{ "uniprot_canonical_ac": "O14950-1", "uniprot_ac": "O14950", "uniprot_id": "ML12B_HUMAN", "mass": { "chemical_mass": 19779.0, "monoisotopic_mass": 19779.0 }, "refseq": { "ac": "NP_001289978", "name": "myosin regulatory light chain 12A isoform 2", "summary": "This gene encodes a nonsarcomeric myosin regulatory light chain. This protein is activated by phosphorylation and regulates smooth muscle and non-muscle cell contraction. This protein may also be involved in DNA damage repair by sequestering the transcriptional regulator apoptosis-antagonizing transcription factor (AATF)/Che-1 which functions as a repressor of p53-driven apoptosis. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 8.[provided by RefSeq, Dec 2014].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001289978" }, "gene_names": [ { "name": "MYL12B", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O14950", "id": "O14950" }, { "name": "HEL-S-24; MLC-2B; MLCB; MRCL3; MRLC3; MYL2B", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001289978", "id": "NP_001289978" }, { "name": "MRLC2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O14950", "id": "O14950" }, { "name": "MYL12A", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001289978", "id": "NP_001289978" }, { "name": "MYLC2B", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O14950", "id": "O14950" } ], "protein_names": [ { "name": "Myosin regulatory light chain 12B", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O14950" }, { "name": "MLC-2A", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O14950" }, { "name": "MLC-2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O14950" }, { "name": "MLC20", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O14950" }, { "name": "Myosin regulatory light chain 2-B, smooth muscle isoform", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O14950" }, { "name": "Myosin regulatory light chain 20 kDa", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O14950" }, { "name": "Myosin regulatory light chain MRLC2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O14950" }, { "name": "SHUJUN-1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O14950" }, { "name": "myosin regulatory light chain 12A isoform 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001289978", "id": "NP_001289978" }, { "name": "myosin regulatory light chain 3; epididymis secretory protein Li 24; myosin regulatory light chain MRLC3; myosin regulatory light chain 12A; myosin, light polypeptide, regulatory, non-sarcomeric (20kD); myosin RLC; myosin regulatory light chain 2, nonsarcomeric; myosin, light chain 12A, regulatory, non-sarcomeric", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001289978", "id": "NP_001289978" } ], "function": [ { "annotation": "Myosin regulatory subunit that plays an important role in regulation of both smooth muscle and nonmuscle cell contractile activity via its phosphorylation. Phosphorylation triggers actin polymerization in vascular smooth muscle. Implicated in cytokinesis, receptor capping, and cell locomotion.", "evidence": [ { "database": "UniProtKB", "id": "O14950", "url": "https://www.uniprot.org/uniprot/O14950#function" }, { "database": "PubMed", "id": "10965042", "url": "https://glygen.org/publication/PubMed/10965042" } ] }, { "annotation": "This gene encodes a nonsarcomeric myosin regulatory light chain. This protein is activated by phosphorylation and regulates smooth muscle and non-muscle cell contraction. This protein may also be involved in DNA damage repair by sequestering the transcriptional regulator apoptosis-antagonizing transcription factor (AATF)/Che-1 which functions as a repressor of p53-driven apoptosis. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome 8.[provided by RefSeq, Dec 2014].", "evidence": [ { "database": "RefSeq", "id": "NP_001289978", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001289978" } ] } ], "disease": [], "snv": [], "mutagenesis": [ { "start_pos": 19, "end_pos": 20, "sequence_org": "TS", "sequence_mut": "AA", "comment": "Shows a decrease in the number of actin filament bundles.", "evidence": [ { "database": "UniProtKB", "id": "O14950", "url": "https://www.uniprot.org/uniprot/O14950" }, { "database": "PubMed", "id": "11942626", "url": "https://glygen.org/publication/PubMed/11942626" }, { "database": "PubMed", "id": "12429016", "url": "https://glygen.org/publication/PubMed/12429016" }, { "database": "PubMed", "id": "12589046", "url": "https://glygen.org/publication/PubMed/12589046" } ] }, { "start_pos": 19, "end_pos": 20, "sequence_org": "TS", "sequence_mut": "DD", "comment": "Shows a larger number of actin filament bundles.", "evidence": [ { "database": "UniProtKB", "id": "O14950", "url": "https://www.uniprot.org/uniprot/O14950" }, { "database": "PubMed", "id": "11942626", "url": "https://glygen.org/publication/PubMed/11942626" }, { "database": "PubMed", "id": "12429016", "url": "https://glygen.org/publication/PubMed/12429016" }, { "database": "PubMed", "id": "12589046", "url": "https://glygen.org/publication/PubMed/12589046" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "99.32", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000118680", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000118680" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "99.4", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000118680", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000118680" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "98.85", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000118680", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000118680" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "98.05", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000118680", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000118680" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "99.35", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000118680", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000118680" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "99.54", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000118680", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000118680" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "99.06", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000118680", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000118680" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "99.3", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000118680", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000118680" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "99.51", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000118680", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000118680" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "98.42", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000118680", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000118680" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "98.58", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000118680", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000118680" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "99.24", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000118680", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000118680" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "99.43", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000118680", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000118680" } ] } ], "expression_disease": [ { "significant": "No", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O14950", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14950" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O14950", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14950" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O14950", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14950" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O14950", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14950" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O14950", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14950" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O14950", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14950" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O14950", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14950" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O14950", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14950" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O14950", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14950" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O14950", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14950" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O14950", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14950" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O14950", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14950" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O14950", "url": "https://www.uniprot.org/uniprot/O14950" } ], "common_name": "Human" } ], "gene": [ { "name": "MYL12B", "url": "https://www.uniprot.org/uniprot/O14950", "locus": { "chromosome": "18", "start_pos": 3278461, "end_pos": 3261479, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000118680", "url": "https://www.ensembl.org/id/ENSG00000118680" } ] } } ], "crossref": [ { "id": "ENSG00000118680", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000118680", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00051", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00051", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL4295652", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL4295652", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "MYL12B", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=MYL12B", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "103910", "url": "https://www.ncbi.nlm.nih.gov/gene/103910", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "10627", "url": "https://www.ncbi.nlm.nih.gov/gene/10627", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "29827", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=29827", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O14950", "url": "https://www.ebi.ac.uk/intact/interactors/id:O14950*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR002048", "url": "https://www.ebi.ac.uk/interpro/entry/IPR002048", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR011992", "url": "https://www.ebi.ac.uk/interpro/entry/IPR011992", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR015070", "url": "https://www.ebi.ac.uk/interpro/entry/IPR015070", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018247", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018247", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:103910", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:103910", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "NX_O14950", "url": "https://www.nextprot.org/entry/NX_O14950", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "O14950", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14950", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "NTACRRE", "url": "https://omabrowser.org/oma/group/NTACRRE/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "312751at2759", "url": "http://www.orthodb.org/?query=312751at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR23049", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23049", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR23049:SF58", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR23049:SF58", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF08976", "url": "http://pfam.xfam.org/family/PF08976", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF13499", "url": "http://pfam.xfam.org/family/PF13499", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O14950", "url": "https://pharos.nih.gov/targets/O14950", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O14950", "url": "http://purl.obolibrary.org/obo/PR_O14950", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-3928663", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3928663", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-416572", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416572", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5625900", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625900", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5627117", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627117", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5627123", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627123", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001289978", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001289978", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "O14950", "url": "https://www.uniprot.org/uniprot/O14950", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O14950-1", "url": "https://www.uniprot.org/uniprot/O14950-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MSSKKAKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDAYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD", "length": 172, "header": "sp|O14950-1|ML12B_HUMAN Isoform 1 of Myosin regulatory light chain 12B OS=Homo sapiens OX=9606 GN=MYL12B PE=1 SV=2 CANONICAL=O14950-1" }, "isoforms": [ { "isoform_ac": "O14950-1", "url": "", "sequence": { "sequence": "MSSKKAKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDAYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD", "length": 172, "header": "sp|O14950-1|ML12B_HUMAN Isoform 1 of Myosin regulatory light chain 12B OS=Homo sapiens OX=9606 GN=MYL12B PE=1 SV=2 CANONICAL=O14950-1" }, "locus": { "chromosome": "18", "start_pos": 3277934, "end_pos": 3272899, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000237500.10", "url": "https://www.ensembl.org/id/ENST00000237500.10" }, { "database": "Ensembl Peptide", "id": "ENSP00000237500.5", "url": "https://www.ensembl.org/id/ENSP00000237500.5" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "O14950", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14950" }, { "id": "35008409", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35008409" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" } ] } ], "phosphorylation": [ { "start_pos": 10, "end_pos": 10, "kinase_uniprot_canonical_ac": "P17252-1", "kinase_gene_name": "PRKCA", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O14950", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14950" }, { "database": "PubMed", "id": "18835557", "url": "https://glygen.org/publication/PubMed/18835557" } ], "site_lbl": "Thr10" }, { "start_pos": 19, "end_pos": 19, "kinase_uniprot_canonical_ac": "O43293-1", "kinase_gene_name": "DAPK3", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O14950", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14950" }, { "database": "PubMed", "id": "10356987", "url": "https://glygen.org/publication/PubMed/10356987" }, { "database": "PubMed", "id": "1178183", "url": "https://glygen.org/publication/PubMed/1178183" }, { "database": "PubMed", "id": "12429016", "url": "https://glygen.org/publication/PubMed/12429016" } ], "site_lbl": "Thr19" }, { "start_pos": 19, "end_pos": 19, "kinase_uniprot_canonical_ac": "P17252-1", "kinase_gene_name": "PRKCA", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O14950", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14950" }, { "database": "PubMed", "id": "18835557", "url": "https://glygen.org/publication/PubMed/18835557" } ], "site_lbl": "Thr19" }, { "start_pos": 19, "end_pos": 19, "kinase_uniprot_canonical_ac": "Q12852-1", "kinase_gene_name": "MAP3K12", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O14950", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14950" }, { "database": "PubMed", "id": "11781833", "url": "https://glygen.org/publication/PubMed/11781833" } ], "site_lbl": "Thr19" }, { "start_pos": 19, "end_pos": 19, "kinase_uniprot_canonical_ac": "Q13418-1", "kinase_gene_name": "ILK", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O14950", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14950" }, { "database": "PubMed", "id": "11278951", "url": "https://glygen.org/publication/PubMed/11278951" } ], "site_lbl": "Thr19" }, { "start_pos": 19, "end_pos": 19, "kinase_uniprot_canonical_ac": "Q13464-1", "kinase_gene_name": "ROCK1", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O14950", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14950" }, { "database": "PubMed", "id": "12185584", "url": "https://glygen.org/publication/PubMed/12185584" } ], "site_lbl": "Thr19" }, { "start_pos": 19, "end_pos": 19, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "Phosphothreonine; by MLCK and ZIPK/DAPK3", "evidence": [ { "database": "UniProtKB", "id": "O14950", "url": "https://www.uniprot.org/uniprot/O14950" }, { "database": "iPTMnet", "id": "O14950", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14950" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" }, { "database": "PubMed", "id": "18212344", "url": "https://glygen.org/publication/PubMed/18212344" }, { "database": "PRO", "id": "O14950", "url": "http://purl.obolibrary.org/obo/O14950" }, { "database": "PubMed", "id": "12429016", "url": "https://glygen.org/publication/PubMed/12429016" }, { "database": "PubMed", "id": "15946647", "url": "https://glygen.org/publication/PubMed/15946647" }, { "database": "PubMed", "id": "11942626", "url": "https://glygen.org/publication/PubMed/11942626" } ], "site_lbl": "Thr19" }, { "start_pos": 20, "end_pos": 20, "kinase_uniprot_canonical_ac": "O43293-1", "kinase_gene_name": "DAPK3", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O14950", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14950" }, { "database": "PubMed", "id": "10356987", "url": "https://glygen.org/publication/PubMed/10356987" }, { "database": "PubMed", "id": "1178183", "url": "https://glygen.org/publication/PubMed/1178183" } ], "site_lbl": "Ser20" }, { "start_pos": 20, "end_pos": 20, "kinase_uniprot_canonical_ac": "P17252-1", "kinase_gene_name": "PRKCA", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O14950", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14950" }, { "database": "PubMed", "id": "18835557", "url": "https://glygen.org/publication/PubMed/18835557" } ], "site_lbl": "Ser20" }, { "start_pos": 20, "end_pos": 20, "kinase_uniprot_canonical_ac": "Q13418-1", "kinase_gene_name": "ILK", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O14950", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14950" }, { "database": "PubMed", "id": "11278951", "url": "https://glygen.org/publication/PubMed/11278951" } ], "site_lbl": "Ser20" }, { "start_pos": 20, "end_pos": 20, "kinase_uniprot_canonical_ac": "Q13464-1", "kinase_gene_name": "ROCK1", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O14950", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14950" }, { "database": "PubMed", "id": "12185584", "url": "https://glygen.org/publication/PubMed/12185584" } ], "site_lbl": "Ser20" }, { "start_pos": 20, "end_pos": 20, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by MLCK and ZIPK/DAPK3", "evidence": [ { "database": "UniProtKB", "id": "O14950", "url": "https://www.uniprot.org/uniprot/O14950" }, { "database": "iPTMnet", "id": "O14950", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14950" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" }, { "database": "PubMed", "id": "18212344", "url": "https://glygen.org/publication/PubMed/18212344" }, { "database": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" }, { "database": "PubMed", "id": "32387766", "url": "" }, { "database": "PRO", "id": "O14950", "url": "http://purl.obolibrary.org/obo/O14950" }, { "database": "PubMed", "id": "12429016", "url": "https://glygen.org/publication/PubMed/12429016" }, { "database": "PubMed", "id": "15946647", "url": "https://glygen.org/publication/PubMed/15946647" }, { "database": "PubMed", "id": "11942626", "url": "https://glygen.org/publication/PubMed/11942626" } ], "site_lbl": "Ser20" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Phosphorylation of non-muscle myosin II regulatory light chain by p21-activated kinase (gamma-PAK).", "journal": "Journal of muscle research and cell motility", "date": "1998", "authors": "Chew TL, Masaracchia RA, Goeckeler ZM, Wysolmerski RB", "evidence": [ { "database": "Reactome", "id": "R-HSA-5627123", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627123" } ], "reference": [ { "type": "PubMed", "id": "10047984", "url": "https://glygen.org/publication/PubMed/10047984" } ] }, { "title": "Inhibition of myosin light chain kinase by p21-activated kinase.", "journal": "Science (New York, N.Y.)", "date": "1999", "authors": "Sanders LC, Matsumura F, Bokoch GM, de Lanerolle P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5627123", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627123" } ], "reference": [ { "type": "PubMed", "id": "10092231", "url": "https://glygen.org/publication/PubMed/10092231" } ] }, { "title": "Cytoplasmic localization of human cdc25C during interphase requires an intact 14-3-3 binding site.", "journal": "Molecular and cellular biology", "date": "1999", "authors": "Dalal SN, Schweitzer CM, Gan J, DeCaprio JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "10330186", "url": "https://glygen.org/publication/PubMed/10330186" } ] }, { "title": "ZIP kinase identified as a novel myosin regulatory light chain kinase in HeLa cells.", "journal": "FEBS letters", "date": "1999", "authors": "Murata-Hori M, Suizu F, Iwasaki T, Kikuchi A, Hosoya H", "evidence": [ { "database": "iPTMnet", "id": "O14950", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14950" } ], "reference": [ { "type": "PubMed", "id": "10356987", "url": "https://glygen.org/publication/PubMed/10356987" } ] }, { "title": "p21-activated protein kinase: a crucial component of morphological signaling?", "journal": "Trends in biochemical sciences", "date": "1999", "authors": "Daniels RH, Bokoch GM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5627123", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627123" } ], "reference": [ { "type": "PubMed", "id": "10470034", "url": "https://glygen.org/publication/PubMed/10470034" } ] }, { "title": "The structural basis of Rho effector recognition revealed by the crystal structure of human RhoA complexed with the effector domain of PKN/PRK1.", "journal": "Molecular cell", "date": "1999", "authors": "Maesaki R, Ihara K, Shimizu T, Kuroda S, Kaibuchi K, Hakoshima T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "10619026", "url": "https://glygen.org/publication/PubMed/10619026" } ] }, { "title": "Endothelial cell retraction is induced by PAK2 monophosphorylation of myosin II.", "journal": "Journal of cell science", "date": "2000", "authors": "Zeng Q, Lagunoff D, Masaracchia R, Goeckeler Z, Cote G, Wysolmerski R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5627123", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627123" } ], "reference": [ { "type": "PubMed", "id": "10639334", "url": "https://glygen.org/publication/PubMed/10639334" } ] }, { "title": "Rho-associated kinase ROCK activates LIM-kinase 1 by phosphorylation at threonine 508 within the activation loop.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Ohashi K, Nagata K, Maekawa M, Ishizaki T, Narumiya S, Mizuno K", "evidence": [ { "database": "Reactome", "id": "R-HSA-416572", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416572" } ], "reference": [ { "type": "PubMed", "id": "10652353", "url": "https://glygen.org/publication/PubMed/10652353" } ] }, { "title": "Phosphorylation of myosin light chain kinase by p21-activated kinase PAK2.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Goeckeler ZM, Masaracchia RA, Zeng Q, Chew TL, Gallagher P, Wysolmerski RB", "evidence": [ { "database": "Reactome", "id": "R-HSA-5627123", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627123" } ], "reference": [ { "type": "PubMed", "id": "10748018", "url": "https://glygen.org/publication/PubMed/10748018" } ] }, { "title": "Rho GTPase control of protein kinase C-related protein kinase activation by 3-phosphoinositide-dependent protein kinase.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Flynn P, Mellor H, Casamassima A, Parker PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "10753910", "url": "https://glygen.org/publication/PubMed/10753910" } ] }, { "title": "Ephrin-A5 induces collapse of growth cones by activating Rho and Rho kinase.", "journal": "The Journal of cell biology", "date": "2000", "authors": "Wahl S, Barth H, Ciossek T, Aktories K, Mueller BK", "evidence": [ { "database": "Reactome", "id": "R-HSA-3928663", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3928663" } ], "reference": [ { "type": "PubMed", "id": "10769020", "url": "https://glygen.org/publication/PubMed/10769020" } ] }, { "title": "Phosphorylation of CPI-17, an inhibitor of myosin phosphatase, by protein kinase N.", "journal": "Biochemical and biophysical research communications", "date": "2000", "authors": "Hamaguchi T, Ito M, Feng J, Seko T, Koyama M, Machida H, Takase K, Amano M, Kaibuchi K, Hartshorne DJ, Nakano T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "10924361", "url": "https://glygen.org/publication/PubMed/10924361" } ] }, { "title": "Activation of actin-activated MgATPase activity of myosin II by phosphorylation with MAPK-activated protein kinase-1b (RSK-2).", "journal": "Journal of biochemistry", "date": "2000-09", "authors": "Suizu F, Ueda K, Iwasaki T, Murata-Hori M, Hosoya H", "evidence": [ { "database": "UniProtKB", "id": "O14950", "url": "https://www.uniprot.org/uniprot/O14950" } ], "reference": [ { "type": "PubMed", "id": "10965042", "url": "https://glygen.org/publication/PubMed/10965042" } ] }, { "title": "Structure of PAK1 in an autoinhibited conformation reveals a multistage activation switch.", "journal": "Cell", "date": "2000", "authors": "Lei M, Lu W, Meng W, Parrini MC, Eck MJ, Mayer BJ, Harrison SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5627123", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627123" } ], "reference": [ { "type": "PubMed", "id": "10975528", "url": "https://glygen.org/publication/PubMed/10975528" } ] }, { "title": "Mibefradil block of cloned T-type calcium channels.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "2000", "authors": "Martin RL, Lee JH, Cribbs LL, Perez-Reyes E, Hanck DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "10991994", "url": "https://glygen.org/publication/PubMed/10991994" } ] }, { "title": "Specific activation of LIM kinase 2 via phosphorylation of threonine 505 by ROCK, a Rho-dependent protein kinase.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Sumi T, Matsumoto K, Nakamura T", "evidence": [ { "database": "Reactome", "id": "R-HSA-416572", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416572" } ], "reference": [ { "type": "PubMed", "id": "11018042", "url": "https://glygen.org/publication/PubMed/11018042" } ] }, { "title": "PKN delays mitotic timing by inhibition of Cdc25C: possible involvement of PKN in the regulation of cell division.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2001", "authors": "Misaki K, Mukai H, Yoshinaga C, Oishi K, Isagawa T, Takahashi M, Ohsumi K, Kishimoto T, Ono Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "11134534", "url": "https://glygen.org/publication/PubMed/11134534" } ] }, { "title": "Rho GTPases in growth cone guidance.", "journal": "Current opinion in neurobiology", "date": "2001", "authors": "Dickson BJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3928663", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3928663" } ], "reference": [ { "type": "PubMed", "id": "11179879", "url": "https://glygen.org/publication/PubMed/11179879" } ] }, { "title": "NO-independent regulatory site on soluble guanylate cyclase.", "journal": "Nature", "date": "2001", "authors": "Stasch JP, Becker EM, Alonso-Alija C, Apeler H, Dembowsky K, Feurer A, Gerzer R, Minuth T, Perzborn E, Pleiss U, Schroder H, Schroeder W, Stahl E, Steinke W, Straub A, Schramm M", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "11242081", "url": "https://glygen.org/publication/PubMed/11242081" } ] }, { "title": "The mechanism of PAK activation. Autophosphorylation events in both regulatory and kinase domains control activity.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Chong C, Tan L, Lim L, Manser E", "evidence": [ { "database": "Reactome", "id": "R-HSA-5627123", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627123" } ], "reference": [ { "type": "PubMed", "id": "11278486", "url": "https://glygen.org/publication/PubMed/11278486" } ] }, { "title": "Ca2+-independent smooth muscle contraction. a novel function for integrin-linked kinase.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Deng JT, Van Lierop JE, Sutherland C, Walsh MP", "evidence": [ { "database": "iPTMnet", "id": "O14950", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14950" } ], "reference": [ { "type": "PubMed", "id": "11278951", "url": "https://glygen.org/publication/PubMed/11278951" } ] }, { "title": "Localization of human Cdc25C is regulated both by nuclear export and 14-3-3 protein binding.", "journal": "Oncogene", "date": "2001", "authors": "Graves PR, Lovly CM, Uy GL, Piwnica-Worms H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "11313932", "url": "https://glygen.org/publication/PubMed/11313932" } ] }, { "title": "Rho-kinase--mediated contraction of isolated stress fibers.", "journal": "The Journal of cell biology", "date": "2001", "authors": "Katoh K, Kano Y, Amano M, Onishi H, Kaibuchi K, Fujiwara K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "11331307", "url": "https://glygen.org/publication/PubMed/11331307" } ] }, { "title": "Molecular cloning and sequencing of myosin light chains in human megakaryoblastic leukemia cells.", "journal": "J. Smooth Muscle Res.", "date": "2001", "authors": "Watanabe M, Kohri M, Takaishi M, Horie R, Higashihara M", "evidence": [ { "database": "UniProtKB", "id": "O14950", "url": "https://www.uniprot.org/uniprot/O14950" } ], "reference": [ { "type": "PubMed", "id": "11436981", "url": "https://glygen.org/publication/PubMed/11436981" } ] }, { "title": "Invited review: cross-bridge regulation by thin filament-associated proteins.", "journal": "Journal of applied physiology (Bethesda, Md. : 1985)", "date": "2001", "authors": "Morgan KG, Gangopadhyay SS", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "11457814", "url": "https://glygen.org/publication/PubMed/11457814" } ] }, { "title": "The sarcolemmal proteins dysferlin and caveolin-3 interact in skeletal muscle.", "journal": "Human molecular genetics", "date": "2001", "authors": "Matsuda C, Hayashi YK, Ogawa M, Aoki M, Murayama K, Nishino I, Nonaka I, Arahata K, Brown RH Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "11532985", "url": "https://glygen.org/publication/PubMed/11532985" } ] }, { "title": "[Laboratory infections].", "journal": "Orvosi hetilap", "date": "1975", "authors": "Nikodemusz I", "evidence": [ { "database": "iPTMnet", "id": "O14950", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14950" } ], "reference": [ { "type": "PubMed", "id": "1178183", "url": "https://glygen.org/publication/PubMed/1178183" } ] }, { "title": "HeLa ZIP kinase induces diphosphorylation of myosin II regulatory light chain and reorganization of actin filaments in nonmuscle cells.", "journal": "Oncogene", "date": "2001", "authors": "Murata-Hori M, Fukuta Y, Ueda K, Iwasaki T, Hosoya H", "evidence": [ { "database": "iPTMnet", "id": "O14950", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14950" } ], "reference": [ { "type": "PubMed", "id": "11781833", "url": "https://glygen.org/publication/PubMed/11781833" } ] }, { "title": "Pak1 kinase homodimers are autoinhibited in trans and dissociated upon activation by Cdc42 and Rac1.", "journal": "Molecular cell", "date": "2002", "authors": "Parrini MC, Lei M, Harrison SC, Mayer BJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5627123", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627123" } ], "reference": [ { "type": "PubMed", "id": "11804587", "url": "https://glygen.org/publication/PubMed/11804587" } ] }, { "title": "Functional and biochemical analysis of endothelial (dys)function and NO/cGMP signaling in human blood vessels with and without nitroglycerin pretreatment.", "journal": "Circulation", "date": "2002", "authors": "Schulz E, Tsilimingas N, Rinze R, Reiter B, Wendt M, Oelze M, Woelken-Weckmuller S, Walter U, Reichenspurner H, Meinertz T, Munzel T", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "11889009", "url": "https://glygen.org/publication/PubMed/11889009" } ] }, { "title": "Diphosphorylated MRLC is required for organization of stress fibers in interphase cells and the contractile ring in dividing cells.", "journal": "Cell structure and function", "date": "2001", "authors": "Iwasaki T, Murata-Hori M, Ishitobi S, Hosoya H", "evidence": [ { "database": "UniProtKB", "id": "O14950", "url": "https://www.uniprot.org/uniprot/O14950" }, { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" }, { "database": "iPTMnet", "id": "O14950", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14950" } ], "reference": [ { "type": "PubMed", "id": "11942626", "url": "https://glygen.org/publication/PubMed/11942626" } ] }, { "title": "Identification of the enzymatic mechanism of nitroglycerin bioactivation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Chen Z, Zhang J, Stamler JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "12048254", "url": "https://glygen.org/publication/PubMed/12048254" } ] }, { "title": "Rho-kinase contributes to diphosphorylation of myosin II regulatory light chain in nonmuscle cells.", "journal": "Oncogene", "date": "2002", "authors": "Ueda K, Murata-Hori M, Tatsuka M, Hosoya H", "evidence": [ { "database": "Reactome", "id": "R-HSA-416572", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416572" }, { "database": "iPTMnet", "id": "O14950", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14950" } ], "reference": [ { "type": "PubMed", "id": "12185584", "url": "https://glygen.org/publication/PubMed/12185584" } ] }, { "title": "The semaphorin receptor plexin-B1 signals through a direct interaction with the Rho-specific nucleotide exchange factor, LARG.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Aurandt J, Vikis HG, Gutkind JS, Ahn N, Guan KL", "evidence": [ { "database": "Reactome", "id": "R-HSA-416572", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416572" } ], "reference": [ { "type": "PubMed", "id": "12196628", "url": "https://glygen.org/publication/PubMed/12196628" } ] }, { "title": "Filamin is essential in actin cytoskeletal assembly mediated by p21-activated kinase 1.", "journal": "Nature cell biology", "date": "2002", "authors": "Vadlamudi RK, Li F, Adam L, Nguyen D, Ohta Y, Stossel TP, Kumar R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5627123", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627123" } ], "reference": [ { "type": "PubMed", "id": "12198493", "url": "https://glygen.org/publication/PubMed/12198493" } ] }, { "title": "Interaction of plexin-B1 with PDZ domain-containing Rho guanine nucleotide exchange factors.", "journal": "Biochemical and biophysical research communications", "date": "2002", "authors": "Hirotani M, Ohoka Y, Yamamoto T, Nirasawa H, Furuyama T, Kogo M, Matsuya T, Inagaki S", "evidence": [ { "database": "Reactome", "id": "R-HSA-416572", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416572" } ], "reference": [ { "type": "PubMed", "id": "12220504", "url": "https://glygen.org/publication/PubMed/12220504" } ] }, { "title": "Phosphorylation of myosin II regulatory light chain is necessary for migration of HeLa cells but not for localization of myosin II at the leading edge.", "journal": "The Biochemical journal", "date": "2003", "authors": "Fumoto K, Uchimura T, Iwasaki T, Ueda K, Hosoya H", "evidence": [ { "database": "UniProtKB", "id": "O14950", "url": "https://www.uniprot.org/uniprot/O14950" }, { "database": "iPTMnet", "id": "O14950", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14950" } ], "reference": [ { "type": "PubMed", "id": "12429016", "url": "https://glygen.org/publication/PubMed/12429016" } ] }, { "title": "Cdc42/Rac1-dependent activation of the p21-activated kinase (PAK) regulates human platelet lamellipodia spreading: implication of the cortical-actin binding protein cortactin.", "journal": "Blood", "date": "2002", "authors": "Vidal C, Geny B, Melle J, Jandrot-Perrus M, Fontenay-Roupie M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5627123", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627123" } ], "reference": [ { "type": "PubMed", "id": "12453877", "url": "https://glygen.org/publication/PubMed/12453877" } ] }, { "title": "Myosin motors and not actin comets are mediators of the actin-based Golgi-to-endoplasmic reticulum protein transport.", "journal": "Molecular biology of the cell", "date": "2003", "authors": "Duran JM, Valderrama F, Castel S, Magdalena J, Tomas M, Hosoya H, Renau-Piqueras J, Malhotra V, Egea G", "evidence": [ { "database": "UniProtKB", "id": "O14950", "url": "https://www.uniprot.org/uniprot/O14950" } ], "reference": [ { "type": "PubMed", "id": "12589046", "url": "https://glygen.org/publication/PubMed/12589046" } ] }, { "title": "Direct interaction of Rnd1 with Plexin-B1 regulates PDZ-RhoGEF-mediated Rho activation by Plexin-B1 and induces cell contraction in COS-7 cells.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Oinuma I, Katoh H, Harada A, Negishi M", "evidence": [ { "database": "Reactome", "id": "R-HSA-416572", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416572" } ], "reference": [ { "type": "PubMed", "id": "12730235", "url": "https://glygen.org/publication/PubMed/12730235" } ] }, { "title": "Hyperosmotic-induced protein kinase N 1 activation in a vesicular compartment is dependent upon Rac1 and 3-phosphoinositide-dependent kinase 1.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Torbett NE, Casamassima A, Parker PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "12783890", "url": "https://glygen.org/publication/PubMed/12783890" } ] }, { "title": "Citron kinase, a Rho-dependent kinase, induces di-phosphorylation of regulatory light chain of myosin II.", "journal": "Molecular biology of the cell", "date": "2003", "authors": "Yamashiro S, Totsukawa G, Yamakita Y, Sasaki Y, Madaule P, Ishizaki T, Narumiya S, Matsumura F", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625900", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625900" } ], "reference": [ { "type": "PubMed", "id": "12802051", "url": "https://glygen.org/publication/PubMed/12802051" } ] }, { "title": "Dysferlin interacts with annexins A1 and A2 and mediates sarcolemmal wound-healing.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Lennon NJ, Kho A, Bacskai BJ, Perlmutter SL, Hyman BT, Brown RH Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "14506282", "url": "https://glygen.org/publication/PubMed/14506282" } ] }, { "title": "Molecular dissection of the interaction between the small G proteins Rac1 and RhoA and protein kinase C-related kinase 1 (PRK1).", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Owen D, Lowe PN, Nietlispach D, Brosnan CE, Chirgadze DY, Parker PJ, Blundell TL, Mott HR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "14514689", "url": "https://glygen.org/publication/PubMed/14514689" } ] }, { "title": "Merlin, the product of the Nf2 tumor suppressor gene, is an inhibitor of the p21-activated kinase, Pak1.", "journal": "Molecular cell", "date": "2003", "authors": "Kissil JL, Wilker EW, Johnson KC, Eckman MS, Yaffe MB, Jacks T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5627123", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627123" } ], "reference": [ { "type": "PubMed", "id": "14580336", "url": "https://glygen.org/publication/PubMed/14580336" } ] }, { "title": "Smooth muscle contraction and relaxation.", "journal": "Advances in physiology education", "date": "2003", "authors": "Webb RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "14627618", "url": "https://glygen.org/publication/PubMed/14627618" } ] }, { "title": "A clue to the therapy of neurofibromatosis type 2: NF2/merlin is a PAK1 inhibitor.", "journal": "Cancer journal (Sudbury, Mass.)", "date": "2004", "authors": "Hirokawa Y, Tikoo A, Huynh J, Utermark T, Hanemann CO, Giovannini M, Xiao GH, Testa JR, Wood J, Maruta H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5627123", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627123" } ], "reference": [ { "type": "PubMed", "id": "15000491", "url": "https://glygen.org/publication/PubMed/15000491" } ] }, { "title": "Association of CPI-17 with protein kinase C and casein kinase I.", "journal": "Biochemical and biophysical research communications", "date": "2004", "authors": "Zemlickova E, Johannes FJ, Aitken A, Dubois T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "15003508", "url": "https://glygen.org/publication/PubMed/15003508" } ] }, { "title": "Phosphoprotein inhibitor CPI-17 specificity depends on allosteric regulation of protein phosphatase-1 by regulatory subunits.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Eto M, Kitazawa T, Brautigan DL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "15184667", "url": "https://glygen.org/publication/PubMed/15184667" } ] }, { "title": "Plexin-B1/RhoGEF-mediated RhoA activation involves the receptor tyrosine kinase ErbB-2.", "journal": "The Journal of cell biology", "date": "2004", "authors": "Swiercz JM, Kuner R, Offermanns S", "evidence": [ { "database": "Reactome", "id": "R-HSA-416572", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416572" } ], "reference": [ { "type": "PubMed", "id": "15210733", "url": "https://glygen.org/publication/PubMed/15210733" } ] }, { "title": "Contribution of aldehyde dehydrogenase to mitochondrial bioactivation of nitroglycerin: evidence for the activation of purified soluble guanylate cyclase through direct formation of nitric oxide.", "journal": "The Biochemical journal", "date": "2005", "authors": "Kollau A, Hofer A, Russwurm M, Koesling D, Keung WM, Schmidt K, Brunner F, Mayer B", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "15377279", "url": "https://glygen.org/publication/PubMed/15377279" } ] }, { "title": "Serine 518 phosphorylation modulates merlin intramolecular association and binding to critical effectors important for NF2 growth suppression.", "journal": "Oncogene", "date": "2004", "authors": "Rong R, Surace EI, Haipek CA, Gutmann DH, Ye K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5627123", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627123" } ], "reference": [ { "type": "PubMed", "id": "15378014", "url": "https://glygen.org/publication/PubMed/15378014" } ] }, { "title": "Human platelet myosin light chain kinase requires the calcium-binding protein calmodulin for activity.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1979", "authors": "Hathaway DR, Adelstein RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "156362", "url": "https://glygen.org/publication/PubMed/156362" } ] }, { "title": "Involvement of protein kinase PKN1 in G2/M delay caused by arsenite.", "journal": "Molecular carcinogenesis", "date": "2005", "authors": "Isagawa T, Takahashi M, Kato T Jr, Mukai H, Ono Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "15791647", "url": "https://glygen.org/publication/PubMed/15791647" } ] }, { "title": "Eph-dependent tyrosine phosphorylation of ephexin1 modulates growth cone collapse.", "journal": "Neuron", "date": "2005", "authors": "Sahin M, Greer PL, Lin MZ, Poucher H, Eberhart J, Schmidt S, Wright TM, Shamah SM, O'connell S, Cowan CW, Hu L, Goldberg JL, Debant A, Corfas G, Krull CE, Greenberg ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-3928663", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3928663" } ], "reference": [ { "type": "PubMed", "id": "15848799", "url": "https://glygen.org/publication/PubMed/15848799" } ] }, { "title": "Epigallocatechin-3-O-gallate disrupts stress fibers and the contractile ring by reducing myosin regulatory light chain phosphorylation mediated through the target molecule 67 kDa laminin receptor.", "journal": "Biochemical and biophysical research communications", "date": "2005", "authors": "Umeda D, Tachibana H, Yamada K", "evidence": [ { "database": "UniProtKB", "id": "O14950", "url": "https://www.uniprot.org/uniprot/O14950" }, { "database": "iPTMnet", "id": "O14950", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14950" } ], "reference": [ { "type": "PubMed", "id": "15946647", "url": "https://glygen.org/publication/PubMed/15946647" } ] }, { "title": "Targeting and clustering citron to synapses.", "journal": "Molecular and cellular neurosciences", "date": "2006", "authors": "Zhang W, Benson DL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625900", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625900" } ], "reference": [ { "type": "PubMed", "id": "16202622", "url": "https://glygen.org/publication/PubMed/16202622" } ] }, { "title": "Regulation of the interaction of Pak2 with Cdc42 via autophosphorylation of serine 141.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Jung JH, Traugh JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5627123", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627123" } ], "reference": [ { "type": "PubMed", "id": "16204230", "url": "https://glygen.org/publication/PubMed/16204230" } ] }, { "title": "Regulation of LIM-kinase 1 and cofilin in thrombin-stimulated platelets.", "journal": "Blood", "date": "2006", "authors": "Pandey D, Goyal P, Bamburg JR, Siess W", "evidence": [ { "database": "Reactome", "id": "R-HSA-416572", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416572" } ], "reference": [ { "type": "PubMed", "id": "16219803", "url": "https://glygen.org/publication/PubMed/16219803" } ] }, { "title": "KIF14 and citron kinase act together to promote efficient cytokinesis.", "journal": "The Journal of cell biology", "date": "2006", "authors": "Gruneberg U, Neef R, Li X, Chan EH, Chalamalasetty RB, Nigg EA, Barr FA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625900", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625900" } ], "reference": [ { "type": "PubMed", "id": "16431929", "url": "https://glygen.org/publication/PubMed/16431929" } ] }, { "title": "Phosphorylation of cortactin by p21-activated kinase.", "journal": "Archives of biochemistry and biophysics", "date": "2006", "authors": "Webb BA, Zhou S, Eves R, Shen L, Jia L, Mak AS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5627123", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627123" } ], "reference": [ { "type": "PubMed", "id": "16854367", "url": "https://glygen.org/publication/PubMed/16854367" } ] }, { "title": "Bioactivation of nitroglycerin by the mitochondrial aldehyde dehydrogenase.", "journal": "Trends in cardiovascular medicine", "date": "2006", "authors": "Chen Z, Stamler JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "17055381", "url": "https://glygen.org/publication/PubMed/17055381" } ] }, { "title": "Novel ZIP kinase isoform lacks leucine zipper.", "journal": "Archives of biochemistry and biophysics", "date": "2006", "authors": "Takamoto N, Komatsu S, Komaba S, Niiro N, Ikebe M", "evidence": [ { "database": "UniProtKB", "id": "O14950", "url": "https://www.uniprot.org/uniprot/O14950" } ], "reference": [ { "type": "PubMed", "id": "17126281", "url": "https://glygen.org/publication/PubMed/17126281" } ] }, { "title": "Regulation of myosin II dynamics by phosphorylation and dephosphorylation of its light chain in epithelial cells.", "journal": "Molecular biology of the cell", "date": "2007", "authors": "Watanabe T, Hosoya H, Yonemura S", "evidence": [ { "database": "Reactome", "id": "R-HSA-416572", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416572" } ], "reference": [ { "type": "PubMed", "id": "17151359", "url": "https://glygen.org/publication/PubMed/17151359" } ] }, { "title": "Global proteomic profiling of phosphopeptides using electron transfer dissociation tandem mass spectrometry.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Molina H, Horn DM, Tang N, Mathivanan S, Pandey A", "evidence": [ { "database": "iPTMnet", "id": "O14950", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14950" } ], "reference": [ { "type": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" } ] }, { "title": "Up-regulation of myometrial RHO effector proteins (PKN1 and DIAPH1) and CPI-17 (PPP1R14A) phosphorylation in human pregnancy is associated with increased GTP-RHOA in spontaneous preterm labor.", "journal": "Biology of reproduction", "date": "2007", "authors": "Lartey J, Smith M, Pawade J, Strachan B, Mellor H, Lopez Bernal A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "17301291", "url": "https://glygen.org/publication/PubMed/17301291" } ] }, { "title": "The Rac1 polybasic region is required for interaction with its effector PRK1.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Modha R, Campbell LJ, Nietlispach D, Buhecha HR, Owen D, Mott HR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "18006505", "url": "https://glygen.org/publication/PubMed/18006505" } ] }, { "title": "ErbB-2 and met reciprocally regulate cellular signaling via plexin-B1.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Swiercz JM, Worzfeld T, Offermanns S", "evidence": [ { "database": "Reactome", "id": "R-HSA-416572", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416572" } ], "reference": [ { "type": "PubMed", "id": "18025083", "url": "https://glygen.org/publication/PubMed/18025083" } ] }, { "title": "Hydrophilic interaction chromatography reduces the complexity of the phosphoproteome and improves global phosphopeptide isolation and detection.", "journal": "Molecular & cellular proteomics : MCP", "date": "2008", "authors": "McNulty DE, Annan RS", "evidence": [ { "database": "iPTMnet", "id": "O14950", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14950" } ], "reference": [ { "type": "PubMed", "id": "18212344", "url": "https://glygen.org/publication/PubMed/18212344" } ] }, { "title": "Motif-specific sampling of phosphoproteomes.", "journal": "Journal of proteome research", "date": "2008", "authors": "Ruse CI, McClatchy DB, Lu B, Cociorva D, Motoyama A, Park SK, Yates JR 3rd", "evidence": [ { "database": "iPTMnet", "id": "O14950", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14950" } ], "reference": [ { "type": "PubMed", "id": "18452278", "url": "https://glygen.org/publication/PubMed/18452278" } ] }, { "title": "Smooth muscle type isoform of 20 kDa myosin light chain is expressed in monocyte/macrophage cell lineage.", "journal": "J. Smooth Muscle Res.", "date": "2008", "authors": "Higashihara Masaaki, Watanabe Mariko, Usuda Shigeki, Miyazaki Kouji", "evidence": [ { "database": "UniProtKB", "id": "O14950", "url": "https://www.uniprot.org/uniprot/O14950" } ], "reference": [ { "type": "PubMed", "id": "18480596", "url": "https://glygen.org/publication/PubMed/18480596" } ] }, { "title": "Validation of the p21-activated kinases as targets for inhibition in neurofibromatosis type 2.", "journal": "Cancer research", "date": "2008", "authors": "Yi C, Wilker EW, Yaffe MB, Stemmer-Rachamimov A, Kissil JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5627123", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627123" } ], "reference": [ { "type": "PubMed", "id": "18829550", "url": "https://glygen.org/publication/PubMed/18829550" } ] }, { "title": "The relaxant effect of okadaic acid on canine basilar artery involves activation of PKCalpha and phosphorylation of the myosin light chain at Thr-9.", "journal": "European journal of pharmacology", "date": "2008", "authors": "Obara K, Ito Y, Shimada H, Nakayama K", "evidence": [ { "database": "iPTMnet", "id": "O14950", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14950" } ], "reference": [ { "type": "PubMed", "id": "18835557", "url": "https://glygen.org/publication/PubMed/18835557" } ] }, { "title": "Molecular pharmacology of human Cav3.2 T-type Ca2+ channels: block by antihypertensives, antiarrhythmics, and their analogs.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "2009", "authors": "Perez-Reyes E, Van Deusen AL, Vitko I", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "18974361", "url": "https://glygen.org/publication/PubMed/18974361" } ] }, { "title": "Erbin and the NF2 tumor suppressor Merlin cooperatively regulate cell-type-specific activation of PAK2 by TGF-beta.", "journal": "Developmental cell", "date": "2009", "authors": "Wilkes MC, Repellin CE, Hong M, Bracamonte M, Penheiter SG, Borg JP, Leof EB", "evidence": [ { "database": "Reactome", "id": "R-HSA-5627123", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627123" } ], "reference": [ { "type": "PubMed", "id": "19289088", "url": "https://glygen.org/publication/PubMed/19289088" } ] }, { "title": "The molecular anatomy of caldesmon.", "journal": "The Biochemical journal", "date": "1991", "authors": "Marston SB, Redwood CS", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "1930128", "url": "https://glygen.org/publication/PubMed/1930128" } ] }, { "title": "Membrane repair defects in muscular dystrophy are linked to altered interaction between MG53, caveolin-3, and dysferlin.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Cai C, Weisleder N, Ko JK, Komazaki S, Sunada Y, Nishi M, Takeshima H, Ma J", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "19380584", "url": "https://glygen.org/publication/PubMed/19380584" } ] }, { "title": "Involvement of Rac/Cdc42/PAK pathway in cytoskeletal rearrangements.", "journal": "Acta biochimica Polonica", "date": "2009", "authors": "Szczepanowska J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5627123", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627123" } ], "reference": [ { "type": "PubMed", "id": "19513348", "url": "https://glygen.org/publication/PubMed/19513348" } ] }, { "title": "Regulation of the interaction between protein kinase C-related protein kinase 2 (PRK2) and its upstream kinase, 3-phosphoinositide-dependent protein kinase 1 (PDK1).", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Dettori R, Sonzogni S, Meyer L, Lopez-Garcia LA, Morrice NA, Zeuzem S, Engel M, Piiper A, Neimanis S, Frodin M, Biondi RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "19723632", "url": "https://glygen.org/publication/PubMed/19723632" } ] }, { "title": "Pak1 phosphorylation enhances cortactin-N-WASP interaction in clathrin-caveolin-independent endocytosis.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2010", "authors": "Grassart A, Meas-Yedid V, Dufour A, Olivo-Marin JC, Dautry-Varsat A, Sauvonnet N", "evidence": [ { "database": "Reactome", "id": "R-HSA-5627123", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627123" } ], "reference": [ { "type": "PubMed", "id": "20444238", "url": "https://glygen.org/publication/PubMed/20444238" } ] }, { "title": "Mechanistic studies of the autoactivation of PAK2: a two-step model of cis initiation followed by trans amplification.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Wang J, Wu JW, Wang ZX", "evidence": [ { "database": "Reactome", "id": "R-HSA-5627123", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627123" } ], "reference": [ { "type": "PubMed", "id": "21098037", "url": "https://glygen.org/publication/PubMed/21098037" } ] }, { "title": "Mutational analysis reveals a single binding interface between RhoA and its effector, PRK1.", "journal": "Biochemistry", "date": "2011", "authors": "Hutchinson CL, Lowe PN, McLaughlin SH, Mott HR, Owen D", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "21351730", "url": "https://glygen.org/publication/PubMed/21351730" } ] }, { "title": "Site recognition and substrate screens for PKN family proteins.", "journal": "The Biochemical journal", "date": "2011", "authors": "Collazos A, Michael N, Whelan RD, Kelly G, Mellor H, Pang LC, Totty N, Parker PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "21749319", "url": "https://glygen.org/publication/PubMed/21749319" } ] }, { "title": "p27(Kip1) controls cytokinesis via the regulation of citron kinase activation.", "journal": "The Journal of clinical investigation", "date": "2012", "authors": "Serres MP, Kossatz U, Chi Y, Roberts JM, Malek NP, Besson A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625900", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625900" } ], "reference": [ { "type": "PubMed", "id": "22293177", "url": "https://glygen.org/publication/PubMed/22293177" } ] }, { "title": "In vivo imaging of molecular interactions at damaged sarcolemma.", "journal": "Developmental cell", "date": "2012", "authors": "Roostalu U, Strahle U", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "22421042", "url": "https://glygen.org/publication/PubMed/22421042" } ] }, { "title": "Cinaciguat, a soluble guanylate cyclase activator, unloads the heart but also causes hypotension in acute decompensated heart failure.", "journal": "European heart journal", "date": "2013", "authors": "Erdmann E, Semigran MJ, Nieminen MS, Gheorghiade M, Agrawal R, Mitrovic V, Mebazaa A", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "22778174", "url": "https://glygen.org/publication/PubMed/22778174" } ] }, { "title": "Biphasic regulation of myosin light chain phosphorylation by p21-activated kinase modulates intestinal smooth muscle contractility.", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Chu J, Pham NT, Olate N, Kislitsyna K, Day MC, LeTourneau PA, Kots A, Stewart RH, Laine GA, Cox CS Jr, Uray K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5627123", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627123" } ], "reference": [ { "type": "PubMed", "id": "23161543", "url": "https://glygen.org/publication/PubMed/23161543" } ] }, { "title": "Citron kinase mediates transition from constriction to abscission through its coiled-coil domain.", "journal": "Journal of cell science", "date": "2013", "authors": "Watanabe S, De Zan T, Ishizaki T, Narumiya S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625900", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625900" } ], "reference": [ { "type": "PubMed", "id": "23444367", "url": "https://glygen.org/publication/PubMed/23444367" } ] }, { "title": "Citron kinase controls a molecular network required for midbody formation in cytokinesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2013", "authors": "Bassi ZI, Audusseau M, Riparbelli MG, Callaini G, D'Avino PP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625900", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625900" } ], "reference": [ { "type": "PubMed", "id": "23716662", "url": "https://glygen.org/publication/PubMed/23716662" } ] }, { "title": "Low threshold T-type calcium channels as targets for novel epilepsy treatments.", "journal": "British journal of clinical pharmacology", "date": "2014", "authors": "Powell KL, Cain SM, Snutch TP, O'Brien TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "23834404", "url": "https://glygen.org/publication/PubMed/23834404" } ] }, { "title": "Differential binding of RhoA, RhoB, and RhoC to protein kinase C-related kinase (PRK) isoforms PRK1, PRK2, and PRK3: PRKs have the highest affinity for RhoB.", "journal": "Biochemistry", "date": "2013", "authors": "Hutchinson CL, Lowe PN, McLaughlin SH, Mott HR, Owen D", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "24128008", "url": "https://glygen.org/publication/PubMed/24128008" } ] }, { "title": "Merlin sumoylation is required for its tumor suppressor activity.", "journal": "Oncogene", "date": "2014", "authors": "Qi Q, Liu X, Brat DJ, Ye K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5627123", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627123" } ], "reference": [ { "type": "PubMed", "id": "24166499", "url": "https://glygen.org/publication/PubMed/24166499" } ] }, { "title": "A Trio-Rac1-Pak1 signalling axis drives invadopodia disassembly.", "journal": "Nature cell biology", "date": "2014", "authors": "Moshfegh Y, Bravo-Cordero JJ, Miskolci V, Condeelis J, Hodgson L", "evidence": [ { "database": "Reactome", "id": "R-HSA-5627123", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627123" } ], "reference": [ { "type": "PubMed", "id": "24859002", "url": "https://glygen.org/publication/PubMed/24859002" } ] }, { "title": "Calcium channel blockers in cardiovascular pharmacotherapy.", "journal": "Journal of cardiovascular pharmacology and therapeutics", "date": "2014", "authors": "Godfraind T", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "24872348", "url": "https://glygen.org/publication/PubMed/24872348" } ] }, { "title": "Characterization and differential expression of human vascular smooth muscle myosin light chain 2 isoform in nonmuscle cells.", "journal": "Biochemistry", "date": "1989", "authors": "Kumar CC, Mohan SR, Zavodny PJ, Narula SK, Leibowitz PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "2526655", "url": "https://glygen.org/publication/PubMed/2526655" } ] }, { "title": "The Physiology, Pathology, and Pharmacology of Voltage-Gated Calcium Channels and Their Future Therapeutic Potential.", "journal": "Pharmacological reviews", "date": "2015", "authors": "Zamponi GW, Striessnig J, Koschak A, Dolphin AC", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "26362469", "url": "https://glygen.org/publication/PubMed/26362469" } ] }, { "title": "The distribution of heavy-chain isoforms of myosin in airways smooth muscle from adult and neonate humans.", "journal": "The Biochemical journal", "date": "1989", "authors": "Mohammad MA, Sparrow MP", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "2764880", "url": "https://glygen.org/publication/PubMed/2764880" } ] }, { "title": "Formation of Nitric Oxide by Aldehyde Dehydrogenase-2 Is Necessary and Sufficient for Vascular Bioactivation of Nitroglycerin.", "journal": "The Journal of biological chemistry", "date": "2016", "authors": "Opelt M, Eroglu E, Waldeck-Weiermair M, Russwurm M, Koesling D, Malli R, Graier WF, Fassett JT, Schrammel A, Mayer B", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "27679490", "url": "https://glygen.org/publication/PubMed/27679490" } ] }, { "title": "Direct comparison of tadalafil with sildenafil for the treatment of erectile dysfunction: a systematic review and meta-analysis.", "journal": "International urology and nephrology", "date": "2017", "authors": "Gong B, Ma M, Xie W, Yang X, Huang Y, Sun T, Luo Y, Huang J", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "28741090", "url": "https://glygen.org/publication/PubMed/28741090" } ] }, { "title": "Effects of phosphorylation of light chain residues threonine 18 and serine 19 on the properties and conformation of smooth muscle myosin.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Ikebe M, Koretz J, Hartshorne DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-416572", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416572" } ], "reference": [ { "type": "PubMed", "id": "2966156", "url": "https://glygen.org/publication/PubMed/2966156" } ] }, { "title": "Identification, phosphorylation, and dephosphorylation of a second site for myosin light chain kinase on the 20,000-dalton light chain of smooth muscle myosin.", "journal": "The Journal of biological chemistry", "date": "1986", "authors": "Ikebe M, Hartshorne DJ, Elzinga M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5627123", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627123" } ], "reference": [ { "type": "PubMed", "id": "3079756", "url": "https://glygen.org/publication/PubMed/3079756" } ] }, { "title": "Comparative O-GlcNAc Proteomic Analysis Reveals a Role of O-GlcNAcylated SAM68 in Lung Cancer Aggressiveness.", "journal": "Cancers", "date": "2022", "authors": "Lin CH, Liao CC, Wang SY, Peng CY, Yeh YC, Chen MY, Chou TY", "evidence": [ { "database": "O-GlcNAc Database", "id": "O14950", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14950" } ], "reference": [ { "type": "PubMed", "id": "35008409", "url": "https://glygen.org/publication/PubMed/35008409" } ] }, { "title": "Extracellular arginine availability modulates eIF2\u03b1 O-GlcNAcylation and heme oxygenase 1 translation for cellular homeostasis.", "journal": "Journal of biomedical science", "date": "2023-05-22", "authors": "Hung Yu-Wen, Ouyang Ching, Ping Xiaoli, Qi Yue, Wang Yi-Chang, Kung Hsing-Jien, Ann David K", "evidence": [ { "database": "O-GlcNAc Database", "id": "O14950", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14950" } ], "reference": [ { "type": "PubMed", "id": "37217939", "url": "https://glygen.org/publication/PubMed/37217939" } ] }, { "title": "Isoforms of myosin and actin in human, monkey and rat myometrium. Comparison of pregnant and non-pregnant uterus proteins.", "journal": "European journal of biochemistry", "date": "1986", "authors": "Cavaille F, Janmot C, Ropert S, d'Albis A", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "3780718", "url": "https://glygen.org/publication/PubMed/3780718" } ] }, { "title": "Phosphorylation of smooth muscle myosin at two distinct sites by myosin light chain kinase.", "journal": "The Journal of biological chemistry", "date": "1985", "authors": "Ikebe M, Hartshorne DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5627123", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627123" } ], "reference": [ { "type": "PubMed", "id": "3839510", "url": "https://glygen.org/publication/PubMed/3839510" } ] }, { "title": "Molecular cloning of a new member of the p21-Cdc42/Rac-activated kinase (PAK) family.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Manser E, Chong C, Zhao ZS, Leung T, Michael G, Hall C, Lim L", "evidence": [ { "database": "Reactome", "id": "R-HSA-5627123", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627123" } ], "reference": [ { "type": "PubMed", "id": "7559638", "url": "https://glygen.org/publication/PubMed/7559638" } ] }, { "title": "A brain serine/threonine protein kinase activated by Cdc42 and Rac1.", "journal": "Nature", "date": "1994", "authors": "Manser E, Leung T, Salihuddin H, Zhao ZS, Lim L", "evidence": [ { "database": "Reactome", "id": "R-HSA-5627123", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627123" } ], "reference": [ { "type": "PubMed", "id": "8107774", "url": "https://glygen.org/publication/PubMed/8107774" } ] }, { "title": "A novel partner for the GTP-bound forms of rho and rac.", "journal": "FEBS letters", "date": "1995", "authors": "Madaule P, Furuyashiki T, Reid T, Ishizaki T, Watanabe G, Morii N, Narumiya S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625900", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625900" } ], "reference": [ { "type": "PubMed", "id": "8543060", "url": "https://glygen.org/publication/PubMed/8543060" } ] }, { "title": "Regulation of myosin phosphatase by Rho and Rho-associated kinase (Rho-kinase)", "journal": "Science (New York, N.Y.)", "date": "1996", "authors": "Kimura K, Ito M, Amano M, Chihara K, Fukata Y, Nakafuku M, Yamamori B, Feng J, Nakano T, Okawa K, Iwamatsu A, Kaibuchi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "8662509", "url": "https://glygen.org/publication/PubMed/8662509" } ] }, { "title": "Phosphorylation and activation of myosin by Rho-associated kinase (Rho-kinase).", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Amano M, Ito M, Kimura K, Fukata Y, Chihara K, Nakano T, Matsuura Y, Kaibuchi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-416572", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416572" } ], "reference": [ { "type": "PubMed", "id": "8702756", "url": "https://glygen.org/publication/PubMed/8702756" } ] }, { "title": "Sildenafil: an orally active type 5 cyclic GMP-specific phosphodiesterase inhibitor for the treatment of penile erectile dysfunction.", "journal": "International journal of impotence research", "date": "1996", "authors": "Boolell M, Allen MJ, Ballard SA, Gepi-Attee S, Muirhead GJ, Naylor AM, Osterloh IH, Gingell C", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "8858389", "url": "https://glygen.org/publication/PubMed/8858389" } ] }, { "title": "Mitotic and G2 checkpoint control: regulation of 14-3-3 protein binding by phosphorylation of Cdc25C on serine-216.", "journal": "Science (New York, N.Y.)", "date": "1997", "authors": "Peng CY, Graves PR, Thoma RS, Wu Z, Shaw AS, Piwnica-Worms H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "9278512", "url": "https://glygen.org/publication/PubMed/9278512" } ] }, { "title": "Regulation of myosin phosphatase through phosphorylation of the myosin-binding subunit in platelet activation.", "journal": "Blood", "date": "1997", "authors": "Nakai K, Suzuki Y, Kihira H, Wada H, Fujioka M, Ito M, Nakano T, Kaibuchi K, Shiku H, Nishikawa M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "9354661", "url": "https://glygen.org/publication/PubMed/9354661" } ] }, { "title": "Cardiovascular T-type calcium channels: physiological and pharmacological significance.", "journal": "Journal of hypertension. Supplement : official journal of the International Society of Hypertension", "date": "1997", "authors": "Triggle DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "9481611", "url": "https://glygen.org/publication/PubMed/9481611" } ] }, { "title": "Interaction of Rac1 with GTPase-activating proteins and putative effectors. A comparison with Cdc42 and RhoA.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Zhang B, Chernoff J, Zheng Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5627123", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627123" } ], "reference": [ { "type": "PubMed", "id": "9535855", "url": "https://glygen.org/publication/PubMed/9535855" } ] }, { "title": "Effects of sildenafil on the relaxation of human corpus cavernosum tissue in vitro and on the activities of cyclic nucleotide phosphodiesterase isozymes.", "journal": "The Journal of urology", "date": "1998", "authors": "Ballard SA, Gingell CJ, Tang K, Turner LA, Price ME, Naylor AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "9598563", "url": "https://glygen.org/publication/PubMed/9598563" } ] }, { "title": "Sildenafil, a novel inhibitor of phosphodiesterase type 5 in human corpus cavernosum smooth muscle cells.", "journal": "Life sciences", "date": "1998", "authors": "Moreland RB, Goldstein I, Traish A", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "9600334", "url": "https://glygen.org/publication/PubMed/9600334" } ] }, { "title": "Translocation of cortactin to the cell periphery is mediated by the small GTPase Rac1.", "journal": "Journal of cell science", "date": "1998", "authors": "Weed SA, Du Y, Parsons JT", "evidence": [ { "database": "Reactome", "id": "R-HSA-5627123", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627123" } ], "reference": [ { "type": "PubMed", "id": "9683637", "url": "https://glygen.org/publication/PubMed/9683637" } ] }, { "title": "Citron rho-interacting kinase, a novel tissue-specific ser/thr kinase encompassing the Rho-Rac-binding protein Citron.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Di Cunto F, Calautti E, Hsiao J, Ong L, Topley G, Turco E, Dotto GP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625900", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625900" } ], "reference": [ { "type": "PubMed", "id": "9792683", "url": "https://glygen.org/publication/PubMed/9792683" } ] }, { "title": "YC-1 potentiates nitric oxide- and carbon monoxide-induced cyclic GMP effects in human platelets.", "journal": "Molecular pharmacology", "date": "1998", "authors": "Friebe A, Mullershausen F, Smolenski A, Walter U, Schultz G, Koesling D", "evidence": [ { "database": "Reactome", "id": "R-HSA-445355", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355" } ], "reference": [ { "type": "PubMed", "id": "9855623", "url": "https://glygen.org/publication/PubMed/9855623" } ] }, { "title": "Citron binds to PSD-95 at glutamatergic synapses on inhibitory neurons in the hippocampus.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "1999", "authors": "Zhang W, Vazquez L, Apperson M, Kennedy MB", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625900", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625900" } ], "reference": [ { "type": "PubMed", "id": "9870942", "url": "https://glygen.org/publication/PubMed/9870942" } ] }, { "title": "Citron, a Rho-target, interacts with PSD-95/SAP-90 at glutamatergic synapses in the thalamus.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "1999", "authors": "Furuyashiki T, Fujisawa K, Fujita A, Madaule P, Uchino S, Mishina M, Bito H, Narumiya S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625900", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625900" } ], "reference": [ { "type": "PubMed", "id": "9870943", "url": "https://glygen.org/publication/PubMed/9870943" } ] }, { "title": "A human homologue of the checkpoint kinase Cds1 directly inhibits Cdc25 phosphatase.", "journal": "Current biology : CB", "date": "1999", "authors": "Blasina A, de Weyer IV, Laus MC, Luyten WH, Parker AE, McGowan CH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "9889122", "url": "https://glygen.org/publication/PubMed/9889122" } ] }, { "title": "Loop 6 of RhoA confers specificity for effector binding, stress fiber formation, and cellular transformation.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Zong H, Raman N, Mickelson-Young LA, Atkinson SJ, Quilliam LA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5625740", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740" } ], "reference": [ { "type": "PubMed", "id": "9988689", "url": "https://glygen.org/publication/PubMed/9988689" } ] } ], "pathway": [ { "id": "hsa:103910", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:103910", "resource": "KEGG Pathway" }, { "id": "R-HSA-3928663", "name": "EPHA-mediated growth cone collapse", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3928663", "resource": "Reactome", "description": "EPHA-mediated growth cone collapse" }, { "id": "R-HSA-416572", "name": "Sema4D induced cell migration and growth-cone collapse", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416572", "resource": "Reactome", "description": "Sema4D induced cell migration and growth-cone collapse" }, { "id": "R-HSA-445355", "name": "Smooth Muscle Contraction", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445355", "resource": "Reactome", "description": "Smooth Muscle Contraction" }, { "id": "R-HSA-5625740", "name": "RHO GTPases activate PKNs", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625740", "resource": "Reactome", "description": "RHO GTPases activate PKNs" }, { "id": "R-HSA-5625900", "name": "RHO GTPases activate CIT", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5625900", "resource": "Reactome", "description": "RHO GTPases activate CIT" }, { "id": "R-HSA-5627117", "name": "RHO GTPases Activate ROCKs", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627117", "resource": "Reactome", "description": "RHO GTPases Activate ROCKs" }, { "id": "R-HSA-5627123", "name": "RHO GTPases activate PAKs", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5627123", "resource": "Reactome", "description": "RHO GTPases activate PAKs" } ], "orthologs": [ { "uniprot_canonical_ac": "P18666-1", "protein_name": "Myosin regulatory light chain 12B", "gene_name": "Myl12b", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MSSKKAKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDAYLDAMMNEAPGRINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD", "length": 172 }, "evidence": [ { "id": "45923836", "url": "http://www.informatics.jax.org/homology/45923836", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P19105-1", "protein_name": "Myosin regulatory light chain 12A", "gene_name": "MYL12A", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MSSKRTKTKTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDEYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD", "length": 171 }, "evidence": [ { "id": "45935035", "url": "http://www.informatics.jax.org/homology/45935035", "database": "MGI" }, { "id": "45923836", "url": "http://www.informatics.jax.org/homology/45923836", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q3THE2-1", "protein_name": "Myosin regulatory light chain 12B", "gene_name": "Myl12b", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MSSKKAKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDAYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD", "length": 172 }, "evidence": [ { "id": "45935035", "url": "http://www.informatics.jax.org/homology/45935035", "database": "MGI" }, { "id": "45923836", "url": "http://www.informatics.jax.org/homology/45923836", "database": "MGI" }, { "id": "O14950", "url": "https://omabrowser.org/oma/group/O14950/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 10, "go_terms": [ { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "O14950", "url": "https://www.uniprot.org/uniprot/O14950" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "O14950", "url": "https://www.uniprot.org/uniprot/O14950" } ], "pmid": "" }, { "name": "brush border", "id": "GO:0005903", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005903", "evidence": [ { "database": "UniProtKB", "id": "O14950", "url": "https://www.uniprot.org/uniprot/O14950" } ], "pmid": "" }, { "name": "cell cortex", "id": "GO:0005938", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005938", "evidence": [ { "database": "UniProtKB", "id": "O14950", "url": "https://www.uniprot.org/uniprot/O14950" } ], "pmid": "" }, { "name": "apical part of cell", "id": "GO:0045177", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045177", "evidence": [ { "database": "UniProtKB", "id": "O14950", "url": "https://www.uniprot.org/uniprot/O14950" } ], "pmid": "" }, { "name": "extracellular exosome", "id": "GO:0070062", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070062", "evidence": [ { "database": "UniProtKB", "id": "O14950", "url": "https://www.uniprot.org/uniprot/O14950" } ], "pmid": "" }, { "name": "stress fiber", "id": "GO:0001725", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001725", "evidence": [ { "database": "UniProtKB", "id": "O14950", "url": "https://www.uniprot.org/uniprot/O14950" } ], "pmid": "" }, { "name": "Z disc", "id": "GO:0030018", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030018", "evidence": [ { "database": "UniProtKB", "id": "O14950", "url": "https://www.uniprot.org/uniprot/O14950" } ], "pmid": "" }, { "name": "myofibril", "id": "GO:0030016", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030016", "evidence": [ { "database": "UniProtKB", "id": "O14950", "url": "https://www.uniprot.org/uniprot/O14950" } ], "pmid": "" }, { "name": "myosin II complex", "id": "GO:0016460", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016460", "evidence": [ { "database": "UniProtKB", "id": "O14950", "url": "https://www.uniprot.org/uniprot/O14950" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "calcium ion binding", "id": "GO:0005509", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005509", "evidence": [ { "database": "UniProtKB", "id": "O14950", "url": "https://www.uniprot.org/uniprot/O14950" } ], "pmid": "" }, { "name": "myosin heavy chain binding", "id": "GO:0032036", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032036", "evidence": [ { "database": "UniProtKB", "id": "O14950", "url": "https://www.uniprot.org/uniprot/O14950" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "regulation of cell shape", "id": "GO:0008360", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008360", "evidence": [ { "database": "UniProtKB", "id": "O14950", "url": "https://www.uniprot.org/uniprot/O14950" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 82, "end_pos": 84, "annotation": "n_glycosylation_sequon" }, { "start_pos": 95, "end_pos": 97, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Phosphorylation increases the actin-activated myosin ATPase activity and thereby regulates the contractile activity. It is required to generate the driving force in the migration of the cells but not necessary for localization of myosin-2 at the leading edge. Phosphorylation is reduced following epigallocatechin-3-O-gallate treatment.", "evidence": [ { "database": "UniProtKB", "id": "O14950", "url": "https://www.uniprot.org/uniprot/O14950" }, { "database": "PubMed", "id": "15946647", "url": "https://glygen.org/publication/PubMed/15946647" }, { "database": "PubMed", "id": "17126281", "url": "https://glygen.org/publication/PubMed/17126281" }, { "database": "PubMed", "id": "11942626", "url": "https://glygen.org/publication/PubMed/11942626" }, { "database": "PubMed", "id": "12429016", "url": "https://glygen.org/publication/PubMed/12429016" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [ 10, 19, 20 ], "sequon_annotation_sites": [ { "start_pos": 82, "end_pos": 84 }, { "start_pos": 95, "end_pos": 97 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 12 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 124 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }