "url": "https://glygen.org/publication/PubMed/9323133" } ] }, { "title": "Identification of Smad7, a TGFbeta-inducible antagonist of TGF-beta signalling.", "journal": "Nature", "date": "1997", "authors": "Nakao A, Afrakhte M, Moren A, Nakayama T, Christian JL, Heuchel R, Itoh S, Kawabata M, Heldin NE, Heldin CH, ten Dijke P", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173788", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173788" } ], "reference": [ { "type": "PubMed", "id": "9335507", "url": "https://glygen.org/publication/PubMed/9335507" } ] }, { "title": "Molecular cloning and cell cycle-dependent expression of mammalian CRM1, a protein involved in nuclear export of proteins.", "journal": "J. Biol. Chem.", "date": "1997", "authors": "Kudo N, Khochbin S, Nishi K, Kitano K, Yanagida M, Yoshida M, Horinouchi S", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "reference": [ { "type": "PubMed", "id": "9368044", "url": "https://glygen.org/publication/PubMed/9368044" } ] }, { "title": "Assembly of cyclin D-dependent kinase and titration of p27Kip1 regulated by mitogen-activated protein kinase kinase (MEK1).", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Cheng M, Sexl V, Sherr CJ, Roussel MF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634638", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638" } ], "reference": [ { "type": "PubMed", "id": "9448290", "url": "https://glygen.org/publication/PubMed/9448290" } ] }, { "title": "Interaction of Rac1 with GTPase-activating proteins and putative effectors. A comparison with Cdc42 and RhoA.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Zhang B, Chernoff J, Zheng Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "9535855", "url": "https://glygen.org/publication/PubMed/9535855" } ] }, { "title": "PRAK, a novel protein kinase regulated by the p38 MAP kinase.", "journal": "The EMBO journal", "date": "1998", "authors": "New L, Jiang Y, Zhao M, Liu K, Zhu W, Flood LJ, Kato Y, Parry GC, Han J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "9628874", "url": "https://glygen.org/publication/PubMed/9628874" } ] }, { "title": "The role of profilin in actin polymerization and nucleotide exchange.", "journal": "Biochemistry", "date": "1998", "authors": "Korenbaum E, Nordberg P, Bjorkegren-Sjogren C, Schutt CE, Lindberg U, Karlsson R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "9649308", "url": "https://glygen.org/publication/PubMed/9649308" } ] }, { "title": "Identification of Xenopus SMC protein complexes required for sister chromatid cohesion.", "journal": "Genes & development", "date": "1998", "authors": "Losada A, Hirano M, Hirano T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2500257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2500257" } ], "reference": [ { "type": "PubMed", "id": "9649503", "url": "https://glygen.org/publication/PubMed/9649503" } ] }, { "title": "MPF localization is controlled by nuclear export.", "journal": "The EMBO journal", "date": "1998", "authors": "Hagting A, Karlsson C, Clute P, Jackman M, Pines J", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "9670027", "url": "https://glygen.org/publication/PubMed/9670027" } ] }, { "title": "Control of cyclin B1 localization through regulated binding of the nuclear export factor CRM1.", "journal": "Genes & development", "date": "1998", "authors": "Yang J, Bardes ES, Moore JD, Brennan J, Powers MA, Kornbluth S", "evidence": [ { "database": "Reactome", "id": "R-HSA-69273", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273" } ], "reference": [ { "type": "PubMed", "id": "9679058", "url": "https://glygen.org/publication/PubMed/9679058" } ] }, { "title": "Cyclin D3: requirement for G1/S transition and high abundance in quiescent tissues suggest a dual role in proliferation and differentiation.", "journal": "Oncogene", "date": "1998", "authors": "Bartkova J, Lukas J, Strauss M, Bartek J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5687128", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128" } ], "reference": [ { "type": "PubMed", "id": "9747882", "url": "https://glygen.org/publication/PubMed/9747882" } ] }, { "title": "The specificity of the CRM1-Rev nuclear export signal interaction is mediated by RanGTP.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Askjaer P, Jensen TH, Nilsson J, Englmeier L, Kjems J", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" }, { "database": "Reactome", "id": "R-HSA-165054", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-165054" } ], "reference": [ { "type": "PubMed", "id": "9837918", "url": "https://glygen.org/publication/PubMed/9837918" } ] }, { "title": "Identification of STRAP, a novel WD domain protein in transforming growth factor-beta signaling.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Datta PK, Chytil A, Gorska AE, Moses HL", "evidence": [ { "database": "Reactome", "id": "R-HSA-2173788", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173788" } ], "reference": [ { "type": "PubMed", "id": "9856985", "url": "https://glygen.org/publication/PubMed/9856985" } ] }, { "title": "Structure, expression, and function of human pituitary tumor-transforming gene (PTTG).", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "1999", "authors": "Zhang X, Horwitz GA, Prezant TR, Valentini A, Nakashima M, Bronstein MD, Melmed S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2467813", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2467813" } ], "reference": [ { "type": "PubMed", "id": "9892021", "url": "https://glygen.org/publication/PubMed/9892021" } ] } ], "pathway": [ { "id": "hsa:7514", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:7514", "resource": "KEGG Pathway" }, { "id": "R-HSA-141430", "name": "Inactivation of APC/C via direct inhibition of the APC/C complex", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-141430", "resource": "Reactome", "description": "Inactivation of APC/C via direct inhibition of the APC/C complex" }, { "id": "R-HSA-141444", "name": "Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-141444", "resource": "Reactome", "description": "Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal" }, { "id": "R-HSA-165054", "name": "Rev-mediated nuclear export of HIV RNA", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-165054", "resource": "Reactome", "description": "Rev-mediated nuclear export of HIV RNA" }, { "id": "R-HSA-168333", "name": "NEP/NS2 Interacts with the Cellular Export Machinery", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-168333", "resource": "Reactome", "description": "NEP/NS2 Interacts with the Cellular Export Machinery" }, { "id": "R-HSA-2173788", "name": "Downregulation of TGF-beta receptor signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2173788", "resource": "Reactome", "description": "Downregulation of TGF-beta receptor signaling" }, { "id": "R-HSA-2467813", "name": "Separation of Sister Chromatids", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2467813", "resource": "Reactome", "description": "Separation of Sister Chromatids" }, { "id": "R-HSA-2500257", "name": "Resolution of Sister Chromatid Cohesion", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2500257", "resource": "Reactome", "description": "Resolution of Sister Chromatid Cohesion" }, { "id": "R-HSA-3769402", "name": "Deactivation of the beta-catenin transactivating complex", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3769402", "resource": "Reactome", "description": "Deactivation of the beta-catenin transactivating complex" }, { "id": "R-HSA-450520", "name": "HuR (ELAVL1) binds and stabilizes mRNA", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-450520", "resource": "Reactome", "description": "HuR (ELAVL1) binds and stabilizes mRNA" }, { "id": "R-HSA-5663220", "name": "RHO GTPases Activate Formins", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220", "resource": "Reactome", "description": "RHO GTPases Activate Formins" }, { "id": "R-HSA-5687128", "name": "MAPK6/MAPK4 signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5687128", "resource": "Reactome", "description": "MAPK6/MAPK4 signaling" }, { "id": "R-HSA-68877", "name": "Mitotic Prometaphase", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68877", "resource": "Reactome", "description": "Mitotic Prometaphase" }, { "id": "R-HSA-69273", "name": "Cyclin A/B1/B2 associated events during G2/M transition", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-69273", "resource": "Reactome", "description": "Cyclin A/B1/B2 associated events during G2/M transition" }, { "id": "R-HSA-9634638", "name": "Estrogen-dependent nuclear events downstream of ESR-membrane signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634638", "resource": "Reactome", "description": "Estrogen-dependent nuclear events downstream of ESR-membrane signaling" }, { "id": "R-HSA-9648025", "name": "EML4 and NUDC in mitotic spindle formation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648025", "resource": "Reactome", "description": "EML4 and NUDC in mitotic spindle formation" }, { "id": "R-HSA-9707616", "name": "Heme signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9707616", "resource": "Reactome", "description": "Heme signaling" }, { "id": "R-HSA-9768919", "name": "NPAS4 regulates expression of target genes", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9768919", "resource": "Reactome", "description": "NPAS4 regulates expression of target genes" }, { "id": "R-HSA-9828806", "name": "Maturation of hRSV A proteins", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9828806", "resource": "Reactome", "description": "Maturation of hRSV A proteins" } ], "orthologs": [ { "uniprot_canonical_ac": "P30822-1", "protein_name": "Exportin-1", "gene_name": "CRM1", "tax_id": 559292, "organism": "Saccharomyces cerevisiae S288C", "sequence": { "sequence": "MEGILDFSNDLDIALLDQVVSTFYQGSGVQQKQAQEILTKFQDNPDAWQKADQILQFSTNPQSKFIALSILDKLITRKWKLLPNDHRIGIRNFVVGMIISMCQDDEVFKTQKNLINKSDLTLVQILKQEWPQNWPEFIPELIGSSSSSVNVCENNMIVLKLLSEEVFDFSAEQMTQAKALHLKNSMSKEFEQIFKLCFQVLEQGSSSSLIVATLESLLRYLHWIPYRYIYETNILELLSTKFMTSPDTRAITLKCLTEVSNLKIPQDNDLIKRQTVLFFQNTLQQIATSVMPVTADLKATYANANGNDQSFLQDLAMFLTTYLARNRALLESDESLRELLLNAHQYLIQLSKIEERELFKTTLDYWHNLVADLFYEVQRLPATEMSPLIQLSVGSQAISTGSGALNPEYMKRFPLKKHIYEEICSQLRLVIIENMVRPEEVLVVENDEGEIVREFVKESDTIQLYKSEREVLVYLTHLNVIDTEEIMISKLARQIDGSEWSWHNINTLSWAIGSISGTMSEDTEKRFVVTVIKDLLDLTVKKRGKDNKAVVASDIMYVVGQYPRFLKAHWNFLRTVILKLFEFMHETHEGVQDMACDTFIKIVQKCKYHFVIQQPRESEPFIQTIIRDIQKTTADLQPQQVHTFYKACGIIISEERSVAERNRLLSDLMQLPNMAWDTIVEQSTANPTLLLDSETVKIIANIIKTNVAVCTSMGADFYPQLGHIYYNMLQLYRAVSSMISAQVAAEGLIATKTPKVRGLRTIKKEILKLVETYISKARNLDDVVKVLVEPLLNAVLEDYMNNVPDARDAEVLNCMTTVVEKVGHMIPQGVILILQSVFECTLDMINKDFTEYPEHRVEFYKLLKVINEKSFAAFLELPPAAFKLFVDAICWAFKHNNRDVEVNGLQIALDLVKNIERMGNVPFANEFHKNYFFIFVSETFFVLTDSDHKSGFSKQALLLMKLISLVYDNKISVPLYQEAEVPQGTSNQVYLSQYLANMLSNAFPHLTSEQIASFLSALTKQYKDLVVFKGTLRDFLVQIKEVGGDPTDYLFAEDKENALMEQNRLEREKAAKIGGLLKPSELDD", "length": 1084 }, "evidence": [ { "id": "O14980", "url": "https://omabrowser.org/oma/group/O14980/", "database": "OMA" } ], "common_name": "Yeast" }, { "uniprot_canonical_ac": "Q6P5F9-1", "protein_name": "Exportin-1", "gene_name": "Xpo1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MPAIMTMLADHAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAWTRVDTILEFSQNMNTKYYGLQILENVIKTRWKILPRNQCEGIKKYVVGLIIKTSSDPTCVEKEKVYIGKLNMILVQILKQEWPKHWPTFISDIVGASRTSESLCQNNMVILKLLSEEVFDFSSGQITQVKAKHLKDSMCNEFSQIFQLCQFVMENSQNAPLVHATLETLLRFLNWIPLGYIFETKLISTLIYKFLNVPMFRNVSLKCLTEIAGVSVSQYEEQFETLFTLTMMQLKQMLPLNTNIRLAYSNGKDDEQNFIQNLSLFLCTFLKEHGQLLEKRLNLREALMEALHYMLLVSEVEETEIFKICLEYWNHLAAELYRESPFSTSASPLLSGSQHFDIPPRRQLYLTVLSKVRLLMVSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYVDTEIIMTKKLQNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFVQVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDQTVQEHLIEKYMLLPNQVWDSIIQQATKNVDILKDPETVKQLGSILKTNVRACKAVGHPFVIQLGRIYLDMLNVYKCLSENISAAIQANGEMVTKQPLIRSMRTVKRETLKLISGWVSRSNDPQMVAENFVPPLLDAVLIDYQRNVPAAREPEVLSTMAIIVNKLGGHITAEIPQIFDAVFECTLNMINKDFEEYPEHRTNFFLLLQAVNSHCFPAFLAIPPAQFKLVLDSIIWAFKHTMRNVADTGLQILFTLLQNVAQEEAAAQSFYQTYFCDILQHIFSVVTDTSHTAGLTMHASILAYMFNLVEEGKISTPLNPGNPVNNQMFIQDYVANLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLVQIKEFAGEDTSDLFLEERETALRQAQEEKHKLQMSVPGILNPHEIPEEMCD", "length": 1071 }, "evidence": [ { "id": "45921570", "url": "http://www.informatics.jax.org/homology/45921570", "database": "MGI" }, { "id": "O14980", "url": "https://omabrowser.org/oma/group/O14980/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q80U96-1", "protein_name": "Exportin-1", "gene_name": "Xpo1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MPAIMTMLADHAARQLLDFSQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAWTRVDTILEFSQNMNTKYYGLQILENVIKTRWKILPRNQCEGIKKYVVGLIIKTSSDPTCVEKEKVYIGKLNMILVQILKQEWPKHWPTFISDIVGASRTSESLCQNNMVILKLLSEEVFDFSSGQITQVKAKHLKDSMCNEFSQIFQLCQFVMENSQNAPLVHATLETLLRFLNWIPLGYIFETKLISTLIYKFLNVPMFRNVSLKCLTEIAGVSVSQYEEQFETLFTLTMMQLKQMLPLNTNIRLAYSNGKDDEQNFIQNLSLFLCTFLKEHGQLLEKRLNLREALMEALHYMLLVSEVEETEIFKICLEYWNHLAAELYRESPFSTSASPLLSGSQHFDIPPRRQLYLTVLSKVRLLMVSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYVDTEIIMTKKLQNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAIIASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFVQVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDQTVQEHLIEKYMLLPNQVWDSIIQQATKNVDILKDPETVKQLGSILKTNVRACKAVGHPFVIQLGRIYLDMLNVYKCLSENISAAIQANGEMVTKQPLIRSMRTVKRETLKLISGWVSRSNDPQMVAENFVPPLLDAVLIDYQRNVPAAREPEVLSTMAIIVNKLGGHITAEIPQIFDAVFECTLNMINKDFEEYPEHRTNFFLLLQAVNSHCFPAFLAIPPAQFKLVLDSIIWAFKHTMRNVADTGLQILFTLLQNVAQEEAAAQSFYQTYFCDILQHIFSVVTDTSHTAGLTMHASILAYMFNLVEEGKISTPLNPGSPVSNQMFIQDYVANLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLVQIKEFAGEDTSDLFLEERETALRQAQEEKHKLQMSVPGILNPHEIPEEMCD", "length": 1071 }, "evidence": [ { "id": "45921570", "url": "http://www.informatics.jax.org/homology/45921570", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q9TVM2-1", "protein_name": "Exportin-1", "gene_name": "emb", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MATMLTSDEAGKLLDFSQKLDINLLDKIVEVVYTAQGEQLRLAQSILTTLKEHPEAWTRVDSILEYSQNQRTKFYALQILEEVIKTRWKVLPRNQCEGIKKYVVSLIIKTSSDPIVMEQNKVYLNKLNMILVHILKREWPRNWETFISDIVGASKTNESLCMNNMVILKNLSEEVFDFSQGQITQTKAKHLKDTMCSEFSQIFTLCSFVLENSMNAALIHVTLETLLRFLNWIPLGYIFETQQIETLIFKFLSVPMFRNVTLKCLSEIAGLTAANYDENFATLFKDTMVQLEQIVGQNMNMNHVFKHGSDTEQELVLNLAMFLCTFLKEHGKLVEDAKYVDYLNQALMYLVMISEVEDVEVFKICLEYWNSLVEDLYNSEFFHPTLESTKRQQVYPRRRFYAPILSKVRFIMISRMAKPEEVLVVENENGEVVREFMKDTNSINLYKNMRETLVFLTHLDSVDTDRIMTLKLLNQVNGSEFSWKNLNTLCWAIGSISGAFCEEDEKRFLVTVIKDLLGLCEQKKGKDNKAIIASNIMYVVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAIKCRRYFVTIQPNEACTFIDEILTTMSSIICDLQPQQVHTFYEAVGYMISAQVDQVQQDVLIERYMQLPNQVWDDIISRASKNVDFLKNMTAVKQLGSILKTNVAACKALGHAYVIQLGRIYLDMLNVYKITSENIIQAIEVNGVNVNNQPLIKTMHVVKKETLNLISEWVSRSNDNQLVMDNFIPPLLDAILLDYQRCKVPSAREPKVLSAMAIIVHKLRQHITNEVPKIFDAVFECTLDMINKNFEDFPQHRLSFYELLQAVNAHCFKAFLNIPPAQFKLVFDSVVWAFKHTMRNVADMGLNILFKMLQNLDQHPGAAQSFYQTYFTDILMQIFSVVTDTSHTAGLPNHAIILAYMFSLVENRKITVNLGPIPDNMIFIQEYVASLLKSAFTHLSDNQVKVFVTGLFNLDENVQAFKEHLRDFLIQIREATGEDDSDLYLEEREAALAEEQSNKHQMQRNIPGMLNPHELPEDMQDE", "length": 1063 }, "evidence": [ { "id": "O14980", "url": "https://omabrowser.org/oma/group/O14980/", "database": "OMA" } ], "common_name": "Fruit fly" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 14, "go_terms": [ { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "pmid": "" }, { "name": "nuclear membrane", "id": "GO:0031965", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031965", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "pmid": "" }, { "name": "intracellular membrane-bounded organelle", "id": "GO:0043231", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043231", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "pmid": "" }, { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "pmid": "" }, { "name": "nuclear envelope", "id": "GO:0005635", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005635", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "pmid": "" }, { "name": "nucleolus", "id": "GO:0005730", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005730", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "pmid": "" }, { "name": "kinetochore", "id": "GO:0000776", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000776", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "pmid": "" }, { "name": "Cajal body", "id": "GO:0015030", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015030", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "pmid": "" }, { "name": "protein-containing complex", "id": "GO:0032991", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032991", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "pmid": "" }, { "name": "ribonucleoprotein complex", "id": "GO:1990904", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990904", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "pmid": "" }, { "name": "annulate lamellae", "id": "GO:0005642", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005642", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "small GTPase binding", "id": "GO:0031267", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031267", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "pmid": "" }, { "name": "nuclear export signal receptor activity", "id": "GO:0005049", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005049", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "pmid": "" }, { "name": "RNA binding", "id": "GO:0003723", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003723", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 11, "go_terms": [ { "name": "protein export from nucleus", "id": "GO:0006611", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006611", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "pmid": "" }, { "name": "regulation of centrosome duplication", "id": "GO:0010824", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010824", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "pmid": "" }, { "name": "ribosomal large subunit export from nucleus", "id": "GO:0000055", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000055", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "pmid": "" }, { "name": "mRNA export from nucleus", "id": "GO:0006406", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006406", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "pmid": "" }, { "name": "nucleocytoplasmic transport", "id": "GO:0006913", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006913", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "pmid": "" }, { "name": "ribosome biogenesis", "id": "GO:0042254", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042254", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "pmid": "" }, { "name": "ribosomal subunit export from nucleus", "id": "GO:0000054", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000054", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "pmid": "" }, { "name": "protein localization to nucleus", "id": "GO:0034504", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034504", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "pmid": "" }, { "name": "regulation of proteasomal ubiquitin-dependent protein catabolic process", "id": "GO:0032434", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032434", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "pmid": "" }, { "name": "regulation of protein export from nucleus", "id": "GO:0046825", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046825", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "pmid": "" }, { "name": "ribosomal small subunit export from nucleus", "id": "GO:0000056", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000056", "evidence": [ { "database": "UniProtKB", "id": "O14980", "url": "https://www.uniprot.org/uniprot/O14980" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 262, "end_pos": 264, "annotation": "n_glycosylation_sequon" }, { "start_pos": 321, "end_pos": 323, "annotation": "n_glycosylation_sequon" }, { "start_pos": 485, "end_pos": 487, "annotation": "n_glycosylation_sequon" }, { "start_pos": 727, "end_pos": 729, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [ 89 ], "snv_sites": [ 74, 220, 303, 495, 769, 793, 890, 905 ], "glycation_sites": [], "phosphorylation_sites": [ 65, 78, 387, 389, 391, 395, 397, 448, 450, 454, 764, 1030, 1031, 1055 ], "sequon_annotation_sites": [ { "start_pos": 262, "end_pos": 264 }, { "start_pos": 321, "end_pos": 323 }, { "start_pos": 485, "end_pos": 487 }, { "start_pos": 727, "end_pos": 729 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 14 }, { "field": "total_sites", "count": 14 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 8 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 8 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 374 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }