{
"uniprot_canonical_ac": "O14939-1",
"uniprot_ac": "O14939",
"uniprot_id": "PLD2_HUMAN",
"mass": {
"chemical_mass": 105987.0,
"monoisotopic_mass": 105987.0
},
"refseq": {
"ac": "NP_001230037",
"name": "phospholipase D2 isoform PLD2B",
"summary": "The protein encoded by this gene catalyzes the hydrolysis of phosphatidylcholine to phosphatidic acid and choline. The activity of the encoded enzyme is enhanced by phosphatidylinositol 4,5-bisphosphate and ADP-ribosylation factor-1. This protein localizes to the peripheral membrane and may be involved in cytoskeletal organization, cell cycle control, transcriptional regulation, and/or regulated secretion. Two transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jul 2011].",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001230037"
},
"gene_names": [
{
"name": "PLD2",
"resource": "UniProtKB",
"type": "recommended",
"url": "https://www.uniprot.org/uniprot/O14939",
"id": "O14939"
},
{
"name": "PLD1C",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001230037",
"id": "NP_001230037"
},
{
"name": "PLD2",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001230037",
"id": "NP_001230037"
}
],
"protein_names": [
{
"name": "Phospholipase D2",
"resource": "UniProtKB",
"type": "recommended",
"url": "",
"id": "O14939"
},
{
"name": "3.1.4.4",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "O14939"
},
{
"name": "Choline phosphatase 2",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "O14939"
},
{
"name": "PLD 2",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "O14939"
},
{
"name": "PLD1C",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "O14939"
},
{
"name": "Phosphatidylcholine-hydrolyzing phospholipase D2",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "O14939"
},
{
"name": "choline phosphatase 2; phosphatidylcholine-hydrolyzing phospholipase D2",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001230037",
"id": "NP_001230037"
},
{
"name": "hPLD2",
"resource": "UniProtKB",
"type": "synonym",
"url": "",
"id": "O14939"
},
{
"name": "phospholipase D2 isoform PLD2B",
"resource": "RefSeq",
"type": "synonym",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001230037",
"id": "NP_001230037"
}
],
"function": [
{
"annotation": "Exosome Secretion and Epithelial-Mesenchymal Transition in Ovarian Cancer Are Regulated by Phospholipase D. Publication Status: Online-Only",
"evidence": [
{
"database": "RefSeq",
"id": "NP_001230037",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001230037"
},
{
"database": "PubMed",
"id": "36362078",
"url": "https://glygen.org/publication/PubMed/36362078"
}
]
},
{
"annotation": "Function as phospholipase selective for phosphatidylcholine (PubMed:9582313). May have a role in signal-induced cytoskeletal regulation and/or endocytosis (By similarity).",
"evidence": [
{
"database": "UniProtKB",
"id": "O14939",
"url": "https://www.uniprot.org/uniprot/O14939#function"
},
{
"database": "PubMed",
"id": "9582313",
"url": "https://glygen.org/publication/PubMed/9582313"
},
{
"database": "UniProtKB",
"id": "P97813",
"url": "https://www.uniprot.org/uniprot/P97813#function"
}
]
},
{
"annotation": "Identification and functional analysis of a novel phospholipase D2 gene mutation associated with familial systemic lupus erythematosus.', trans 'PLD2.",
"evidence": [
{
"database": "RefSeq",
"id": "NP_001230037",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001230037"
},
{
"database": "PubMed",
"id": "33927069",
"url": "https://glygen.org/publication/PubMed/33927069"
}
]
},
{
"annotation": "PLD2 deletion alleviates disruption of tight junctions in sepsis-induced ALI by regulating PA/STAT3 phosphorylation pathway.",
"evidence": [
{
"database": "RefSeq",
"id": "NP_001230037",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001230037"
},
{
"database": "PubMed",
"id": "36700766",
"url": "https://glygen.org/publication/PubMed/36700766"
}
]
},
{
"annotation": "Phospholipase D and cancer metastasis: A focus on exosomes. Review article",
"evidence": [
{
"database": "RefSeq",
"id": "NP_001230037",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001230037"
},
{
"database": "PubMed",
"id": "36272918",
"url": "https://glygen.org/publication/PubMed/36272918"
}
]
},
{
"annotation": "Phospholipase D2 is a positive regulator of sirtuin 1 and modulates p53-mediated apoptosis via sirtuin 1.",
"evidence": [
{
"database": "RefSeq",
"id": "NP_001230037",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001230037"
},
{
"database": "PubMed",
"id": "34471223",
"url": "https://glygen.org/publication/PubMed/34471223"
}
]
},
{
"annotation": "The protein encoded by this gene catalyzes the hydrolysis of phosphatidylcholine to phosphatidic acid and choline. The activity of the encoded enzyme is enhanced by phosphatidylinositol 4,5-bisphosphate and ADP-ribosylation factor-1. This protein localizes to the peripheral membrane and may be involved in cytoskeletal organization, cell cycle control, transcriptional regulation, and/or regulated secretion. Two transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Jul 2011].",
"evidence": [
{
"database": "RefSeq",
"id": "NP_001230037",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001230037"
}
]
}
],
"disease": [],
"snv": [],
"mutagenesis": [],
"expression_tissue": [
{
"tissue": {
"name": "Adult mammalian kidney",
"namespace": "UBERON",
"id": "0000082",
"url": "http://purl.obolibrary.org/obo/UBERON_0000082"
},
"score": "80.89",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000129219",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000129219"
}
]
},
{
"tissue": {
"name": "Oral cavity",
"namespace": "UBERON",
"id": "0000167",
"url": "http://purl.obolibrary.org/obo/UBERON_0000167"
},
"score": "82.34",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000129219",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000129219"
}
]
},
{
"tissue": {
"name": "Stomach",
"namespace": "UBERON",
"id": "0000945",
"url": "http://purl.obolibrary.org/obo/UBERON_0000945"
},
"score": "85.71",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000129219",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000129219"
}
]
},
{
"tissue": {
"name": "Uterus",
"namespace": "UBERON",
"id": "0000995",
"url": "http://purl.obolibrary.org/obo/UBERON_0000995"
},
"score": "86.19",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000129219",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000129219"
}
]
},
{
"tissue": {
"name": "Esophagus",
"namespace": "UBERON",
"id": "0001043",
"url": "http://purl.obolibrary.org/obo/UBERON_0001043"
},
"score": "90.55",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000129219",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000129219"
}
]
},
{
"tissue": {
"name": "Rectum",
"namespace": "UBERON",
"id": "0001052",
"url": "http://purl.obolibrary.org/obo/UBERON_0001052"
},
"score": "87.02",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000129219",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000129219"
}
]
},
{
"tissue": {
"name": "Colon",
"namespace": "UBERON",
"id": "0001155",
"url": "http://purl.obolibrary.org/obo/UBERON_0001155"
},
"score": "86.4",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000129219",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000129219"
}
]
},
{
"tissue": {
"name": "Urinary bladder",
"namespace": "UBERON",
"id": "0001255",
"url": "http://purl.obolibrary.org/obo/UBERON_0001255"
},
"score": "84.33",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000129219",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000129219"
}
]
},
{
"tissue": {
"name": "Thyroid gland",
"namespace": "UBERON",
"id": "0002046",
"url": "http://purl.obolibrary.org/obo/UBERON_0002046"
},
"score": "88.01",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000129219",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000129219"
}
]
},
{
"tissue": {
"name": "Lung",
"namespace": "UBERON",
"id": "0002048",
"url": "http://purl.obolibrary.org/obo/UBERON_0002048"
},
"score": "84.13",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000129219",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000129219"
}
]
},
{
"tissue": {
"name": "Liver",
"namespace": "UBERON",
"id": "0002107",
"url": "http://purl.obolibrary.org/obo/UBERON_0002107"
},
"score": "82.64",
"present": "MEDIUM",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000129219",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000129219"
}
]
},
{
"tissue": {
"name": "Prostate gland",
"namespace": "UBERON",
"id": "0002367",
"url": "http://purl.obolibrary.org/obo/UBERON_0002367"
},
"score": "93.83",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000129219",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000129219"
}
]
},
{
"tissue": {
"name": "Thoracic mammary gland",
"namespace": "UBERON",
"id": "0005200",
"url": "http://purl.obolibrary.org/obo/UBERON_0005200"
},
"score": "91.97",
"present": "HIGH",
"evidence": [
{
"database": "Bgee",
"id": "ENSG00000129219",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000129219"
}
]
}
],
"expression_disease": [
{
"significant": "Yes",
"trend": "down",
"name": "Prostate cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:10283",
"evidence": [
{
"database": "BioXpress",
"id": "O14939",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14939"
}
],
"disease": [
{
"disease_id": "DOID:10283",
"recommended_name": {
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate cancer",
"description": "A male reproductive organ cancer that is located_in the prostate."
},
"synonyms": [
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "NGP - new growth of prostate",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "hereditary prostate cancer",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "malignant tumor of the prostate",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate cancer, familial",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostate neoplasm",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostatic cancer",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "prostatic neoplasm",
"description": ""
},
{
"id": "DOID:10283",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10283",
"name": "tumor of the prostate",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "prostate cancer, hereditary, type 9",
"description": ""
},
{
"id": "MONDO:0012597",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012597",
"name": "HPC9",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, 12",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene."
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "EHBP1 familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "familial prostate cancer caused by mutation in EHBP1",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, 12",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "prostate cancer, hereditary, type 12",
"description": ""
},
{
"id": "MONDO:0012741",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012741",
"name": "HPC12",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "prostate cancer, hereditary, type 5",
"description": ""
},
{
"id": "MONDO:0012244",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012244",
"name": "HPC5",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, hereditary, type 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "prostate cancer, susceptibility to, 3",
"description": ""
},
{
"id": "MONDO:0012093",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012093",
"name": "HPC3",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, type 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, susceptibility to, 4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "HPC4",
"description": ""
},
{
"id": "MONDO:0012094",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012094",
"name": "prostate cancer, hereditary, on chromosome 7",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, 13",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene."
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "MSMB familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "familial prostate cancer caused by mutation in MSMB",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, 13",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "prostate cancer, hereditary, type 13",
"description": ""
},
{
"id": "MONDO:0012758",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012758",
"name": "HPC13",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, hereditary, type 8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "HPC8",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "predisposing for prostate cancer",
"description": ""
},
{
"id": "MONDO:0011270",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011270",
"name": "prostate cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, hereditary, type 6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "HPC6",
"description": ""
},
{
"id": "MONDO:0012300",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012300",
"name": "prostate cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "prostate cancer, hereditary, 10",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "HPC10",
"description": ""
},
{
"id": "MONDO:0012620",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012620",
"name": "prostate cancer, hereditary, 10",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "familial prostate carcinoma",
"description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma."
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "hereditary prostate cancer",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "hereditary prostate carcinoma",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, somatic",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, familial",
"description": ""
},
{
"id": "MONDO:0023122",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0023122",
"name": "prostate cancer, hereditary",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer, hereditary, 7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "HPC7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer, hereditary, 7",
"description": ""
},
{
"id": "MONDO:0012470",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012470",
"name": "prostate cancer aggressiveness",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, 1",
"description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene."
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "RNASEL familial prostate cancer",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "familial prostate cancer caused by mutation in RNASEL",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "prostate cancer, hereditary, type 1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "HPC1",
"description": ""
},
{
"id": "MONDO:0011098",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0011098",
"name": "Prca1",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "prostate cancer, hereditary, 11",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "HPC11",
"description": ""
},
{
"id": "MONDO:0012768",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012768",
"name": "prostate cancer, hereditary, 11",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "prostate cancer, hereditary, 14",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "HPC14",
"description": ""
},
{
"id": "MONDO:0012769",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012769",
"name": "prostate cancer, hereditary, 14",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "prostate cancer, hereditary, 15",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "HPC15",
"description": ""
},
{
"id": "MONDO:0012770",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012770",
"name": "prostate cancer, hereditary, 15",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer, hereditary, X-linked 1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "HPCX1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer, hereditary, X-linked 1",
"description": ""
},
{
"id": "MONDO:0010257",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010257",
"name": "prostate cancer susceptibility, X-linked",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "prostate cancer, hereditary, X-linked 2",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "HPCX2",
"description": ""
},
{
"id": "MONDO:0010405",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0010405",
"name": "prostate cancer, hereditary, X-linked 2",
"description": ""
},
{
"id": "MIM:611868",
"resource": "MIM",
"url": "https://www.omim.org/entry/611868",
"name": "Prostate cancer, hereditary, 12",
"description": "Prostate cancer, hereditary, 12"
},
{
"id": "MIM:611928",
"resource": "MIM",
"url": "https://www.omim.org/entry/611928",
"name": "Prostate cancer, hereditary, 13",
"description": "Prostate cancer, hereditary, 13"
},
{
"id": "MIM:176807",
"resource": "MIM",
"url": "https://www.omim.org/entry/176807",
"name": "Prostate cancer",
"description": "Prostate cancer"
},
{
"id": "MIM:601518",
"resource": "MIM",
"url": "https://www.omim.org/entry/601518",
"name": "Prostate cancer, hereditary, 1",
"description": "Prostate cancer, hereditary, 1"
},
{
"id": "MIM:611955",
"resource": "MIM",
"url": "https://www.omim.org/entry/611955",
"name": "Prostate cancer, hereditary, 11",
"description": "Prostate cancer, hereditary, 11"
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Stomach cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:10534",
"evidence": [
{
"database": "BioXpress",
"id": "O14939",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14939"
}
],
"disease": [
{
"disease_id": "DOID:10534",
"recommended_name": {
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "stomach cancer",
"description": "A gastrointestinal system cancer that is located_in the stomach."
},
"synonyms": [
{
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "gastric cancer",
"description": ""
},
{
"id": "DOID:10534",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:10534",
"name": "gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer",
"description": "A primary or metastatic malignant neoplasm involving the stomach."
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "Ca lesser curvature - stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "cancer of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer risk after h. pylori infection",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer, somatic",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric tumor",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant gastric tumour",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant stomach neoplasm",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of greater curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumor of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of greater curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of lesser curve of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant tumour of the stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "stomach cancer",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "Ca body - stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "ca greater curvature of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "malignant neoplasm of body of stomach",
"description": ""
},
{
"id": "MONDO:0001056",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001056",
"name": "gastric cancer, intestinal",
"description": ""
},
{
"id": "MIM:613659",
"resource": "MIM",
"url": "https://www.omim.org/entry/613659",
"name": "Gastric cancer",
"description": "Gastric cancer"
}
]
}
]
},
{
"significant": "No",
"trend": "up",
"name": "Urinary bladder cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:11054",
"evidence": [
{
"database": "BioXpress",
"id": "O14939",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14939"
}
],
"disease": [
{
"disease_id": "DOID:11054",
"recommended_name": {
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "urinary bladder cancer",
"description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder."
},
"synonyms": [
{
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "bladder cancer",
"description": ""
},
{
"id": "DOID:11054",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11054",
"name": "tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder cancer",
"description": "A primary or metastatic malignant neoplasm involving the bladder."
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "tumour of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "bladder cancer, somatic",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "cancer of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant bladder tumour",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm, bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant neoplasm, urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumor, urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of the bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of the urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant tumour of urinary bladder",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "malignant urinary bladder tumour",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder cancer",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant neoplasm",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant tumor",
"description": ""
},
{
"id": "MONDO:0001187",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0001187",
"name": "urinary bladder malignant tumour",
"description": ""
},
{
"id": "MIM:109800",
"resource": "MIM",
"url": "https://www.omim.org/entry/109800",
"name": "Bladder cancer",
"description": "Bladder cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Head and neck cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:11934",
"evidence": [
{
"database": "BioXpress",
"id": "O14939",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14939"
}
],
"disease": [
{
"disease_id": "DOID:11934",
"recommended_name": {
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck cancer",
"description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx."
},
"synonyms": [
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck neoplasm",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head and neck tumours",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "head/neck neoplasm",
"description": ""
},
{
"id": "DOID:11934",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:11934",
"name": "tumor of head and neck",
"description": ""
}
]
}
]
},
{
"significant": "No",
"trend": "up",
"name": "Lung cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1324",
"evidence": [
{
"database": "BioXpress",
"id": "O14939",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14939"
}
],
"disease": [
{
"disease_id": "DOID:1324",
"recommended_name": {
"id": "DOID:1324",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1324",
"name": "lung cancer",
"description": "A respiratory system cancer that is located_in the lung."
},
"synonyms": [
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility 1",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "LNCR1",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility",
"description": ""
},
{
"id": "MONDO:0012159",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012159",
"name": "lung cancer susceptibility 1",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "lung cancer susceptibility 3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "LNCR3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "lung cancer susceptibility 3",
"description": ""
},
{
"id": "MONDO:0012942",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012942",
"name": "adenocarcinoma of lung, susceptibility to",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "lung cancer susceptibility 4",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "LNCR4",
"description": ""
},
{
"id": "MONDO:0012955",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0012955",
"name": "lung cancer susceptibility 4",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "lung cancer susceptibility 5",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "LNCR5",
"description": ""
},
{
"id": "MONDO:0013631",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0013631",
"name": "lung cancer susceptibility 5",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer",
"description": "A malignant neoplasm involving the lung."
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "adenocarcinoma of lung, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "cancer of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, protection against, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, resistance to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung neoplasm",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung tumor",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant lung tumour",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant neoplasm of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant neoplasm of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumor of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumor of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumour of lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "malignant tumour of the lung",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, somatic",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "Nonsmall cell lung cancer",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "alveolar cell carcinoma",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung cancer, protection against",
"description": ""
},
{
"id": "MONDO:0008903",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0008903",
"name": "lung neoplasm",
"description": ""
},
{
"id": "MIM:211980",
"resource": "MIM",
"url": "https://www.omim.org/entry/211980",
"name": "Lung cancer",
"description": "Lung cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Breast cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1612",
"evidence": [
{
"database": "BioXpress",
"id": "O14939",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14939"
}
],
"disease": [
{
"disease_id": "DOID:1612",
"recommended_name": {
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "breast cancer",
"description": "A thoracic cancer that originates in the mammary gland."
},
"synonyms": [
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "breast tumor",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "malignant neoplasm of breast",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "malignant tumor of the breast",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "mammary cancer",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "mammary tumor",
"description": ""
},
{
"id": "DOID:1612",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1612",
"name": "primary breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast carcinoma",
"description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma."
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer susceptibility, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, lobular, somatic",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, protection against, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, somatic",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial breast carcinoma",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial cancer of breast",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "familial cancer of the breast",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast cancer",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "hereditary breast carcinoma",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, familial",
"description": ""
},
{
"id": "MONDO:0016419",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0016419",
"name": "breast cancer, familial Male",
"description": ""
},
{
"id": "MIM:114480",
"resource": "MIM",
"url": "https://www.omim.org/entry/114480",
"name": "Breast cancer",
"description": "Breast cancer"
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Thyroid cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:1781",
"evidence": [
{
"database": "BioXpress",
"id": "O14939",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14939"
}
],
"disease": [
{
"disease_id": "DOID:1781",
"recommended_name": {
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid cancer",
"description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage."
},
"synonyms": [
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid gland cancer",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "Thyroid gland neoplasm",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "malignant neoplasm of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "malignant tumour of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "neoplasm of thyroid gland",
"description": ""
},
{
"id": "DOID:1781",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:1781",
"name": "thyroid neoplasm",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "up",
"name": "Kidney cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:263",
"evidence": [
{
"database": "BioXpress",
"id": "O14939",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14939"
}
],
"disease": [
{
"disease_id": "DOID:263",
"recommended_name": {
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "kidney cancer",
"description": "A urinary system cancer that is located_in the kidney."
},
"synonyms": [
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "malignant neoplasm of kidney except pelvis",
"description": ""
},
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "malignant tumour of kidney",
"description": ""
},
{
"id": "DOID:263",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:263",
"name": "renal cancer",
"description": ""
}
]
}
]
},
{
"significant": "No",
"trend": "up",
"name": "Liver cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:3571",
"evidence": [
{
"database": "BioXpress",
"id": "O14939",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14939"
}
],
"disease": [
{
"disease_id": "DOID:3571",
"recommended_name": {
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "liver cancer",
"description": "A hepatobiliary system cancer that is located_in the liver."
},
"synonyms": [
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "Ca liver - primary",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "Resectable malignant neoplasm of Liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "hepatic cancer",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "hepatic neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant hepato-biliary neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver, primary",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant tumor of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "non-resectable primary hepatic malignant neoplasm",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "primary liver cancer",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "primary malignant neoplasm of liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "resectable malignant neoplasm of the liver",
"description": ""
},
{
"id": "DOID:3571",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:3571",
"name": "malignant neoplasm of liver, not specified as primary or secondary",
"description": ""
}
]
}
]
},
{
"significant": "Yes",
"trend": "down",
"name": "Uterine cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:363",
"evidence": [
{
"database": "BioXpress",
"id": "O14939",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14939"
}
],
"disease": [
{
"disease_id": "DOID:363",
"recommended_name": {
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine cancer",
"description": "A female reproductive organ cancer that is located_in the uterus."
},
"synonyms": [
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "CA - cancer of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "Tumour of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "malignant uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "neoplasm of uterus",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterine tumor",
"description": ""
},
{
"id": "DOID:363",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:363",
"name": "uterus neoplasm",
"description": ""
}
]
}
]
},
{
"significant": "No",
"trend": "up",
"name": "Esophageal cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:5041",
"evidence": [
{
"database": "BioXpress",
"id": "O14939",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14939"
}
],
"disease": [
{
"disease_id": "DOID:5041",
"recommended_name": {
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "esophageal cancer",
"description": "A gastrointestinal system cancer that is located_in the esophagus."
},
"synonyms": [
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "Ca lower third oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "Ca middle third oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "esophagus cancer",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of distal third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of lower third of oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of middle third of oesophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of proximal third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant neoplasm of upper third esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of Distal Third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of Proximal Third of esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of abdominal esophagus",
"description": ""
},
{
"id": "DOID:5041",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:5041",
"name": "malignant tumor of the middle Third of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer",
"description": "A primary or metastatic malignant neoplasm involving the esophagus."
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "cancer of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "cancer of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal cancer, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal carcinoma, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal squamous cell carcinoma, somatic",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophagus cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal tumor",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophageal tumour",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophagus neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant esophagus tumor",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant oesophagus neoplasm",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant oesophagus tumour",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "oesophagus cancer",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca lower third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca lower third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca middle third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Ca middle third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of distal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of distal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of lower third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of lower third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of middle third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of middle third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of proximal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of proximal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of upper third esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant neoplasm of upper third oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of abdominal esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of distal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of proximal third of esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumor of the middle third of the esophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of abdominal oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of distal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of proximal third of oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "malignant tumour of the middle third of the oesophagus",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Aerodigestive tract cancer, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "Escc, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "esophageal squamous cell carcinoma, susceptibility to",
"description": ""
},
{
"id": "MONDO:0007576",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0007576",
"name": "gastric cardia adenocarcinoma, susceptibility to",
"description": ""
},
{
"id": "MIM:133239",
"resource": "MIM",
"url": "https://www.omim.org/entry/133239",
"name": "Esophageal cancer",
"description": "Esophageal cancer"
}
]
}
]
},
{
"significant": "No",
"trend": "up",
"name": "Colorectal cancer [DO disease name]",
"url": "http://disease-ontology.org/term/DOID:9256",
"evidence": [
{
"database": "BioXpress",
"id": "O14939",
"url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14939"
}
],
"disease": [
{
"disease_id": "DOID:9256",
"recommended_name": {
"id": "DOID:9256",
"resource": "Disease Ontology",
"url": "http://disease-ontology.org/term/DOID:9256",
"name": "colorectal cancer",
"description": "A large intestine cancer that is located_in the colon and/or located_in the rectum."
},
"synonyms": [
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma."
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "cancer of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, advanced, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer with chromosomal instability, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, somatic",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colorectum cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectal tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant colorectum neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large bowel tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine neoplasm",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumor",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant large intestine tumour",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of colorectum",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant neoplasm of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumor of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large bowel",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "malignant tumour of the large intestine",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "CRC",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation",
"description": ""
},
{
"id": "MONDO:0005575",
"resource": "MONDO",
"url": "https://monarchinitiative.org/disease/MONDO:0005575",
"name": "large intestine cancer",
"description": ""
},
{
"id": "MIM:114500",
"resource": "MIM",
"url": "https://www.omim.org/entry/114500",
"name": "Colorectal cancer",
"description": "Colorectal cancer"
}
]
}
]
}
],
"species": [
{
"name": "Homo sapiens",
"taxid": 9606,
"evidence": [
{
"database": "UniProtKB",
"id": "O14939",
"url": "https://www.uniprot.org/uniprot/O14939"
}
],
"common_name": "Human"
}
],
"gene": [
{
"name": "PLD2",
"url": "https://www.uniprot.org/uniprot/O14939",
"locus": {
"chromosome": "17",
"start_pos": 4823434,
"end_pos": 4807152,
"strand": "-",
"evidence": [
{
"database": "Ensembl Gene",
"id": "ENSG00000129219",
"url": "https://www.ensembl.org/id/ENSG00000129219"
}
]
}
}
],
"crossref": [
{
"id": "ENSG00000129219",
"url": "https://bgee.org/?page=gene&gene_id=ENSG00000129219",
"database": "Bgee",
"categories": [
"Gene Expression"
]
},
{
"id": "3.1.4.4",
"url": "https://www.brenda-enzymes.org/enzyme.php?ecno=3.1.4.4&UniProtAcc=O14939",
"database": "BRENDA",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "4.2.1.1",
"url": "https://www.brenda-enzymes.org/enzyme.php?ecno=4.2.1.1&UniProtAcc=O14939",
"database": "BRENDA",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "cd01254",
"url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd01254",
"database": "CDD",
"categories": [
"Protein Classification"
]
},
{
"id": "cd09845",
"url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd09845",
"database": "CDD",
"categories": [
"Protein Classification"
]
},
{
"id": "CHEMBL2734",
"url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL2734",
"database": "ChEMBL",
"categories": [
"Other"
]
},
{
"id": "PLD2",
"url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=PLD2",
"database": "GeneCards",
"categories": [
"Gene Annotation",
"Organism-specific"
]
},
{
"id": "5338",
"url": "https://www.ncbi.nlm.nih.gov/gene/5338",
"database": "GeneID",
"categories": [
"Genome Annotation"
]
},
{
"id": "9068",
"url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=9068",
"database": "HGNC",
"categories": [
"Organism-specific"
]
},
{
"id": "O14939",
"url": "https://www.ebi.ac.uk/intact/interactors/id:O14939*",
"database": "IntAct",
"categories": [
"Other"
]
},
{
"id": "IPR001683",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR001683",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR001736",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR001736",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR001849",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR001849",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR011993",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR011993",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR015679",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR015679",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR016555",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR016555",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR025202",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR025202",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "IPR036871",
"url": "https://www.ebi.ac.uk/interpro/entry/IPR036871",
"database": "InterPro",
"categories": [
"Protein Classification"
]
},
{
"id": "602384",
"url": "http://www.omim.org/entry/602384",
"database": "MIM",
"categories": [
"Other"
]
},
{
"id": "NX_O14939",
"url": "https://www.nextprot.org/entry/NX_O14939",
"database": "neXtProt",
"categories": [
"Protein",
"Organism-specific"
]
},
{
"id": "VRHPHRE",
"url": "https://omabrowser.org/oma/group/VRHPHRE/",
"database": "OMA",
"categories": [
"Protein Classification"
]
},
{
"id": "335467at2759",
"url": "http://www.orthodb.org/?query=335467at2759",
"database": "OrthoDB",
"categories": [
"Protein Classification"
]
},
{
"id": "PTHR18896",
"url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR18896",
"database": "PANTHER",
"categories": [
"Protein Classification"
]
},
{
"id": "PTHR18896:SF121",
"url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR18896:SF121",
"database": "PANTHER",
"categories": [
"Protein Classification"
]
},
{
"id": "6OHM",
"url": "https://www.rcsb.org/structure/6OHM",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6OHO",
"url": "https://www.rcsb.org/structure/6OHO",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6OHP",
"url": "https://www.rcsb.org/structure/6OHP",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6OHQ",
"url": "https://www.rcsb.org/structure/6OHQ",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "6OHS",
"url": "https://www.rcsb.org/structure/6OHS",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "7SVP",
"url": "https://www.rcsb.org/structure/7SVP",
"database": "PDB",
"categories": [
"3D Structure"
]
},
{
"id": "PF00614",
"url": "http://pfam.xfam.org/family/PF00614",
"database": "Pfam",
"categories": [
"Protein Classification"
]
},
{
"id": "PF00787",
"url": "http://pfam.xfam.org/family/PF00787",
"database": "Pfam",
"categories": [
"Protein Classification"
]
},
{
"id": "PF13091",
"url": "http://pfam.xfam.org/family/PF13091",
"database": "Pfam",
"categories": [
"Protein Classification"
]
},
{
"id": "O14939",
"url": "https://pharos.nih.gov/targets/O14939",
"database": "PHAROS",
"categories": [
"Organism-specific"
]
},
{
"id": "PR_O14939",
"url": "http://purl.obolibrary.org/obo/PR_O14939",
"database": "PRO",
"categories": [
"Protein"
]
},
{
"id": "R-HSA-1483148",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483148",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-1483166",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-2029485",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "R-HSA-9013404",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404",
"database": "Reactome",
"categories": [
"Protein Classification"
]
},
{
"id": "NP_001230037",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001230037",
"database": "RefSeq",
"categories": [
"Protein"
]
},
{
"id": "14445",
"url": "https://www.rhea-db.org/rhea/14445",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "44872",
"url": "https://www.rhea-db.org/rhea/44872",
"database": "Rhea",
"categories": [
"Enzyme and Pathway"
]
},
{
"id": "I3L1F3",
"url": "https://www.uniprot.org/uniprot/I3L1F3",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "I3L1F3-1",
"url": "https://www.uniprot.org/uniprot/I3L1F3-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "I3L222",
"url": "https://www.uniprot.org/uniprot/I3L222",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "I3L222-1",
"url": "https://www.uniprot.org/uniprot/I3L222-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "I3L381",
"url": "https://www.uniprot.org/uniprot/I3L381",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "I3L381-1",
"url": "https://www.uniprot.org/uniprot/I3L381-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "I3L3I7",
"url": "https://www.uniprot.org/uniprot/I3L3I7",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "I3L3I7-1",
"url": "https://www.uniprot.org/uniprot/I3L3I7-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "I3L4R5",
"url": "https://www.uniprot.org/uniprot/I3L4R5",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "I3L4R5-1",
"url": "https://www.uniprot.org/uniprot/I3L4R5-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "O14939",
"url": "https://www.uniprot.org/uniprot/O14939",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "O14939-1",
"url": "https://www.uniprot.org/uniprot/O14939-1",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "O14939-3",
"url": "https://www.uniprot.org/uniprot/O14939-3",
"database": "UniProtKB",
"categories": [
"Protein"
]
},
{
"id": "O14939-4",
"url": "https://www.uniprot.org/uniprot/O14939-4",
"database": "UniProtKB",
"categories": [
"Protein"
]
}
],
"sequence": {
"sequence": "MTATPESLFPTGDELDSSQLQMESDEVDTLKEGEDPADRMHPFLAIYELQSLKVHPLVFAPGVPVTAQVVGTERYTSGSKVGTCTLYSVRLTHGDFSWTTKKKYRHFQELHRDLLRHKVLMSLLPLARFAVAYSPARDAGNREMPSLPRAGPEGSTRHAASKQKYLENYLNRLLTMSFYRNYHAMTEFLEVSQLSFIPDLGRKGLEGMIRKRSGGHRVPGLTCCGRDQVCYRWSKRWLVVKDSFLLYMCLETGAISFVQLFDPGFEVQVGKRSTEARHGVRIDTSHRSLILKCSSYRQARWWAQEITELAQGPGRDFLQLHRHDSYAPPRPGTLARWFVNGAGYFAAVADAILRAQEEIFITDWWLSPEVYLKRPAHSDDWRLDIMLKRKAEEGVRVSILLFKEVELALGINSGYSKRALMLLHPNIKVMRHPDQVTLWAHHEKLLVVDQVVAFLGGLDLAYGRWDDLHYRLTDLGDSSESAASQPPTPRPDSPATPDLSHNQFFWLGKDYSNLITKDWVQLDRPFEDFIDRETTPRMPWRDVGVVVHGLPARDLARHFIQRWNFTKTTKAKYKTPTYPYLLPKSTSTANQLPFTLPGGQCTTVQVLRSVDRWSAGTLENSILNAYLHTIRESQHFLYIENQFFISCSDGRTVLNKVGDEIVDRILKAHKQGWCYRVYVLLPLLPGFEGDISTGGGNSIQAILHFTYRTLCRGEYSILHRLKAAMGTAWRDYISICGLRTHGELGGHPVSELIYIHSKVLIADDRTVIIGSANINDRSLLGKRDSELAVLIEDTETEPSLMNGAEYQAGRFALSLRKHCFGVILGANTRPDLDLRDPICDDFFQLWQDMAESNANIYEQIFRCLPSNATRSLRTLREYVAVEPLATVSPPLARSELTQVQGHLVHFPLKFLEDESLLPPLGSKEGMIPLEVWT",
"length": 933,
"header": "sp|O14939-1|PLD2_HUMAN Isoform 1 of Phospholipase D2 OS=Homo sapiens OX=9606 GN=PLD2 PE=1 SV=2 CANONICAL=O14939-1"
},
"isoforms": [
{
"isoform_ac": "I3L1F3-1",
"url": "",
"sequence": {
"sequence": "MTATPESLFPTGDELDSSQLQMESDEVDTLKEGEDPADRMHPFLAIYELQSLKVHPLVFAPGVPVTAQVVGTERYTSGSKVGTCTLYSVRLTHGDFSWTTKKKYRHFQELHRDLLRHKVLMSLLPLARFAVAYSPARDAGNREMPSLPRAGPEGSTRHAASKQKYLENYLNR",
"length": 172,
"header": "tr|I3L1F3-1|PLD2_HUMAN Computationally mapped isoform of Phospholipase D2 OS=Homo sapiens OX=9606 GN=PLD2 PE=1 SV=1 CANONICAL=O14939-1"
},
"locus": {
"chromosome": "17",
"start_pos": 4809324,
"end_pos": 4807773,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000575316.1",
"url": "https://www.ensembl.org/id/ENST00000575316.1"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000458795.1",
"url": "https://www.ensembl.org/id/ENSP00000458795.1"
}
]
}
},
{
"isoform_ac": "I3L222-1",
"url": "",
"sequence": {
"sequence": "MTATPESLFPTGDELDSSQLQMESDEVDTLKEGEDPADRMHPFLAIYELQSLKVHPLVFAPGVPVTAQVVGTERYTSGSKVGTCTLYSVRLTHGDFSWTTKKKYRHFQELHRDLLRHKVLMSLLPLAR",
"length": 128,
"header": "tr|I3L222-1|I3L222_HUMAN Computationally mapped isoform of Phospholipase D2 OS=Homo sapiens OX=9606 GN=PLD2 PE=1 SV=1 CANONICAL=O14939-1"
},
"locus": {
"chromosome": "17",
"start_pos": 4808417,
"end_pos": 4807773,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000575246.6",
"url": "https://www.ensembl.org/id/ENST00000575246.6"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000459304.1",
"url": "https://www.ensembl.org/id/ENSP00000459304.1"
}
]
}
},
{
"isoform_ac": "I3L381-1",
"url": "",
"sequence": {
"sequence": "TTKAKYKTPTYPYLLPKSTSTANQLPFTLPGGQCTTVQNQFFISCSDGRTVLNKVGDEIVDRILKAHKQGWCYRVYVLLPLLPGFEGDISTGGGNSIQAILHFTYRTLCRGEYSILHRLKAAMGTAWRDYISICGLRTHGELGGHPVSELIYIHSKVLIADDRTVIIGSANINDRSLLGKRDSELAVLIEDTETEP",
"length": 196,
"header": "tr|I3L381-1|PLD2_HUMAN Computationally mapped isoform of Phospholipase D2 OS=Homo sapiens OX=9606 GN=PLD2 PE=1 SV=2 CANONICAL=O14939-1"
},
"locus": {
"chromosome": "17",
"start_pos": 4819514,
"end_pos": 4817146,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000576983.5",
"url": "https://www.ensembl.org/id/ENST00000576983.5"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000460250.2",
"url": "https://www.ensembl.org/id/ENSP00000460250.2"
}
]
}
},
{
"isoform_ac": "I3L3I7-1",
"url": "",
"sequence": {
"sequence": "XHFTYRTLCRGEYSILHRLKAAMGTAWRDYISICGLRTHGELGGHPVSELIYIHSKVLIADDRTVIIGSANINDRSLLGKRDSELAVLIEDTETEPSLMNGAEYQAGRFALSLRKHCFGVILGANTRPDLDLRDPICDDFFQLWQDMAESNANIYEQIFRCLPSNATRSLRTLREYVAVEPLATGPPSPLLPRWREG",
"length": 197,
"header": "tr|I3L3I7-1|PLD2_HUMAN Computationally mapped isoform of Phospholipase D2 OS=Homo sapiens OX=9606 GN=PLD2 PE=1 SV=1 CANONICAL=O14939-1"
},
"locus": {
"chromosome": "17",
"start_pos": 4823299,
"end_pos": 4818593,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000576864.1",
"url": "https://www.ensembl.org/id/ENST00000576864.1"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000460477.1",
"url": "https://www.ensembl.org/id/ENSP00000460477.1"
}
]
}
},
{
"isoform_ac": "I3L4R5-1",
"url": "",
"sequence": {
"sequence": "XILKCSSYRQARWWAQEITELAQGPGRDFLQLHRHDSYAPPRPGTLAR",
"length": 48,
"header": "tr|I3L4R5-1|I3L4R5_HUMAN Computationally mapped isoform of Phospholipase D2 OS=Homo sapiens OX=9606 GN=PLD2 PE=1 SV=1 CANONICAL=O14939-1"
},
"locus": {
"chromosome": "17",
"start_pos": 4810951,
"end_pos": 4810807,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000575813.5",
"url": "https://www.ensembl.org/id/ENST00000575813.5"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000461459.1",
"url": "https://www.ensembl.org/id/ENSP00000461459.1"
}
]
}
},
{
"isoform_ac": "O14939-1",
"url": "",
"sequence": {
"sequence": "MTATPESLFPTGDELDSSQLQMESDEVDTLKEGEDPADRMHPFLAIYELQSLKVHPLVFAPGVPVTAQVVGTERYTSGSKVGTCTLYSVRLTHGDFSWTTKKKYRHFQELHRDLLRHKVLMSLLPLARFAVAYSPARDAGNREMPSLPRAGPEGSTRHAASKQKYLENYLNRLLTMSFYRNYHAMTEFLEVSQLSFIPDLGRKGLEGMIRKRSGGHRVPGLTCCGRDQVCYRWSKRWLVVKDSFLLYMCLETGAISFVQLFDPGFEVQVGKRSTEARHGVRIDTSHRSLILKCSSYRQARWWAQEITELAQGPGRDFLQLHRHDSYAPPRPGTLARWFVNGAGYFAAVADAILRAQEEIFITDWWLSPEVYLKRPAHSDDWRLDIMLKRKAEEGVRVSILLFKEVELALGINSGYSKRALMLLHPNIKVMRHPDQVTLWAHHEKLLVVDQVVAFLGGLDLAYGRWDDLHYRLTDLGDSSESAASQPPTPRPDSPATPDLSHNQFFWLGKDYSNLITKDWVQLDRPFEDFIDRETTPRMPWRDVGVVVHGLPARDLARHFIQRWNFTKTTKAKYKTPTYPYLLPKSTSTANQLPFTLPGGQCTTVQVLRSVDRWSAGTLENSILNAYLHTIRESQHFLYIENQFFISCSDGRTVLNKVGDEIVDRILKAHKQGWCYRVYVLLPLLPGFEGDISTGGGNSIQAILHFTYRTLCRGEYSILHRLKAAMGTAWRDYISICGLRTHGELGGHPVSELIYIHSKVLIADDRTVIIGSANINDRSLLGKRDSELAVLIEDTETEPSLMNGAEYQAGRFALSLRKHCFGVILGANTRPDLDLRDPICDDFFQLWQDMAESNANIYEQIFRCLPSNATRSLRTLREYVAVEPLATVSPPLARSELTQVQGHLVHFPLKFLEDESLLPPLGSKEGMIPLEVWT",
"length": 933,
"header": "sp|O14939-1|PLD2_HUMAN Isoform 1 of Phospholipase D2 OS=Homo sapiens OX=9606 GN=PLD2 PE=1 SV=2 CANONICAL=O14939-1"
},
"locus": {
"chromosome": "17",
"start_pos": 4822861,
"end_pos": 4807773,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000263088.11",
"url": "https://www.ensembl.org/id/ENST00000263088.11"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000263088.5",
"url": "https://www.ensembl.org/id/ENSP00000263088.5"
}
]
}
},
{
"isoform_ac": "O14939-3",
"url": "",
"sequence": {
"sequence": "MTATPESLFPTGDELDSSQLQMESDEVDTLKEGEDPADRMHPFLAIYELQSLKVHPLVFAPGVPVTAQVVGTERYTSGSKVGTCTLYSVRLTHGDFSWTTKKKYRHFQELHRDLLRHKVLMSLLPLARFAVAYSPARDAGNREMPSLPRAGPEGSTRHAASKQKYLENYLNRLLTMSFYRNYHAMTEFLEVSQLSFIPDLGRKGLEGMIRKRSGGHRVPGLTCCGRDQVCYRWSKRWLVVKDSFLLYMCLETGAISFVQLFDPGFEVQVGKRSTEARHGVRIDTSHRSLILKCSSYRQARWWAQEITELAQGPGRDFLQLHRHDSYAPPRPGTLAR",
"length": 336,
"header": "sp|O14939-3|PLD2_HUMAN Isoform 3 of Phospholipase D2 OS=Homo sapiens OX=9606 GN=PLD2 PE=1 SV=2 CANONICAL=O14939-1"
},
"locus": {}
},
{
"isoform_ac": "O14939-4",
"url": "",
"sequence": {
"sequence": "MTATPESLFPTGDELDSSQLQMESDEVDTLKEGEDPADRMHPFLAIYELQSLKVHPLVFAPGVPVTAQVVGTERYTSGSKVGTCTLYSVRLTHGDFSWTTKKKYRHFQELHRDLLRHKVLMSLLPLARFAVAYSPARDAGNREMPSLPRAGPEGSTRHAASKQKYLENYLNRLLTMSFYRNYHAMTEFLEVSQLSFIPDLGRKGLEGMIRKRSGGHRVPGLTCCGRDQVCYRWSKRWLVVKDSFLLYMCLETGAISFVQLFDPGFEVQVGKRSTEARHGVRIDTSHRSLILKCSSYRQARWWAQEITELAQGPGRDFLQLHRHDSYAPPRPGTLARWFVNGAGYFAAVADAILRAQEEIFITDWWLSPEVYLKRPAHSDDWRLDIMLKRKAEEGVRVSILLFKEVELALGINSGYSKRALMLLHPNIKVMRHPDQVTLWAHHEKLLVVDQVVAFLGGLDLAYGRWDDLHYRLTDLGDSSESAASQPPTPRPDSPATPDLSHNQFFWLGKDYSNLITKDWVQLDRPFEDFIDRETTPRMPWRDVGVVVHGLPARDLARHFIQRWNFTKTTKAKYKTPTYPYLLPKSTSTANQLPFTLPGGQCTTVQVLRSVDRWSAGTLENSILNAYLHTIRESQHFLYIENQFFISCSDGRTVLNKVGDEIVDRILKAHKQGWCYRVYVLLPLLPGFEGDISTGGGNSIQAILHFTYRTLCRGEYSILHRLKAAMGTAWRDYISICGLRTHGELGGHPVSELIYIHSKVLIADDRTVIIGSANINDRSLLGKRDSELAVLIEDTETEPSLMNGAEYQAGSVILGANTRPDLDLRDPICDDFFQLWQDMAESNANIYEQIFRCLPSNATRSLRTLREYVAVEPLATVSPPLARSELTQVQGHLVHFPLKFLEDESLLPPLGSKEGMIPLEVWT",
"length": 922,
"header": "sp|O14939-4|PLD2_HUMAN Isoform 4 of Phospholipase D2 OS=Homo sapiens OX=9606 GN=PLD2 PE=1 SV=2 CANONICAL=O14939-1"
},
"locus": {
"chromosome": "17",
"start_pos": 4822861,
"end_pos": 4807773,
"strand": "-",
"evidence": [
{
"database": "Ensembl Transcript",
"id": "ENST00000572940.5",
"url": "https://www.ensembl.org/id/ENST00000572940.5"
},
{
"database": "Ensembl Peptide",
"id": "ENSP00000459571.1",
"url": "https://www.ensembl.org/id/ENSP00000459571.1"
}
]
}
}
],
"glycosylation": [],
"phosphorylation": [
{
"start_pos": 100,
"end_pos": 100,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Thr",
"comment": "",
"evidence": [
{
"database": "phospho.ELM",
"id": "O14939",
"url": "http://phospho.elm.eu.org/byAccession/O14939.html"
},
{
"database": "iPTMnet",
"id": "O14939",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14939"
},
{
"database": "PubMed",
"id": "15979581",
"url": "https://glygen.org/publication/PubMed/15979581"
}
],
"site_lbl": "Thr100"
},
{
"start_pos": 104,
"end_pos": 104,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Tyr",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "O14939",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14939"
},
{
"database": "PubMed",
"id": "35494241",
"url": ""
}
],
"site_lbl": "Tyr104"
},
{
"start_pos": 134,
"end_pos": 134,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "",
"evidence": [
{
"database": "phospho.ELM",
"id": "O14939",
"url": "http://phospho.elm.eu.org/byAccession/O14939.html"
},
{
"database": "iPTMnet",
"id": "O14939",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14939"
},
{
"database": "PubMed",
"id": "15979581",
"url": "https://glygen.org/publication/PubMed/15979581"
}
],
"site_lbl": "Ser134"
},
{
"start_pos": 146,
"end_pos": 146,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "",
"evidence": [
{
"database": "phospho.ELM",
"id": "O14939",
"url": "http://phospho.elm.eu.org/byAccession/O14939.html"
},
{
"database": "iPTMnet",
"id": "O14939",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14939"
},
{
"database": "PubMed",
"id": "15979581",
"url": "https://glygen.org/publication/PubMed/15979581"
}
],
"site_lbl": "Ser146"
},
{
"start_pos": 175,
"end_pos": 175,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Thr",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "O14939",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14939"
},
{
"database": "PubMed",
"id": "18006275",
"url": "https://glygen.org/publication/PubMed/18006275"
}
],
"site_lbl": "Thr175"
},
{
"start_pos": 179,
"end_pos": 179,
"kinase_uniprot_canonical_ac": "P00533-1",
"kinase_gene_name": "EGFR",
"residue": "Tyr",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "O14939",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14939"
},
{
"database": "PubMed",
"id": "9837959",
"url": "https://glygen.org/publication/PubMed/9837959"
}
],
"site_lbl": "Tyr179"
},
{
"start_pos": 179,
"end_pos": 179,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Tyr",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "O14939",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14939"
},
{
"database": "PubMed",
"id": "18006275",
"url": "https://glygen.org/publication/PubMed/18006275"
}
],
"site_lbl": "Tyr179"
},
{
"start_pos": 243,
"end_pos": 243,
"kinase_uniprot_canonical_ac": "P17252-1",
"kinase_gene_name": "PRKCA",
"residue": "Ser",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "O14939",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14939"
},
{
"database": "PubMed",
"id": "15979581",
"url": "https://glygen.org/publication/PubMed/15979581"
}
],
"site_lbl": "Ser243"
},
{
"start_pos": 243,
"end_pos": 243,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "",
"evidence": [
{
"database": "phospho.ELM",
"id": "O14939",
"url": "http://phospho.elm.eu.org/byAccession/O14939.html"
},
{
"database": "iPTMnet",
"id": "O14939",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14939"
},
{
"database": "PubMed",
"id": "15979581",
"url": "https://glygen.org/publication/PubMed/15979581"
}
],
"site_lbl": "Ser243"
},
{
"start_pos": 252,
"end_pos": 252,
"kinase_uniprot_canonical_ac": "P17252-1",
"kinase_gene_name": "PRKCA",
"residue": "Thr",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "O14939",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14939"
},
{
"database": "PubMed",
"id": "15979581",
"url": "https://glygen.org/publication/PubMed/15979581"
}
],
"site_lbl": "Thr252"
},
{
"start_pos": 252,
"end_pos": 252,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Thr",
"comment": "",
"evidence": [
{
"database": "phospho.ELM",
"id": "O14939",
"url": "http://phospho.elm.eu.org/byAccession/O14939.html"
},
{
"database": "iPTMnet",
"id": "O14939",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14939"
},
{
"database": "PubMed",
"id": "15979581",
"url": "https://glygen.org/publication/PubMed/15979581"
}
],
"site_lbl": "Thr252"
},
{
"start_pos": 296,
"end_pos": 296,
"kinase_uniprot_canonical_ac": "P00533-1",
"kinase_gene_name": "EGFR",
"residue": "Tyr",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "O14939",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14939"
},
{
"database": "PubMed",
"id": "20176813",
"url": "https://glygen.org/publication/PubMed/20176813"
}
],
"site_lbl": "Tyr296"
},
{
"start_pos": 296,
"end_pos": 296,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Tyr",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "O14939",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14939"
},
{
"database": "PubMed",
"id": "20176813",
"url": "https://glygen.org/publication/PubMed/20176813"
}
],
"site_lbl": "Tyr296"
},
{
"start_pos": 415,
"end_pos": 415,
"kinase_uniprot_canonical_ac": "P52333-1",
"kinase_gene_name": "JAK3",
"residue": "Tyr",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "O14939",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14939"
},
{
"database": "PubMed",
"id": "20176813",
"url": "https://glygen.org/publication/PubMed/20176813"
},
{
"database": "PubMed",
"id": "21414324",
"url": "https://glygen.org/publication/PubMed/21414324"
}
],
"site_lbl": "Tyr415"
},
{
"start_pos": 566,
"end_pos": 566,
"kinase_uniprot_canonical_ac": "Q05655-1",
"kinase_gene_name": "PRKCD",
"residue": "Thr",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "O14939",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14939"
},
{
"database": "PubMed",
"id": "20733000",
"url": "https://glygen.org/publication/PubMed/20733000"
}
],
"site_lbl": "Thr566"
},
{
"start_pos": 566,
"end_pos": 566,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Thr",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "O14939",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14939"
},
{
"database": "PubMed",
"id": "20733000",
"url": "https://glygen.org/publication/PubMed/20733000"
}
],
"site_lbl": "Thr566"
},
{
"start_pos": 609,
"end_pos": 609,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Ser",
"comment": "",
"evidence": [
{
"database": "iPTMnet",
"id": "O14939",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14939"
},
{
"database": "PubMed",
"id": "18452278",
"url": "https://glygen.org/publication/PubMed/18452278"
}
],
"site_lbl": "Ser609"
},
{
"start_pos": 72,
"end_pos": 72,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Thr",
"comment": "",
"evidence": [
{
"database": "phospho.ELM",
"id": "O14939",
"url": "http://phospho.elm.eu.org/byAccession/O14939.html"
},
{
"database": "iPTMnet",
"id": "O14939",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14939"
},
{
"database": "PubMed",
"id": "15979581",
"url": "https://glygen.org/publication/PubMed/15979581"
}
],
"site_lbl": "Thr72"
},
{
"start_pos": 99,
"end_pos": 99,
"kinase_uniprot_canonical_ac": "",
"kinase_gene_name": "",
"residue": "Thr",
"comment": "",
"evidence": [
{
"database": "phospho.ELM",
"id": "O14939",
"url": "http://phospho.elm.eu.org/byAccession/O14939.html"
},
{
"database": "iPTMnet",
"id": "O14939",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14939"
},
{
"database": "PubMed",
"id": "15979581",
"url": "https://glygen.org/publication/PubMed/15979581"
}
],
"site_lbl": "Thr99"
}
],
"glycation": [],
"keywords": [
"enzyme"
],
"publication": [
{
"title": "Phospholipases and phagocytosis: the role of phospholipid-derived second messengers in phagocytosis.",
"journal": "The international journal of biochemistry & cell biology",
"date": "1999",
"authors": "Lennartz MR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029485",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485"
}
],
"reference": [
{
"type": "PubMed",
"id": "10224668",
"url": "https://glygen.org/publication/PubMed/10224668"
}
]
},
{
"title": "Expression, purification and crystallization of a BH domain from the GTPase regulatory protein associated with focal adhesion kinase.",
"journal": "Acta crystallographica. Section D, Biological crystallography",
"date": "1999",
"authors": "Sheffield PJ, Derewenda U, Taylor J, Parsons TJ, Derewenda ZS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "10232922",
"url": "https://glygen.org/publication/PubMed/10232922"
}
]
},
{
"title": "Cloning and characterization of novel mouse and human secretory phospholipase A(2)s.",
"journal": "The Journal of biological chemistry",
"date": "1999",
"authors": "Ishizaki J, Suzuki N, Higashino K, Yokota Y, Ono T, Kawamoto K, Fujii N, Arita H, Hanasaki K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1483166",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166"
}
],
"reference": [
{
"type": "PubMed",
"id": "10455175",
"url": "https://glygen.org/publication/PubMed/10455175"
}
]
},
{
"title": "Association of frabin with the actin cytoskeleton is essential for microspike formation through activation of Cdc42 small G protein.",
"journal": "The Journal of biological chemistry",
"date": "1999",
"authors": "Umikawa M, Obaishi H, Nakanishi H, Satoh-Horikawa K, Takahashi K, Hotta I, Matsuura Y, Takai Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "10464238",
"url": "https://glygen.org/publication/PubMed/10464238"
}
]
},
{
"title": "The Borgs, a new family of Cdc42 and TC10 GTPase-interacting proteins.",
"journal": "Molecular and cellular biology",
"date": "1999",
"authors": "Joberty G, Perlungher RR, Macara IG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "10490598",
"url": "https://glygen.org/publication/PubMed/10490598"
}
]
},
{
"title": "Isolation of a cDNA encoding human lysophosphatidic acid phosphatase that is involved in the regulation of mitochondrial lipid biosynthesis.",
"journal": "The Journal of biological chemistry",
"date": "1999",
"authors": "Hiroyama M, Takenawa T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1483166",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166"
}
],
"reference": [
{
"type": "PubMed",
"id": "10506173",
"url": "https://glygen.org/publication/PubMed/10506173"
}
]
},
{
"title": "Sema3A-induced growth-cone collapse is mediated by Rac1 amino acids 17-32.",
"journal": "Current biology : CB",
"date": "1999",
"authors": "Vastrik I, Eickholt BJ, Walsh FS, Ridley A, Doherty P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "10508610",
"url": "https://glygen.org/publication/PubMed/10508610"
}
]
},
{
"title": "Dependence of Dbl and Dbs transformation on MEK and NF-kappaB activation.",
"journal": "Molecular and cellular biology",
"date": "1999",
"authors": "Whitehead IP, Lambert QT, Glaven JA, Abe K, Rossman KL, Mahon GM, Trzaskos JM, Kay R, Campbell SL, Der CJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "10523665",
"url": "https://glygen.org/publication/PubMed/10523665"
}
]
},
{
"title": "Biological and regulatory properties of Vav-3, a new member of the Vav family of oncoproteins.",
"journal": "Molecular and cellular biology",
"date": "1999",
"authors": "Movilla N, Bustelo XR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "10523675",
"url": "https://glygen.org/publication/PubMed/10523675"
}
]
},
{
"title": "Rho-specific binding and guanine nucleotide exchange catalysis by KIAA0380, a dbl family member.",
"journal": "FEBS letters",
"date": "1999",
"authors": "Rumenapp U, Blomquist A, Schworer G, Schablowski H, Psoma A, Jakobs KH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "10526156",
"url": "https://glygen.org/publication/PubMed/10526156"
}
]
},
{
"title": "Ether lipid biosynthesis: alkyl-dihydroxyacetonephosphate synthase protein deficiency leads to reduced dihydroxyacetonephosphate acyltransferase activities.",
"journal": "Journal of lipid research",
"date": "1999",
"authors": "de Vet EC, Ijlst L, Oostheim W, Dekker C, Moser HW, van Den Bosch H, Wanders RJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1483166",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166"
}
],
"reference": [
{
"type": "PubMed",
"id": "10553003",
"url": "https://glygen.org/publication/PubMed/10553003"
}
]
},
{
"title": "Identification and characterization of hPEM-2, a guanine nucleotide exchange factor specific for Cdc42.",
"journal": "The Journal of biological chemistry",
"date": "1999",
"authors": "Reid T, Bathoorn A, Ahmadian MR, Collard JG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "10559246",
"url": "https://glygen.org/publication/PubMed/10559246"
}
]
},
{
"title": "Human ECT2 is an exchange factor for Rho GTPases, phosphorylated in G2/M phases, and involved in cytokinesis.",
"journal": "The Journal of cell biology",
"date": "1999",
"authors": "Tatsumoto T, Xie X, Blumenthal R, Okamoto I, Miki T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "10579713",
"url": "https://glygen.org/publication/PubMed/10579713"
}
]
},
{
"title": "Phospholipase C-gamma as a signal-transducing element.",
"journal": "Experimental cell research",
"date": "1999",
"authors": "Carpenter G, Ji Qs",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029485",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485"
}
],
"reference": [
{
"type": "PubMed",
"id": "10579907",
"url": "https://glygen.org/publication/PubMed/10579907"
}
]
},
{
"title": "Structures, enzymatic properties, and expression of novel human and mouse secretory phospholipase A(2)s.",
"journal": "The Journal of biological chemistry",
"date": "2000",
"authors": "Suzuki N, Ishizaki J, Yokota Y, Higashino K, Ono T, Ikeda M, Fujii N, Kawamoto K, Hanasaki K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1483166",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166"
}
],
"reference": [
{
"type": "PubMed",
"id": "10681567",
"url": "https://glygen.org/publication/PubMed/10681567"
}
]
},
{
"title": "Functional analysis of ARHGAP6, a novel GTPase-activating protein for RhoA.",
"journal": "Human molecular genetics",
"date": "2000",
"authors": "Prakash SK, Paylor R, Jenna S, Lamarche-Vane N, Armstrong DL, Xu B, Mancini MA, Zoghbi HY",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "10699171",
"url": "https://glygen.org/publication/PubMed/10699171"
}
]
},
{
"title": "Molecular cloning and characterization of a novel human STE20-like kinase, hSLK.",
"journal": "Biochimica et biophysica acta",
"date": "2000",
"authors": "Yamada E, Tsujikawa K, Itoh S, Kameda Y, Kohama Y, Yamamoto H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "10699464",
"url": "https://glygen.org/publication/PubMed/10699464"
}
]
},
{
"title": "Trio combines with dock to regulate Pak activity during photoreceptor axon pathfinding in Drosophila.",
"journal": "Cell",
"date": "2000",
"authors": "Newsome TP, Schmidt S, Dietzl G, Keleman K, Asling B, Debant A, Dickson BJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013404",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404"
}
],
"reference": [
{
"type": "PubMed",
"id": "10847683",
"url": "https://glygen.org/publication/PubMed/10847683"
}
]
},
{
"title": "A human homolog of the C. elegans polarity determinant Par-6 links Rac and Cdc42 to PKCzeta signaling and cell transformation.",
"journal": "Current biology : CB",
"date": "2000",
"authors": "Qiu RG, Abo A, Steven Martin G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "10873802",
"url": "https://glygen.org/publication/PubMed/10873802"
}
]
},
{
"title": "FRL, a novel formin-related protein, binds to Rac and regulates cell motility and survival of macrophages.",
"journal": "Molecular and cellular biology",
"date": "2000",
"authors": "Yayoshi-Yamamoto S, Taniuchi I, Watanabe T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "10958683",
"url": "https://glygen.org/publication/PubMed/10958683"
}
]
},
{
"title": "Structural basis for relief of autoinhibition of the Dbl homology domain of proto-oncogene Vav by tyrosine phosphorylation.",
"journal": "Cell",
"date": "2000",
"authors": "Aghazadeh B, Lowry WE, Huang XY, Rosen MK",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "11007481",
"url": "https://glygen.org/publication/PubMed/11007481"
}
]
},
{
"title": "Cloning and recombinant expression of a structurally novel human secreted phospholipase A2.",
"journal": "The Journal of biological chemistry",
"date": "2000",
"authors": "Gelb MH, Valentin E, Ghomashchi F, Lazdunski M, Lambeau G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1483166",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166"
}
],
"reference": [
{
"type": "PubMed",
"id": "11031251",
"url": "https://glygen.org/publication/PubMed/11031251"
}
]
},
{
"title": "Interaction of the type Ialpha PIPkinase with phospholipase D: a role for the local generation of phosphatidylinositol 4, 5-bisphosphate in the regulation of PLD2 activity.",
"journal": "EMBO J.",
"date": "2000",
"authors": "Divecha N, Roefs M, Halstead J R, D'Andrea S, Fernandez-Borga M, Oomen L, Saqib K M, Wakelam M J, D'Santos C",
"evidence": [
{
"database": "UniProtKB",
"id": "O14939",
"url": "https://www.uniprot.org/uniprot/O14939"
}
],
"reference": [
{
"type": "PubMed",
"id": "11032811",
"url": "https://glygen.org/publication/PubMed/11032811"
}
]
},
{
"title": "Characterization of p190RhoGEF, a RhoA-specific guanine nucleotide exchange factor that interacts with microtubules.",
"journal": "The Journal of biological chemistry",
"date": "2001",
"authors": "van Horck FP, Ahmadian MR, Haeusler LC, Moolenaar WH, Kranenburg O",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "11058585",
"url": "https://glygen.org/publication/PubMed/11058585"
}
]
},
{
"title": "Identification and characterization of a novel Rho-specific guanine nucleotide exchange factor.",
"journal": "The Biochemical journal",
"date": "2000",
"authors": "Blomquist A, Schworer G, Schablowski H, Psoma A, Lehnen M, Jakobs KH, Rumenapp U",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "11085924",
"url": "https://glygen.org/publication/PubMed/11085924"
}
]
},
{
"title": "Cloning and recombinant expression of human group IIF-secreted phospholipase A(2).",
"journal": "Biochemical and biophysical research communications",
"date": "2000",
"authors": "Valentin E, Singer AG, Ghomashchi F, Lazdunski M, Gelb MH, Lambeau G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1483166",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166"
}
],
"reference": [
{
"type": "PubMed",
"id": "11112443",
"url": "https://glygen.org/publication/PubMed/11112443"
}
]
},
{
"title": "Rac2 is an essential regulator of neutrophil nicotinamide adenine dinucleotide phosphate oxidase activation in response to specific signaling pathways.",
"journal": "Journal of immunology (Baltimore, Md. : 1950)",
"date": "2001",
"authors": "Kim C, Dinauer MC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013404",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404"
}
],
"reference": [
{
"type": "PubMed",
"id": "11145705",
"url": "https://glygen.org/publication/PubMed/11145705"
}
]
},
{
"title": "Differential localization of Rho GTPases in live cells: regulation by hypervariable regions and RhoGDI binding.",
"journal": "The Journal of cell biology",
"date": "2001",
"authors": "Michaelson D, Silletti J, Murphy G, D'Eustachio P, Rush M, Philips MR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013404",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404"
}
],
"reference": [
{
"type": "PubMed",
"id": "11149925",
"url": "https://glygen.org/publication/PubMed/11149925"
}
]
},
{
"title": "Leukemia-associated Rho guanine nucleotide exchange factor, a Dbl family protein found mutated in leukemia, causes transformation by activation of RhoA.",
"journal": "The Journal of biological chemistry",
"date": "2001",
"authors": "Reuther GW, Lambert QT, Booden MA, Wennerberg K, Becknell B, Marcucci G, Sondek J, Caligiuri MA, Der CJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "11373293",
"url": "https://glygen.org/publication/PubMed/11373293"
}
]
},
{
"title": "Isolation of a novel human gene, ARHGAP9, encoding a rho-GTPase activating protein.",
"journal": "Biochemical and biophysical research communications",
"date": "2001",
"authors": "Furukawa Y, Kawasoe T, Daigo Y, Nishiwaki T, Ishiguro H, Takahashi M, Kitayama J, Nakamura Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "11396949",
"url": "https://glygen.org/publication/PubMed/11396949"
}
]
},
{
"title": "Restricted accumulation of phosphatidylinositol 3-kinase products in a plasmalemmal subdomain during Fc gamma receptor-mediated phagocytosis.",
"journal": "The Journal of cell biology",
"date": "2001",
"authors": "Marshall JG, Booth JW, Stambolic V, Mak T, Balla T, Schreiber AD, Meyer T, Grinstein S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029485",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485"
}
],
"reference": [
{
"type": "PubMed",
"id": "11425868",
"url": "https://glygen.org/publication/PubMed/11425868"
}
]
},
{
"title": "Rich, a rho GTPase-activating protein domain-containing protein involved in signaling by Cdc42 and Rac1.",
"journal": "The Journal of biological chemistry",
"date": "2001",
"authors": "Richnau N, Aspenstrom P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "11431473",
"url": "https://glygen.org/publication/PubMed/11431473"
}
]
},
{
"title": "PKNbeta interacts with the SH3 domains of Graf and a novel Graf related protein, Graf2, which are GTPase activating proteins for Rho family.",
"journal": "Journal of biochemistry",
"date": "2001",
"authors": "Shibata H, Oishi K, Yamagiwa A, Matsumoto M, Mukai H, Ono Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "11432776",
"url": "https://glygen.org/publication/PubMed/11432776"
}
]
},
{
"title": "Endocytic protein intersectin-l regulates actin assembly via Cdc42 and N-WASP.",
"journal": "Nature cell biology",
"date": "2001",
"authors": "Hussain NK, Jenna S, Glogauer M, Quinn CC, Wasiak S, Guipponi M, Antonarakis SE, Kay BK, Stossel TP, Lamarche-Vane N, McPherson PS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "11584276",
"url": "https://glygen.org/publication/PubMed/11584276"
}
]
},
{
"title": "Signal transduction in neuronal migration: roles of GTPase activating proteins and the small GTPase Cdc42 in the Slit-Robo pathway.",
"journal": "Cell",
"date": "2001",
"authors": "Wong K, Ren XR, Huang YZ, Xie Y, Liu G, Saito H, Tang H, Wen L, Brady-Kalnay SM, Mei L, Wu JY, Xiong WC, Rao Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "11672528",
"url": "https://glygen.org/publication/PubMed/11672528"
}
]
},
{
"title": "The gene for a new brain specific RhoA exchange factor maps to the highly unstable chromosomal region 1p36.2-1p36.3.",
"journal": "Oncogene",
"date": "2001",
"authors": "De Toledo M, Coulon V, Schmidt S, Fort P, Blangy A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "11704860",
"url": "https://glygen.org/publication/PubMed/11704860"
}
]
},
{
"title": "Characterization of STEF, a guanine nucleotide exchange factor for Rac1, required for neurite growth.",
"journal": "The Journal of biological chemistry",
"date": "2002",
"authors": "Matsuo N, Hoshino M, Yoshizawa M, Nabeshima Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "11707441",
"url": "https://glygen.org/publication/PubMed/11707441"
}
]
},
{
"title": "Protein kinase C: structural and spatial regulation by phosphorylation, cofactors, and macromolecular interactions.",
"journal": "Chemical reviews",
"date": "2001",
"authors": "Newton AC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029485",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485"
}
],
"reference": [
{
"type": "PubMed",
"id": "11749377",
"url": "https://glygen.org/publication/PubMed/11749377"
}
]
},
{
"title": "PAK5, a new brain-specific kinase, promotes neurite outgrowth in N1E-115 cells.",
"journal": "Molecular and cellular biology",
"date": "2002",
"authors": "Dan C, Nath N, Liberto M, Minden A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "11756552",
"url": "https://glygen.org/publication/PubMed/11756552"
}
]
},
{
"title": "AR and ER interaction with a p21-activated kinase (PAK6).",
"journal": "Molecular endocrinology (Baltimore, Md.)",
"date": "2002",
"authors": "Lee SR, Ramos SM, Ko A, Masiello D, Swanson KD, Lu ML, Balk SP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "11773441",
"url": "https://glygen.org/publication/PubMed/11773441"
}
]
},
{
"title": "A novel phospholipase A1 with sequence homology to a mammalian Sec23p-interacting protein, p125.",
"journal": "The Journal of biological chemistry",
"date": "2002",
"authors": "Nakajima K, Sonoda H, Mizoguchi T, Aoki J, Arai H, Nagahama M, Tagaya M, Tani K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1483166",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166"
}
],
"reference": [
{
"type": "PubMed",
"id": "11788596",
"url": "https://glygen.org/publication/PubMed/11788596"
}
]
},
{
"title": "Rac1 and RhoG promote cell survival by the activation of PI3K and Akt, independently of their ability to stimulate JNK and NF-kappaB.",
"journal": "Oncogene",
"date": "2002",
"authors": "Murga C, Zohar M, Teramoto H, Gutkind JS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "11803464",
"url": "https://glygen.org/publication/PubMed/11803464"
}
]
},
{
"title": "Pak1 kinase homodimers are autoinhibited in trans and dissociated upon activation by Cdc42 and Rac1.",
"journal": "Molecular cell",
"date": "2002",
"authors": "Parrini MC, Lei M, Harrison SC, Mayer BJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "11804587",
"url": "https://glygen.org/publication/PubMed/11804587"
}
]
},
{
"title": "Identification of ARAP3, a novel PI3K effector regulating both Arf and Rho GTPases, by selective capture on phosphoinositide affinity matrices.",
"journal": "Molecular cell",
"date": "2002",
"authors": "Krugmann S, Anderson KE, Ridley SH, Risso N, McGregor A, Coadwell J, Davidson K, Eguinoa A, Ellson CD, Lipp P, Manifava M, Ktistakis N, Painter G, Thuring JW, Cooper MA, Lim ZY, Holmes AB, Dove SK, Michell RH, Grewal A, Nazarian A, Erdjument-Bromage H, Tempst P, Stephens LR, Hawkins PT",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "11804589",
"url": "https://glygen.org/publication/PubMed/11804589"
}
]
},
{
"title": "ARAP1: a point of convergence for Arf and Rho signaling.",
"journal": "Molecular cell",
"date": "2002",
"authors": "Miura K, Jacques KM, Stauffer S, Kubosaki A, Zhu K, Hirsch DS, Resau J, Zheng Y, Randazzo PA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "11804590",
"url": "https://glygen.org/publication/PubMed/11804590"
}
]
},
{
"title": "Identification of a soluble form phospholipase A2 receptor as a circulating endogenous inhibitor for secretory phospholipase A2.",
"journal": "The Journal of biological chemistry",
"date": "2002",
"authors": "Higashino Ki K, Yokota Y, Ono T, Kamitani S, Arita H, Hanasaki K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1483166",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166"
}
],
"reference": [
{
"type": "PubMed",
"id": "11830583",
"url": "https://glygen.org/publication/PubMed/11830583"
}
]
},
{
"title": "Distinct role of phosphatidylinositol 3-kinase and Rho family GTPases in Vav3-induced cell transformation, cell motility, and morphological changes.",
"journal": "The Journal of biological chemistry",
"date": "2002",
"authors": "Sachdev P, Zeng L, Wang LH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "11884391",
"url": "https://glygen.org/publication/PubMed/11884391"
}
]
},
{
"title": "Nucleotide exchange factor GEF-H1 mediates cross-talk between microtubules and the actin cytoskeleton.",
"journal": "Nature cell biology",
"date": "2002",
"authors": "Krendel M, Zenke FT, Bokoch GM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "11912491",
"url": "https://glygen.org/publication/PubMed/11912491"
}
]
},
{
"title": "Rac function and regulation during Drosophila development.",
"journal": "Nature",
"date": "2002",
"authors": "Hakeda-Suzuki S, Ng J, Tzu J, Dietzl G, Sun Y, Harms M, Nardine T, Luo L, Dickson BJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013404",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404"
}
],
"reference": [
{
"type": "PubMed",
"id": "11919634",
"url": "https://glygen.org/publication/PubMed/11919634"
}
]
},
{
"title": "SWAP-70 is a guanine-nucleotide-exchange factor that mediates signalling of membrane ruffling.",
"journal": "Nature",
"date": "2002",
"authors": "Shinohara M, Terada Y, Iwamatsu A, Shinohara A, Mochizuki N, Higuchi M, Gotoh Y, Ihara S, Nagata S, Itoh H, Fukui Y, Jessberger R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "11961559",
"url": "https://glygen.org/publication/PubMed/11961559"
}
]
},
{
"title": "A novel phosphatidic acid-selective phospholipase A1 that produces lysophosphatidic acid.",
"journal": "The Journal of biological chemistry",
"date": "2002",
"authors": "Sonoda H, Aoki J, Hiramatsu T, Ishida M, Bandoh K, Nagai Y, Taguchi R, Inoue K, Arai H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1483166",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166"
}
],
"reference": [
{
"type": "PubMed",
"id": "12063250",
"url": "https://glygen.org/publication/PubMed/12063250"
}
]
},
{
"title": "A mammalian Rho-specific guanine-nucleotide exchange factor (p164-RhoGEF) without a pleckstrin homology domain.",
"journal": "The Biochemical journal",
"date": "2002",
"authors": "Rumenapp U, Freichel-Blomquist A, Wittinghofer B, Jakobs KH, Wieland T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "12071859",
"url": "https://glygen.org/publication/PubMed/12071859"
}
]
},
{
"title": "A novel Rho GTPase-activating-protein interacts with Gem, a member of the Ras superfamily of GTPases.",
"journal": "The Biochemical journal",
"date": "2002",
"authors": "Aresta S, de Tand-Heim MF, Beranger F, de Gunzburg J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "12093360",
"url": "https://glygen.org/publication/PubMed/12093360"
}
]
},
{
"title": "p38 MAPK-mediated activation of NF-kappaB by the RhoGEF domain of Bcr.",
"journal": "Oncogene",
"date": "2002",
"authors": "Korus M, Mahon GM, Cheng L, Whitehead IP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "12096337",
"url": "https://glygen.org/publication/PubMed/12096337"
}
]
},
{
"title": "Crystal structure of human group X secreted phospholipase A2. Electrostatically neutral interfacial surface targets zwitterionic membranes.",
"journal": "The Journal of biological chemistry",
"date": "2002",
"authors": "Pan YH, Yu BZ, Singer AG, Ghomashchi F, Lambeau G, Gelb MH, Jain MK, Bahnson BJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1483166",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166"
}
],
"reference": [
{
"type": "PubMed",
"id": "12161451",
"url": "https://glygen.org/publication/PubMed/12161451"
}
]
},
{
"title": "The novel Rho-GTPase activating gene MEGAP/ srGAP3 has a putative role in severe mental retardation.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2002",
"authors": "Endris V, Wogatzky B, Leimer U, Bartsch D, Zatyka M, Latif F, Maher ER, Tariverdian G, Kirsch S, Karch D, Rappold GA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "12195014",
"url": "https://glygen.org/publication/PubMed/12195014"
}
]
},
{
"title": "XPLN, a guanine nucleotide exchange factor for RhoA and RhoB, but not RhoC.",
"journal": "The Journal of biological chemistry",
"date": "2002",
"authors": "Arthur WT, Ellerbroek SM, Der CJ, Burridge K, Wennerberg K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "12221096",
"url": "https://glygen.org/publication/PubMed/12221096"
}
]
},
{
"title": "A novel FERM domain including guanine nucleotide exchange factor is involved in Rac signaling and regulates neurite remodeling.",
"journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience",
"date": "2002",
"authors": "Kubo T, Yamashita T, Yamaguchi A, Sumimoto H, Hosokawa K, Tohyama M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "12351724",
"url": "https://glygen.org/publication/PubMed/12351724"
}
]
},
{
"title": "Interfacial kinetic and binding properties of the complete set of human and mouse groups I, II, V, X, and XII secreted phospholipases A2.",
"journal": "The Journal of biological chemistry",
"date": "2002",
"authors": "Singer AG, Ghomashchi F, Le Calvez C, Bollinger J, Bezzine S, Rouault M, Sadilek M, Nguyen E, Lazdunski M, Lambeau G, Gelb MH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1483166",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166"
}
],
"reference": [
{
"type": "PubMed",
"id": "12359733",
"url": "https://glygen.org/publication/PubMed/12359733"
}
]
},
{
"title": "Identification of an evolutionarily conserved superfamily of DOCK180-related proteins with guanine nucleotide exchange activity.",
"journal": "Journal of cell science",
"date": "2002",
"authors": "Cote JF, Vuori K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "12432077",
"url": "https://glygen.org/publication/PubMed/12432077"
}
]
},
{
"title": "Novel role of gp91(phox)-containing NAD(P)H oxidase in vascular endothelial growth factor-induced signaling and angiogenesis.",
"journal": "Circulation research",
"date": "2002",
"authors": "Ushio-Fukai M, Tang Y, Fukai T, Dikalov SI, Ma Y, Fujimoto M, Quinn MT, Pagano PJ, Johnson C, Alexander RW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "12480817",
"url": "https://glygen.org/publication/PubMed/12480817"
}
]
},
{
"title": "Cellular arachidonate-releasing function of novel classes of secretory phospholipase A2s (groups III and XII).",
"journal": "The Journal of biological chemistry",
"date": "2003",
"authors": "Murakami M, Masuda S, Shimbara S, Bezzine S, Lazdunski M, Lambeau G, Gelb MH, Matsukura S, Kokubu F, Adachi M, Kudo I",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1483166",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166"
}
],
"reference": [
{
"type": "PubMed",
"id": "12522102",
"url": "https://glygen.org/publication/PubMed/12522102"
}
]
},
{
"title": "Deleted in liver cancer (DLC) 2 encodes a RhoGAP protein with growth suppressor function and is underexpressed in hepatocellular carcinoma.",
"journal": "The Journal of biological chemistry",
"date": "2003",
"authors": "Ching YP, Wong CM, Chan SF, Leung TH, Ng DC, Jin DY, Ng IO",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "12531887",
"url": "https://glygen.org/publication/PubMed/12531887"
}
]
},
{
"title": "Rapid induction of dendritic spine morphogenesis by trans-synaptic ephrinB-EphB receptor activation of the Rho-GEF kalirin.",
"journal": "Neuron",
"date": "2003",
"authors": "Penzes P, Beeser A, Chernoff J, Schiller MR, Eipper BA, Mains RE, Huganir RL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "12546821",
"url": "https://glygen.org/publication/PubMed/12546821"
}
]
},
{
"title": "A Rac/Cdc42-specific exchange factor, GEFT, induces cell proliferation, transformation, and migration.",
"journal": "The Journal of biological chemistry",
"date": "2003",
"authors": "Guo X, Stafford LJ, Bryan B, Xia C, Ma W, Wu X, Liu D, Songyang Z, Liu M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "12547822",
"url": "https://glygen.org/publication/PubMed/12547822"
}
]
},
{
"title": "ArhGAP15, a novel human RacGAP protein with GTPase binding property.",
"journal": "FEBS letters",
"date": "2003",
"authors": "Seoh ML, Ng CH, Yong J, Lim L, Leung T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "12650940",
"url": "https://glygen.org/publication/PubMed/12650940"
}
]
},
{
"title": "The role of PI3K in immune cells.",
"journal": "Nature immunology",
"date": "2003",
"authors": "Koyasu S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029485",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485"
}
],
"reference": [
{
"type": "PubMed",
"id": "12660731",
"url": "https://glygen.org/publication/PubMed/12660731"
}
]
},
{
"title": "Translocation of CrkL to focal adhesions mediates integrin-induced migration downstream of Src family kinases.",
"journal": "Molecular and cellular biology",
"date": "2003",
"authors": "Li L, Guris DL, Okura M, Imamoto A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "12665586",
"url": "https://glygen.org/publication/PubMed/12665586"
}
]
},
{
"title": "p250GAP, a novel brain-enriched GTPase-activating protein for Rho family GTPases, is involved in the N-methyl-d-aspartate receptor signaling.",
"journal": "Molecular biology of the cell",
"date": "2003",
"authors": "Nakazawa T, Watabe AM, Tezuka T, Yoshida Y, Yokoyama K, Umemori H, Inoue A, Okabe S, Manabe T, Yamamoto T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "12857875",
"url": "https://glygen.org/publication/PubMed/12857875"
}
]
},
{
"title": "Class I phosphoinositide 3-kinase p110beta is required for apoptotic cell and Fcgamma receptor-mediated phagocytosis by macrophages.",
"journal": "The Journal of biological chemistry",
"date": "2003",
"authors": "Leverrier Y, Okkenhaug K, Sawyer C, Bilancio A, Vanhaesebroeck B, Ridley AJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029485",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485"
}
],
"reference": [
{
"type": "PubMed",
"id": "12869549",
"url": "https://glygen.org/publication/PubMed/12869549"
}
]
},
{
"title": "Characterization of the Rac-GAP (Rac-GTPase-activating protein) activity of beta2-chimaerin, a 'non-protein kinase C' phorbol ester receptor.",
"journal": "The Biochemical journal",
"date": "2003",
"authors": "Caloca MJ, Wang H, Kazanietz MG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "12877655",
"url": "https://glygen.org/publication/PubMed/12877655"
}
]
},
{
"title": "T cell receptor engagement leads to the recruitment of IBP, a novel guanine nucleotide exchange factor, to the immunological synapse.",
"journal": "The Journal of biological chemistry",
"date": "2003",
"authors": "Gupta S, Fanzo JC, Hu C, Cox D, Jang SY, Lee AE, Greenberg S, Pernis AB",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "12923183",
"url": "https://glygen.org/publication/PubMed/12923183"
}
]
},
{
"title": "Biochemical and molecular characterization of two phosphatidic acid-selective phospholipase A1s, mPA-PLA1alpha and mPA-PLA1beta.",
"journal": "The Journal of biological chemistry",
"date": "2003",
"authors": "Hiramatsu T, Sonoda H, Takanezawa Y, Morikawa R, Ishida M, Kasahara K, Sanai Y, Taguchi R, Aoki J, Arai H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1483166",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166"
}
],
"reference": [
{
"type": "PubMed",
"id": "12963729",
"url": "https://glygen.org/publication/PubMed/12963729"
}
]
},
{
"title": "G Protein betagamma subunits stimulate p114RhoGEF, a guanine nucleotide exchange factor for RhoA and Rac1: regulation of cell shape and reactive oxygen species production.",
"journal": "Circulation research",
"date": "2003",
"authors": "Niu J, Profirovic J, Pan H, Vaiskunaite R, Voyno-Yasenetskaya T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "14512443",
"url": "https://glygen.org/publication/PubMed/14512443"
}
]
},
{
"title": "Molecular dissection of the interaction between the small G proteins Rac1 and RhoA and protein kinase C-related kinase 1 (PRK1).",
"journal": "The Journal of biological chemistry",
"date": "2003",
"authors": "Owen D, Lowe PN, Nietlispach D, Brosnan CE, Chirgadze DY, Parker PJ, Blundell TL, Mott HR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "14514689",
"url": "https://glygen.org/publication/PubMed/14514689"
}
]
},
{
"title": "Phospholipid scramblase 3 controls mitochondrial structure, function, and apoptotic response.",
"journal": "Molecular cancer research : MCR",
"date": "2003",
"authors": "Liu J, Dai Q, Chen J, Durrant D, Freeman A, Liu T, Grossman D, Lee RM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1483166",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166"
}
],
"reference": [
{
"type": "PubMed",
"id": "14573790",
"url": "https://glygen.org/publication/PubMed/14573790"
}
]
},
{
"title": "Post-translational processing of rac p21s is important both for their interaction with the GDP/GTP exchange proteins and for their activation of NADPH oxidase.",
"journal": "The Journal of biological chemistry",
"date": "1992",
"authors": "Ando S, Kaibuchi K, Sasaki T, Hiraoka K, Nishiyama T, Mizuno T, Asada M, Nunoi H, Matsuda I, Matsuura Y, et al.",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013404",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404"
}
],
"reference": [
{
"type": "PubMed",
"id": "1464587",
"url": "https://glygen.org/publication/PubMed/1464587"
}
]
},
{
"title": "Comparative functional analysis of the Rac GTPases.",
"journal": "FEBS letters",
"date": "2003",
"authors": "Haeusler LC, Blumenstein L, Stege P, Dvorsky R, Ahmadian MR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "14675773",
"url": "https://glygen.org/publication/PubMed/14675773"
}
]
},
{
"title": "MOCA induces membrane spreading by activating Rac1.",
"journal": "The Journal of biological chemistry",
"date": "2004",
"authors": "Namekata K, Enokido Y, Iwasawa K, Kimura H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "14718541",
"url": "https://glygen.org/publication/PubMed/14718541"
}
]
},
{
"title": "Fcgamma RI-triggered generation of arachidonic acid and eicosanoids requires iPLA2 but not cPLA2 in human monocytic cells.",
"journal": "The Journal of biological chemistry",
"date": "2004",
"authors": "Tay HK, Melendez AJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029485",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485"
}
],
"reference": [
{
"type": "PubMed",
"id": "15007079",
"url": "https://glygen.org/publication/PubMed/15007079"
}
]
},
{
"title": "DEF6, a novel PH-DH-like domain protein, is an upstream activator of the Rho GTPases Rac1, Cdc42, and RhoA.",
"journal": "Experimental cell research",
"date": "2004",
"authors": "Mavrakis KJ, McKinlay KJ, Jones P, Sablitzky F",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "15023524",
"url": "https://glygen.org/publication/PubMed/15023524"
}
]
},
{
"title": "Alsin is a Rab5 and Rac1 guanine nucleotide exchange factor.",
"journal": "The Journal of biological chemistry",
"date": "2004",
"authors": "Topp JD, Gray NW, Gerard RD, Horazdovsky BF",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "15033976",
"url": "https://glygen.org/publication/PubMed/15033976"
}
]
},
{
"title": "BPGAP1 interacts with cortactin and facilitates its translocation to cell periphery for enhanced cell migration.",
"journal": "Molecular biology of the cell",
"date": "2004",
"authors": "Lua BL, Low BC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "15064355",
"url": "https://glygen.org/publication/PubMed/15064355"
}
]
},
{
"title": "Scambio, a novel guanine nucleotide exchange factor for Rho.",
"journal": "Molecular cancer",
"date": "2004",
"authors": "Curtis C, Hemmeryckx B, Haataja L, Senadheera D, Groffen J, Heisterkamp N",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "15107133",
"url": "https://glygen.org/publication/PubMed/15107133"
}
]
},
{
"title": "SGEF, a RhoG guanine nucleotide exchange factor that stimulates macropinocytosis.",
"journal": "Molecular biology of the cell",
"date": "2004",
"authors": "Ellerbroek SM, Wennerberg K, Arthur WT, Dunty JM, Bowman DR, DeMali KA, Der C, Burridge K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "15133129",
"url": "https://glygen.org/publication/PubMed/15133129"
}
]
},
{
"title": "Identification and characterization of a novel Rho GTPase activating protein implicated in receptor-mediated endocytosis.",
"journal": "FEBS letters",
"date": "2004",
"authors": "Sakakibara T, Nemoto Y, Nukiwa T, Takeshima H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "15147912",
"url": "https://glygen.org/publication/PubMed/15147912"
}
]
},
{
"title": "Mechanism of tyrosine phosphorylation and activation of phospholipase C-gamma 1. Tyrosine 783 phosphorylation is not sufficient for lipase activation.",
"journal": "The Journal of biological chemistry",
"date": "2004",
"authors": "Sekiya F, Poulin B, Kim YJ, Rhee SG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029485",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485"
}
],
"reference": [
{
"type": "PubMed",
"id": "15161916",
"url": "https://glygen.org/publication/PubMed/15161916"
}
]
},
{
"title": "Cdc42, Rac1, and Rac2 display distinct patterns of activation during phagocytosis.",
"journal": "Molecular biology of the cell",
"date": "2004",
"authors": "Hoppe AD, Swanson JA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013404",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404"
}
],
"reference": [
{
"type": "PubMed",
"id": "15169870",
"url": "https://glygen.org/publication/PubMed/15169870"
}
]
},
{
"title": "Phospholipases D1 and D2 coordinately regulate macrophage phagocytosis.",
"journal": "Journal of immunology (Baltimore, Md. : 1950)",
"date": "2004",
"authors": "Iyer SS, Barton JA, Bourgoin S, Kusner DJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029485",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485"
}
],
"reference": [
{
"type": "PubMed",
"id": "15294978",
"url": "https://glygen.org/publication/PubMed/15294978"
}
]
},
{
"title": "A vascular cell-restricted RhoGAP, p73RhoGAP, is a key regulator of angiogenesis.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2004",
"authors": "Su ZJ, Hahn CN, Goodall GJ, Reck NM, Leske AF, Davy A, Kremmidiotis G, Vadas MA, Gamble JR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "15302923",
"url": "https://glygen.org/publication/PubMed/15302923"
}
]
},
{
"title": "Galpha13 stimulates cell migration through cortactin-interacting protein Hax-1.",
"journal": "The Journal of biological chemistry",
"date": "2004",
"authors": "Radhika V, Onesime D, Ha JH, Dhanasekaran N",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "15339924",
"url": "https://glygen.org/publication/PubMed/15339924"
}
]
},
{
"title": "Vilse, a conserved Rac/Cdc42 GAP mediating Robo repulsion in tracheal cells and axons.",
"journal": "Genes & development",
"date": "2004",
"authors": "Lundstrom A, Gallio M, Englund C, Steneberg P, Hemphala J, Aspenstrom P, Keleman K, Falileeva L, Dickson BJ, Samakovlis C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "15342493",
"url": "https://glygen.org/publication/PubMed/15342493"
}
]
},
{
"title": "Cloning and characterization of murine 1-acyl-sn-glycerol 3-phosphate acyltransferases and their regulation by PPARalpha in murine heart.",
"journal": "The Biochemical journal",
"date": "2005",
"authors": "Lu B, Jiang YJ, Zhou Y, Xu FY, Hatch GM, Choy PC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1483166",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166"
}
],
"reference": [
{
"type": "PubMed",
"id": "15367102",
"url": "https://glygen.org/publication/PubMed/15367102"
}
]
},
{
"title": "WGEF is a novel RhoGEF expressed in intestine, liver, heart, and kidney.",
"journal": "Biochemical and biophysical research communications",
"date": "2004",
"authors": "Wang Y, Suzuki H, Yokoo T, Tada-Iida K, Kihara R, Miura M, Watanabe K, Sone H, Shimano H, Toyoshima H, Yamada N",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "15485661",
"url": "https://glygen.org/publication/PubMed/15485661"
}
]
},
{
"title": "Structural mechanism for lipid activation of the Rac-specific GAP, beta2-chimaerin.",
"journal": "Cell",
"date": "2004",
"authors": "Canagarajah B, Leskow FC, Ho JY, Mischak H, Saidi LF, Kazanietz MG, Hurley JH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "15507211",
"url": "https://glygen.org/publication/PubMed/15507211"
}
]
},
{
"title": "Molecular basis for a direct interaction between the Syk protein-tyrosine kinase and phosphoinositide 3-kinase.",
"journal": "The Journal of biological chemistry",
"date": "2005",
"authors": "Moon KD, Post CB, Durden DL, Zhou Q, De P, Harrison ML, Geahlen RL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029485",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485"
}
],
"reference": [
{
"type": "PubMed",
"id": "15536084",
"url": "https://glygen.org/publication/PubMed/15536084"
}
]
},
{
"title": "SWAP-70 regulates c-kit-induced mast cell activation, cell-cell adhesion, and migration.",
"journal": "Molecular and cellular biology",
"date": "2004",
"authors": "Sivalenka RR, Jessberger R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013404",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404"
}
],
"reference": [
{
"type": "PubMed",
"id": "15542837",
"url": "https://glygen.org/publication/PubMed/15542837"
}
]
},
{
"title": "A Rac1/phosphatidylinositol 3-kinase/Akt3 anti-apoptotic pathway, triggered by AlsinLF, the product of the ALS2 gene, antagonizes Cu/Zn-superoxide dismutase (SOD1) mutant-induced motoneuronal cell death.",
"journal": "The Journal of biological chemistry",
"date": "2005",
"authors": "Kanekura K, Hashimoto Y, Kita Y, Sasabe J, Aiso S, Nishimoto I, Matsuoka M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "15579468",
"url": "https://glygen.org/publication/PubMed/15579468"
}
]
},
{
"title": "TIM, a Dbl-related protein, regulates cell shape and cytoskeletal organization in a Rho-dependent manner.",
"journal": "Cellular signalling",
"date": "2005",
"authors": "Xie X, Chang SW, Tatsumoto T, Chan AM, Miki T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "15601624",
"url": "https://glygen.org/publication/PubMed/15601624"
}
]
},
{
"title": "Characterization of a novel GTPase-activating protein associated with focal adhesions and the actin cytoskeleton.",
"journal": "The Journal of biological chemistry",
"date": "2005",
"authors": "Lavelin I, Geiger B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "15611138",
"url": "https://glygen.org/publication/PubMed/15611138"
}
]
},
{
"title": "Local phosphatidylinositol 3,4,5-trisphosphate accumulation recruits Vav2 and Vav3 to activate Rac1/Cdc42 and initiate neurite outgrowth in nerve growth factor-stimulated PC12 cells.",
"journal": "Molecular biology of the cell",
"date": "2005",
"authors": "Aoki K, Nakamura T, Fujikawa K, Matsuda M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "15728722",
"url": "https://glygen.org/publication/PubMed/15728722"
}
]
},
{
"title": "Phosphatidylinositol-4,5-bisphosphate hydrolysis directs actin remodeling during phagocytosis.",
"journal": "The Journal of cell biology",
"date": "2005",
"authors": "Scott CC, Dobson W, Botelho RJ, Coady-Osberg N, Chavrier P, Knecht DA, Heath C, Stahl P, Grinstein S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029485",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485"
}
],
"reference": [
{
"type": "PubMed",
"id": "15809313",
"url": "https://glygen.org/publication/PubMed/15809313"
}
]
},
{
"title": "Rac2 regulates neutrophil chemotaxis, superoxide production, and myeloid colony formation through multiple distinct effector pathways.",
"journal": "Journal of immunology (Baltimore, Md. : 1950)",
"date": "2005",
"authors": "Carstanjen D, Yamauchi A, Koornneef A, Zang H, Filippi MD, Harris C, Towe J, Atkinson S, Zheng Y, Dinauer MC, Williams DA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013404",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404"
}
],
"reference": [
{
"type": "PubMed",
"id": "15814684",
"url": "https://glygen.org/publication/PubMed/15814684"
}
]
},
{
"title": "Recognition and activation of Rho GTPases by Vav1 and Vav2 guanine nucleotide exchange factors.",
"journal": "Biochemistry",
"date": "2005",
"authors": "Heo J, Thapar R, Campbell SL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "15850391",
"url": "https://glygen.org/publication/PubMed/15850391"
}
]
},
{
"title": "Involvement of a Rac activator,P-Rex1, in neurotrophin-derived signaling and neuronal migration.",
"journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience",
"date": "2005",
"authors": "Yoshizawa M, Kawauchi T, Sone M, Nishimura YV, Terao M, Chihama K, Nabeshima Y, Hoshino M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "15858067",
"url": "https://glygen.org/publication/PubMed/15858067"
}
]
},
{
"title": "Substrate specificity and recognition is conferred by the pleckstrin homology domain of the Dbl family guanine nucleotide exchange factor P-Rex2.",
"journal": "The Journal of biological chemistry",
"date": "2005",
"authors": "Joseph RE, Norris FA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "15897194",
"url": "https://glygen.org/publication/PubMed/15897194"
}
]
},
{
"title": "Sites on phospholipase D2 phosphorylated by PKCalpha.",
"journal": "Biochemical and biophysical research communications",
"date": "2005",
"authors": "Chen JS, Exton JH",
"evidence": [
{
"database": "iPTMnet",
"id": "O14939",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14939"
}
],
"reference": [
{
"type": "PubMed",
"id": "15979581",
"url": "https://glygen.org/publication/PubMed/15979581"
}
]
},
{
"title": "Regulation of p21-activated kinase-independent Rac1 signal transduction by nischarin.",
"journal": "The Journal of biological chemistry",
"date": "2005",
"authors": "Reddig PJ, Xu D, Juliano RL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "16002401",
"url": "https://glygen.org/publication/PubMed/16002401"
}
]
},
{
"title": "Isoform-specific membrane targeting mechanism of Rac during Fc gamma R-mediated phagocytosis: positive charge-dependent and independent targeting mechanism of Rac to the phagosome.",
"journal": "Journal of immunology (Baltimore, Md. : 1950)",
"date": "2005",
"authors": "Ueyama T, Eto M, Kami K, Tatsuno T, Kobayashi T, Shirai Y, Lennartz MR, Takeya R, Sumimoto H, Saito N",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013404",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404"
}
],
"reference": [
{
"type": "PubMed",
"id": "16081809",
"url": "https://glygen.org/publication/PubMed/16081809"
}
]
},
{
"title": "GrinchGEF--a novel Rho-specific guanine nucleotide exchange factor.",
"journal": "Biochemical and biophysical research communications",
"date": "2005",
"authors": "Winkler S, Mohl M, Wieland T, Lutz S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "16112081",
"url": "https://glygen.org/publication/PubMed/16112081"
}
]
},
{
"title": "The t complex-encoded GTPase-activating protein Tagap1 acts as a transmission ratio distorter in mice.",
"journal": "Nature genetics",
"date": "2005",
"authors": "Bauer H, Willert J, Koschorz B, Herrmann BG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "16116428",
"url": "https://glygen.org/publication/PubMed/16116428"
}
]
},
{
"title": "ARHGAP10 is necessary for alpha-catenin recruitment at adherens junctions and for Listeria invasion.",
"journal": "Nature cell biology",
"date": "2005",
"authors": "Sousa S, Cabanes D, Archambaud C, Colland F, Lemichez E, Popoff M, Boisson-Dupuis S, Gouin E, Lecuit M, Legrain P, Cossart P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "16184169",
"url": "https://glygen.org/publication/PubMed/16184169"
}
]
},
{
"title": "P-Rex1 regulates neutrophil function.",
"journal": "Current biology : CB",
"date": "2005",
"authors": "Welch HC, Condliffe AM, Milne LJ, Ferguson GJ, Hill K, Webb LM, Okkenhaug K, Coadwell WJ, Andrews SR, Thelen M, Jones GE, Hawkins PT, Stephens LR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013404",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404"
}
],
"reference": [
{
"type": "PubMed",
"id": "16243035",
"url": "https://glygen.org/publication/PubMed/16243035"
}
]
},
{
"title": "P-Rex1 is a primary Rac2 guanine nucleotide exchange factor in mouse neutrophils.",
"journal": "Current biology : CB",
"date": "2005",
"authors": "Dong X, Mo Z, Bokoch G, Guo C, Li Z, Wu D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "16243036",
"url": "https://glygen.org/publication/PubMed/16243036"
}
]
},
{
"title": "Crystal structures of human glycerol 3-phosphate dehydrogenase 1 (GPD1).",
"journal": "Journal of molecular biology",
"date": "2006",
"authors": "Ou X, Ji C, Han X, Zhao X, Li X, Mao Y, Wong LL, Bartlam M, Rao Z",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1483166",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166"
}
],
"reference": [
{
"type": "PubMed",
"id": "16460752",
"url": "https://glygen.org/publication/PubMed/16460752"
}
]
},
{
"title": "Biochemical characterization of Alsin, a Rab5 and Rac1 guanine nucleotide exchange factor.",
"journal": "Methods in enzymology",
"date": "2005",
"authors": "Topp JD, Carney DS, Horazdovsky BF",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "16473593",
"url": "https://glygen.org/publication/PubMed/16473593"
}
]
},
{
"title": "Targeting and activation of Rac1 are mediated by the exchange factor beta-Pix.",
"journal": "The Journal of cell biology",
"date": "2006",
"authors": "ten Klooster JP, Jaffer ZM, Chernoff J, Hordijk PL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "16492808",
"url": "https://glygen.org/publication/PubMed/16492808"
}
]
},
{
"title": "A regulatory role for 1-acylglycerol-3-phosphate-O-acyltransferase 2 in adipocyte differentiation.",
"journal": "The Journal of biological chemistry",
"date": "2006",
"authors": "Gale SE, Frolov A, Han X, Bickel PE, Cao L, Bowcock A, Schaffer JE, Ory DS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1483166",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166"
}
],
"reference": [
{
"type": "PubMed",
"id": "16495223",
"url": "https://glygen.org/publication/PubMed/16495223"
}
]
},
{
"title": "Dynamics and function of phospholipase D and phosphatidic acid during phagocytosis.",
"journal": "Traffic (Copenhagen, Denmark)",
"date": "2006",
"authors": "Corrotte M, Chasserot-Golaz S, Huang P, Du G, Ktistakis NT, Frohman MA, Vitale N, Bader MF, Grant NJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029485",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485"
}
],
"reference": [
{
"type": "PubMed",
"id": "16497229",
"url": "https://glygen.org/publication/PubMed/16497229"
}
]
},
{
"title": "Involvement of Rac1 in activation of multicomponent Nox1- and Nox3-based NADPH oxidases.",
"journal": "Molecular and cellular biology",
"date": "2006",
"authors": "Ueyama T, Geiszt M, Leto TL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "16507994",
"url": "https://glygen.org/publication/PubMed/16507994"
}
]
},
{
"title": "The human orthologue of CdGAP is a phosphoprotein and a GTPase-activating protein for Cdc42 and Rac1 but not RhoA.",
"journal": "Biology of the cell",
"date": "2006",
"authors": "Tcherkezian J, Triki I, Stenne R, Danek EI, Lamarche-Vane N",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "16519628",
"url": "https://glygen.org/publication/PubMed/16519628"
}
]
},
{
"title": "Regulation of phagocyte oxygen radical production by the GTP-binding protein Rac 2.",
"journal": "Science (New York, N.Y.)",
"date": "1991",
"authors": "Knaus UG, Heyworth PG, Evans T, Curnutte JT, Bokoch GM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013404",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404"
}
],
"reference": [
{
"type": "PubMed",
"id": "1660188",
"url": "https://glygen.org/publication/PubMed/1660188"
}
]
},
{
"title": "Functional characterization of human 1-acylglycerol-3-phosphate acyltransferase isoform 8: cloning, tissue distribution, gene structure, and enzymatic activity.",
"journal": "Archives of biochemistry and biophysics",
"date": "2006",
"authors": "Agarwal AK, Barnes RI, Garg A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1483166",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166"
}
],
"reference": [
{
"type": "PubMed",
"id": "16620771",
"url": "https://glygen.org/publication/PubMed/16620771"
}
]
},
{
"title": "Nox1-dependent reactive oxygen generation is regulated by Rac1.",
"journal": "The Journal of biological chemistry",
"date": "2006",
"authors": "Cheng G, Diebold BA, Hughes Y, Lambeth JD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "16636067",
"url": "https://glygen.org/publication/PubMed/16636067"
}
]
},
{
"title": "PKD at the crossroads of DAG and PKC signaling.",
"journal": "Trends in pharmacological sciences",
"date": "2006",
"authors": "Wang QJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029485",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485"
}
],
"reference": [
{
"type": "PubMed",
"id": "16678913",
"url": "https://glygen.org/publication/PubMed/16678913"
}
]
},
{
"title": "Optimization of WAVE2 complex-induced actin polymerization by membrane-bound IRSp53, PIP(3), and Rac.",
"journal": "The Journal of cell biology",
"date": "2006",
"authors": "Suetsugu S, Kurisu S, Oikawa T, Yamazaki D, Oda A, Takenawa T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "16702231",
"url": "https://glygen.org/publication/PubMed/16702231"
}
]
},
{
"title": "Cloning and characterization of mouse lung-type acyl-CoA:lysophosphatidylcholine acyltransferase 1 (LPCAT1). Expression in alveolar type II cells and possible involvement in surfactant production.",
"journal": "The Journal of biological chemistry",
"date": "2006",
"authors": "Nakanishi H, Shindou H, Hishikawa D, Harayama T, Ogasawara R, Suwabe A, Taguchi R, Shimizu T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1483166",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166"
}
],
"reference": [
{
"type": "PubMed",
"id": "16704971",
"url": "https://glygen.org/publication/PubMed/16704971"
}
]
},
{
"title": "Direct involvement of the small GTPase Rac in activation of the superoxide-producing NADPH oxidase Nox1.",
"journal": "The Journal of biological chemistry",
"date": "2006",
"authors": "Miyano K, Ueno N, Takeya R, Sumimoto H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "16762923",
"url": "https://glygen.org/publication/PubMed/16762923"
}
]
},
{
"title": "The effect of missense mutations in the RhoGAP-homology domain on ocrl1 function.",
"journal": "Molecular genetics and metabolism",
"date": "2006",
"authors": "Lichter-Konecki U, Farber LW, Cronin JS, Suchy SF, Nussbaum RL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "16777452",
"url": "https://glygen.org/publication/PubMed/16777452"
}
]
},
{
"title": "Physical and functional interaction of Fyn tyrosine kinase with a brain-enriched Rho GTPase-activating protein TCGAP.",
"journal": "The Journal of biological chemistry",
"date": "2006",
"authors": "Liu H, Nakazawa T, Tezuka T, Yamamoto T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "16777849",
"url": "https://glygen.org/publication/PubMed/16777849"
}
]
},
{
"title": "FilGAP, a Rho- and ROCK-regulated GAP for Rac binds filamin A to control actin remodelling.",
"journal": "Nature cell biology",
"date": "2006",
"authors": "Ohta Y, Hartwig JH, Stossel TP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "16862148",
"url": "https://glygen.org/publication/PubMed/16862148"
}
]
},
{
"title": "Identification and characterization of a lysophosphatidylcholine acyltransferase in alveolar type II cells.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2006",
"authors": "Chen X, Hyatt BA, Mucenski ML, Mason RJ, Shannon JM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1483166",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166"
}
],
"reference": [
{
"type": "PubMed",
"id": "16864775",
"url": "https://glygen.org/publication/PubMed/16864775"
}
]
},
{
"title": "Gef10--the third member of a Rho-specific guanine nucleotide exchange factor subfamily with unusual protein architecture.",
"journal": "Naunyn-Schmiedeberg's archives of pharmacology",
"date": "2006",
"authors": "Mohl M, Winkler S, Wieland T, Lutz S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "16896804",
"url": "https://glygen.org/publication/PubMed/16896804"
}
]
},
{
"title": "Gene targeting of Cdc42 and Cdc42GAP affirms the critical involvement of Cdc42 in filopodia induction, directed migration, and proliferation in primary mouse embryonic fibroblasts.",
"journal": "Molecular biology of the cell",
"date": "2006",
"authors": "Yang L, Wang L, Zheng Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "16914516",
"url": "https://glygen.org/publication/PubMed/16914516"
}
]
},
{
"title": "The consensus coding sequences of human breast and colorectal cancers.",
"journal": "Science (New York, N.Y.)",
"date": "2006",
"authors": "Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE",
"evidence": [
{
"database": "UniProtKB",
"id": "O14939",
"url": "https://www.uniprot.org/uniprot/O14939"
}
],
"reference": [
{
"type": "PubMed",
"id": "16959974",
"url": "https://glygen.org/publication/PubMed/16959974"
}
]
},
{
"title": "Identification of a DOCK180-related guanine nucleotide exchange factor that is capable of mediating a positive feedback activation of Cdc42.",
"journal": "The Journal of biological chemistry",
"date": "2006",
"authors": "Lin Q, Yang W, Baird D, Feng Q, Cerione RA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "16968698",
"url": "https://glygen.org/publication/PubMed/16968698"
}
]
},
{
"title": "A common lipid links Mfn-mediated mitochondrial fusion and SNARE-regulated exocytosis.",
"journal": "Nature cell biology",
"date": "2006",
"authors": "Choi SY, Huang P, Jenkins GM, Chan DC, Schiller J, Frohman MA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1483166",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166"
}
],
"reference": [
{
"type": "PubMed",
"id": "17028579",
"url": "https://glygen.org/publication/PubMed/17028579"
}
]
},
{
"title": "The Rac effector p67phox regulates phagocyte NADPH oxidase by stimulating Vav1 guanine nucleotide exchange activity.",
"journal": "Molecular and cellular biology",
"date": "2007",
"authors": "Ming W, Li S, Billadeau DD, Quilliam LA, Dinauer MC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013404",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404"
}
],
"reference": [
{
"type": "PubMed",
"id": "17060455",
"url": "https://glygen.org/publication/PubMed/17060455"
}
]
},
{
"title": "ARAP2 effects on the actin cytoskeleton are dependent on Arf6-specific GTPase-activating-protein activity and binding to RhoA-GTP.",
"journal": "Journal of cell science",
"date": "2006",
"authors": "Yoon HY, Miura K, Cuthbert EJ, Davis KK, Ahvazi B, Casanova JE, Randazzo PA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "17077126",
"url": "https://glygen.org/publication/PubMed/17077126"
}
]
},
{
"title": "Asef2 functions as a Cdc42 exchange factor and is stimulated by the release of an autoinhibitory module from a concealed C-terminal activation element.",
"journal": "Molecular and cellular biology",
"date": "2007",
"authors": "Hamann MJ, Lubking CM, Luchini DN, Billadeau DD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "17145773",
"url": "https://glygen.org/publication/PubMed/17145773"
}
]
},
{
"title": "Vav proteins control MyD88-dependent oxidative burst.",
"journal": "Blood",
"date": "2007",
"authors": "Miletic AV, Graham DB, Montgrain V, Fujikawa K, Kloeppel T, Brim K, Weaver B, Schreiber R, Xavier R, Swat W",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013404",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404"
}
],
"reference": [
{
"type": "PubMed",
"id": "17158234",
"url": "https://glygen.org/publication/PubMed/17158234"
}
]
},
{
"title": "Molecular identification of microsomal acyl-CoA:glycerol-3-phosphate acyltransferase, a key enzyme in de novo triacylglycerol synthesis.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2006",
"authors": "Cao J, Li JL, Li D, Tobin JF, Gimeno RE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1483166",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166"
}
],
"reference": [
{
"type": "PubMed",
"id": "17170135",
"url": "https://glygen.org/publication/PubMed/17170135"
}
]
},
{
"title": "Dock6, a Dock-C subfamily guanine nucleotide exchanger, has the dual specificity for Rac1 and Cdc42 and regulates neurite outgrowth.",
"journal": "Experimental cell research",
"date": "2007",
"authors": "Miyamoto Y, Yamauchi J, Sanbe A, Tanoue A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "17196961",
"url": "https://glygen.org/publication/PubMed/17196961"
}
]
},
{
"title": "Asef is a Cdc42-specific guanine nucleotide exchange factor.",
"journal": "Biological chemistry",
"date": "2007",
"authors": "Gotthardt K, Ahmadian MR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "17214551",
"url": "https://glygen.org/publication/PubMed/17214551"
}
]
},
{
"title": "IQGAP3, a novel effector of Rac1 and Cdc42, regulates neurite outgrowth.",
"journal": "Journal of cell science",
"date": "2007",
"authors": "Wang S, Watanabe T, Noritake J, Fukata M, Yoshimura T, Itoh N, Harada T, Nakagawa M, Matsuura Y, Arimura N, Kaibuchi K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "17244649",
"url": "https://glygen.org/publication/PubMed/17244649"
}
]
},
{
"title": "Characterization of IQGAP1-containing complexes in NK-like cells: evidence for Rac 2 and RACK1 association during homotypic adhesion.",
"journal": "Journal of proteome research",
"date": "2007",
"authors": "Meng X, Krokhin O, Cheng K, Ens W, Wilkins JA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013404",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404"
}
],
"reference": [
{
"type": "PubMed",
"id": "17269730",
"url": "https://glygen.org/publication/PubMed/17269730"
}
]
},
{
"title": "Role of the small GTPase Rac in p22phox-dependent NADPH oxidases.",
"journal": "Biochimie",
"date": "2007",
"authors": "Miyano K, Sumimoto H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "17583407",
"url": "https://glygen.org/publication/PubMed/17583407"
}
]
},
{
"title": "Cloning and characterization of DPPL1 and DPPL2, representatives of a novel type of mammalian phosphatidate phosphatase.",
"journal": "Gene",
"date": "2007",
"authors": "Takeuchi M, Harigai M, Momohara S, Ball E, Abe J, Furuichi K, Kamatani N",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029485",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485"
}
],
"reference": [
{
"type": "PubMed",
"id": "17590538",
"url": "https://glygen.org/publication/PubMed/17590538"
}
]
},
{
"title": "Identification and characterization of Asef2, a guanine-nucleotide exchange factor specific for Rac1 and Cdc42.",
"journal": "Oncogene",
"date": "2007",
"authors": "Kawasaki Y, Sagara M, Shibata Y, Shirouzu M, Yokoyama S, Akiyama T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "17599059",
"url": "https://glygen.org/publication/PubMed/17599059"
}
]
},
{
"title": "Membrane translocation of P-Rex1 is mediated by G protein betagamma subunits and phosphoinositide 3-kinase.",
"journal": "The Journal of biological chemistry",
"date": "2007",
"authors": "Barber MA, Donald S, Thelen S, Anderson KE, Thelen M, Welch HC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013404",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404"
}
],
"reference": [
{
"type": "PubMed",
"id": "17698854",
"url": "https://glygen.org/publication/PubMed/17698854"
}
]
},
{
"title": "Regulation of ephexin1, a guanine nucleotide exchange factor of Rho family GTPases, by fibroblast growth factor receptor-mediated tyrosine phosphorylation.",
"journal": "The Journal of biological chemistry",
"date": "2007",
"authors": "Zhang Y, Sawada T, Jing X, Yokote H, Yan X, Sakaguchi K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "17702745",
"url": "https://glygen.org/publication/PubMed/17702745"
}
]
},
{
"title": "Topology of acyltransferase motifs and substrate specificity and accessibility in 1-acyl-sn-glycero-3-phosphate acyltransferase 1.",
"journal": "Biochimica et biophysica acta",
"date": "2007",
"authors": "Yamashita A, Nakanishi H, Suzuki H, Kamata R, Tanaka K, Waku K, Sugiura T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1483166",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166"
}
],
"reference": [
{
"type": "PubMed",
"id": "17707131",
"url": "https://glygen.org/publication/PubMed/17707131"
}
]
},
{
"title": "A role of the Lowe syndrome protein OCRL in early steps of the endocytic pathway.",
"journal": "Developmental cell",
"date": "2007",
"authors": "Erdmann KS, Mao Y, McCrea HJ, Zoncu R, Lee S, Paradise S, Modregger J, Biemesderfer D, Toomre D, De Camilli P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "17765681",
"url": "https://glygen.org/publication/PubMed/17765681"
}
]
},
{
"title": "ARHGAP4 is a novel RhoGAP that mediates inhibition of cell motility and axon outgrowth.",
"journal": "Molecular and cellular neurosciences",
"date": "2007",
"authors": "Vogt DL, Gray CD, Young WS 3rd, Orellana SA, Malouf AT",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "17804252",
"url": "https://glygen.org/publication/PubMed/17804252"
}
]
},
{
"title": "START-GAP3/DLC3 is a GAP for RhoA and Cdc42 and is localized in focal adhesions regulating cell morphology.",
"journal": "Biochemical and biophysical research communications",
"date": "2007",
"authors": "Kawai K, Kiyota M, Seike J, Deki Y, Yagisawa H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "17976533",
"url": "https://glygen.org/publication/PubMed/17976533"
}
]
},
{
"title": "Mutation of Y179 on phospholipase D2 (PLD2) upregulates DNA synthesis in a PI3K-and Akt-dependent manner.",
"journal": "Cellular signalling",
"date": "2008",
"authors": "Di Fulvio M, Frondorf K, Gomez-Cambronero J",
"evidence": [
{
"database": "iPTMnet",
"id": "O14939",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14939"
}
],
"reference": [
{
"type": "PubMed",
"id": "18006275",
"url": "https://glygen.org/publication/PubMed/18006275"
}
]
},
{
"title": "The Rac1 polybasic region is required for interaction with its effector PRK1.",
"journal": "The Journal of biological chemistry",
"date": "2008",
"authors": "Modha R, Campbell LJ, Nietlispach D, Buhecha HR, Owen D, Mott HR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "18006505",
"url": "https://glygen.org/publication/PubMed/18006505"
}
]
},
{
"title": "Heterotrimeric G protein betagamma subunits stimulate FLJ00018, a guanine nucleotide exchange factor for Rac1 and Cdc42.",
"journal": "The Journal of biological chemistry",
"date": "2008",
"authors": "Ueda H, Nagae R, Kozawa M, Morishita R, Kimura S, Nagase T, Ohara O, Yoshida S, Asano T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "18045877",
"url": "https://glygen.org/publication/PubMed/18045877"
}
]
},
{
"title": "Specific recognition of Rac2 and Cdc42 by DOCK2 and DOCK9 guanine nucleotide exchange factors.",
"journal": "The Journal of biological chemistry",
"date": "2008",
"authors": "Kwofie MA, Skowronski J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013404",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404"
}
],
"reference": [
{
"type": "PubMed",
"id": "18056264",
"url": "https://glygen.org/publication/PubMed/18056264"
}
]
},
{
"title": "Activation of the small GTPase Rac2 via the B cell receptor regulates B cell adhesion and immunological-synapse formation.",
"journal": "Immunity",
"date": "2008",
"authors": "Arana E, Vehlow A, Harwood NE, Vigorito E, Henderson R, Turner M, Tybulewicz VL, Batista FD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013404",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404"
}
],
"reference": [
{
"type": "PubMed",
"id": "18191593",
"url": "https://glygen.org/publication/PubMed/18191593"
}
]
},
{
"title": "Biochemical characterization of the Rho GTPase-regulated actin assembly by diaphanous-related formins, mDia1 and Daam1, in platelets.",
"journal": "The Journal of biological chemistry",
"date": "2008",
"authors": "Higashi T, Ikeda T, Shirakawa R, Kondo H, Kawato M, Horiguchi M, Okuda T, Okawa K, Fukai S, Nureki O, Kita T, Horiuchi H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "18218625",
"url": "https://glygen.org/publication/PubMed/18218625"
}
]
},
{
"title": "AGPAT6 is a novel microsomal glycerol-3-phosphate acyltransferase.",
"journal": "The Journal of biological chemistry",
"date": "2008",
"authors": "Chen YQ, Kuo MS, Li S, Bui HH, Peake DA, Sanders PE, Thibodeaux SJ, Chu S, Qian YW, Zhao Y, Bredt DS, Moller DE, Konrad RJ, Beigneux AP, Young SG, Cao G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1483166",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166"
}
],
"reference": [
{
"type": "PubMed",
"id": "18238778",
"url": "https://glygen.org/publication/PubMed/18238778"
}
]
},
{
"title": "Role of chimaerins, a group of Rac-specific GTPase activating proteins, in T-cell receptor signaling.",
"journal": "Cellular signalling",
"date": "2008",
"authors": "Caloca MJ, Delgado P, Alarcon B, Bustelo XR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "18249095",
"url": "https://glygen.org/publication/PubMed/18249095"
}
]
},
{
"title": "Identification of a conserved Rac-binding site on NADPH oxidases supports a direct GTPase regulatory mechanism.",
"journal": "The Journal of biological chemistry",
"date": "2008",
"authors": "Kao YY, Gianni D, Bohl B, Taylor RM, Bokoch GM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "18347018",
"url": "https://glygen.org/publication/PubMed/18347018"
}
]
},
{
"title": "Mutation of Dock5, a member of the guanine exchange factor Dock180 superfamily, in the rupture of lens cataract mouse.",
"journal": "Experimental eye research",
"date": "2008",
"authors": "Omi N, Kiyokawa E, Matsuda M, Kinoshita K, Yamada S, Yamada K, Matsushima Y, Wang Y, Kawai J, Suzuki M, Hayashizaki Y, Hiai H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "18396277",
"url": "https://glygen.org/publication/PubMed/18396277"
}
]
},
{
"title": "ErbB2 directly activates the exchange factor Dock7 to promote Schwann cell migration.",
"journal": "The Journal of cell biology",
"date": "2008",
"authors": "Yamauchi J, Miyamoto Y, Chan JR, Tanoue A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "18426980",
"url": "https://glygen.org/publication/PubMed/18426980"
}
]
},
{
"title": "Motif-specific sampling of phosphoproteomes.",
"journal": "Journal of proteome research",
"date": "2008",
"authors": "Ruse CI, McClatchy DB, Lu B, Cociorva D, Motoyama A, Park SK, Yates JR 3rd",
"evidence": [
{
"database": "iPTMnet",
"id": "O14939-1",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14939-1"
}
],
"reference": [
{
"type": "PubMed",
"id": "18452278",
"url": "https://glygen.org/publication/PubMed/18452278"
}
]
},
{
"title": "Phosphorylation and activation of the Rac1 and Cdc42 GEF Asef in A431 cells stimulated by EGF.",
"journal": "Journal of cell science",
"date": "2008",
"authors": "Itoh RE, Kiyokawa E, Aoki K, Nishioka T, Akiyama T, Matsuda M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "18653540",
"url": "https://glygen.org/publication/PubMed/18653540"
}
]
},
{
"title": "Parallel phosphatidylinositol 3-kinase (PI3K)-dependent and Src-dependent pathways lead to CXCL8-mediated Rac2 activation and chemotaxis.",
"journal": "The Journal of biological chemistry",
"date": "2008",
"authors": "Sai J, Raman D, Liu Y, Wikswo J, Richmond A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013404",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404"
}
],
"reference": [
{
"type": "PubMed",
"id": "18662984",
"url": "https://glygen.org/publication/PubMed/18662984"
}
]
},
{
"title": "Acyl-CoA:lysophospholipid acyltransferases.",
"journal": "The Journal of biological chemistry",
"date": "2009",
"authors": "Shindou H, Shimizu T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1483166",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166"
}
],
"reference": [
{
"type": "PubMed",
"id": "18718904",
"url": "https://glygen.org/publication/PubMed/18718904"
}
]
},
{
"title": "FGD2, a CDC42-specific exchange factor expressed by antigen-presenting cells, localizes to early endosomes and active membrane ruffles.",
"journal": "The Journal of biological chemistry",
"date": "2008",
"authors": "Huber C, Martensson A, Bokoch GM, Nemazee D, Gavin AL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "18838382",
"url": "https://glygen.org/publication/PubMed/18838382"
}
]
},
{
"title": "Silencing of D4-GDI inhibits growth and invasive behavior in MDA-MB-231 cells by activation of Rac-dependent p38 and JNK signaling.",
"journal": "The Journal of biological chemistry",
"date": "2009",
"authors": "Zhang Y, Rivera Rosado LA, Moon SY, Zhang B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "19269969",
"url": "https://glygen.org/publication/PubMed/19269969"
}
]
},
{
"title": "Biochemistry, physiology, and genetics of GPAT, AGPAT, and lipin enzymes in triglyceride synthesis.",
"journal": "American journal of physiology. Endocrinology and metabolism",
"date": "2009",
"authors": "Takeuchi K, Reue K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1483166",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166"
}
],
"reference": [
{
"type": "PubMed",
"id": "19336658",
"url": "https://glygen.org/publication/PubMed/19336658"
}
]
},
{
"title": "Cdc42GAP, reactive oxygen species, and the vimentin network.",
"journal": "American journal of physiology. Cell physiology",
"date": "2009",
"authors": "Li QF, Spinelli AM, Tang DD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "19494238",
"url": "https://glygen.org/publication/PubMed/19494238"
}
]
},
{
"title": "The rho-guanine nucleotide exchange factor domain of obscurin activates rhoA signaling in skeletal muscle.",
"journal": "Molecular biology of the cell",
"date": "2009",
"authors": "Ford-Speelman DL, Roche JA, Bowman AL, Bloch RJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "19605563",
"url": "https://glygen.org/publication/PubMed/19605563"
}
]
},
{
"title": "GPD1L links redox state to cardiac excitability by PKC-dependent phosphorylation of the sodium channel SCN5A.",
"journal": "American journal of physiology. Heart and circulatory physiology",
"date": "2009",
"authors": "Valdivia CR, Ueda K, Ackerman MJ, Makielski JC",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1483166",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166"
}
],
"reference": [
{
"type": "PubMed",
"id": "19666841",
"url": "https://glygen.org/publication/PubMed/19666841"
}
]
},
{
"title": "Regulation of the substrate preference of p190RhoGAP by protein kinase C-mediated phosphorylation of a phospholipid binding site.",
"journal": "Biochemistry",
"date": "2009",
"authors": "Levay M, Settleman J, Ligeti E",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "19673492",
"url": "https://glygen.org/publication/PubMed/19673492"
}
]
},
{
"title": "Regulation of immature dendritic cell migration by RhoA guanine nucleotide exchange factor Arhgef5.",
"journal": "The Journal of biological chemistry",
"date": "2009",
"authors": "Wang Z, Kumamoto Y, Wang P, Gan X, Lehmann D, Smrcka AV, Cohn L, Iwasaki A, Li L, Wu D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "19713215",
"url": "https://glygen.org/publication/PubMed/19713215"
}
]
},
{
"title": "The Rho-family GEF Asef2 activates Rac to modulate adhesion and actin dynamics and thereby regulate cell migration.",
"journal": "Journal of cell science",
"date": "2009",
"authors": "Bristow JM, Sellers MH, Majumdar D, Anderson B, Hu L, Webb DJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "19934221",
"url": "https://glygen.org/publication/PubMed/19934221"
}
]
},
{
"title": "A comprehensive model that explains the regulation of phospholipase D2 activity by phosphorylation-dephosphorylation.",
"journal": "Molecular and cellular biology",
"date": "2010",
"authors": "Henkels KM, Peng HJ, Frondorf K, Gomez-Cambronero J",
"evidence": [
{
"database": "iPTMnet",
"id": "O14939",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14939"
}
],
"reference": [
{
"type": "PubMed",
"id": "20176813",
"url": "https://glygen.org/publication/PubMed/20176813"
}
]
},
{
"title": "Regulation of Rho GTPase crosstalk, degradation and activity by RhoGDI1.",
"journal": "Nature cell biology",
"date": "2010",
"authors": "Boulter E, Garcia-Mata R, Guilluy C, Dubash A, Rossi G, Brennwald PJ, Burridge K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "20400958",
"url": "https://glygen.org/publication/PubMed/20400958"
}
]
},
{
"title": "Focal-adhesion targeting links caveolin-1 to a Rac1-degradation pathway.",
"journal": "Journal of cell science",
"date": "2010",
"authors": "Nethe M, Anthony EC, Fernandez-Borja M, Dee R, Geerts D, Hensbergen PJ, Deelder AM, Schmidt G, Hordijk PL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "20460433",
"url": "https://glygen.org/publication/PubMed/20460433"
}
]
},
{
"title": "Ephexin4 and EphA2 mediate cell migration through a RhoG-dependent mechanism.",
"journal": "The Journal of cell biology",
"date": "2010",
"authors": "Hiramoto-Yamaki N, Takeuchi S, Ueda S, Harada K, Fujimoto S, Negishi M, Katoh H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "20679435",
"url": "https://glygen.org/publication/PubMed/20679435"
}
]
},
{
"title": "Interfacial kinetic and binding properties of mammalian group IVB phospholipase A2 (cPLA2beta) and comparison with the other cPLA2 isoforms.",
"journal": "The Journal of biological chemistry",
"date": "2010",
"authors": "Ghomashchi F, Naika GS, Bollinger JG, Aloulou A, Lehr M, Leslie CC, Gelb MH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1483166",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166"
}
],
"reference": [
{
"type": "PubMed",
"id": "20705608",
"url": "https://glygen.org/publication/PubMed/20705608"
}
]
},
{
"title": "Protein kinase Cdelta-mediated phosphorylation of phospholipase D controls integrin-mediated cell spreading.",
"journal": "Molecular and cellular biology",
"date": "2010",
"authors": "Chae YC, Kim KL, Ha SH, Kim J, Suh PG, Ryu SH",
"evidence": [
{
"database": "iPTMnet",
"id": "O14939",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14939"
}
],
"reference": [
{
"type": "PubMed",
"id": "20733000",
"url": "https://glygen.org/publication/PubMed/20733000"
}
]
},
{
"title": "srGAP2 arginine methylation regulates cell migration and cell spreading through promoting dimerization.",
"journal": "The Journal of biological chemistry",
"date": "2010",
"authors": "Guo S, Bao S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "20810653",
"url": "https://glygen.org/publication/PubMed/20810653"
}
]
},
{
"title": "Bi-modal regulation of a formin by srGAP2.",
"journal": "The Journal of biological chemistry",
"date": "2011",
"authors": "Mason FM, Heimsath EG, Higgs HN, Soderling SH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "21148482",
"url": "https://glygen.org/publication/PubMed/21148482"
}
]
},
{
"title": "The distinct role of guanine nucleotide exchange factor Vav1 in Bcl-2 transcription and apoptosis inhibition in Jurkat leukemia T cells.",
"journal": "Acta pharmacologica Sinica",
"date": "2011",
"authors": "Yin J, Wan YJ, Li SY, Du MJ, Zhang CZ, Zhou XL, Cao YJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013404",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404"
}
],
"reference": [
{
"type": "PubMed",
"id": "21151158",
"url": "https://glygen.org/publication/PubMed/21151158"
}
]
},
{
"title": "Enzymatic activities of the human AGPAT isoform 3 and isoform 5: localization of AGPAT5 to mitochondria.",
"journal": "Journal of lipid research",
"date": "2011",
"authors": "Prasad SS, Garg A, Agarwal AK",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1483166",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166"
}
],
"reference": [
{
"type": "PubMed",
"id": "21173190",
"url": "https://glygen.org/publication/PubMed/21173190"
}
]
},
{
"title": "Evidence for two CRIB domains in phospholipase D2 (PLD2) that the enzyme uses to specifically bind to the small GTPase Rac2.",
"journal": "The Journal of biological chemistry",
"date": "2011",
"authors": "Peng HJ, Henkels KM, Mahankali M, Dinauer MC, Gomez-Cambronero J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013404",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404"
}
],
"reference": [
{
"type": "PubMed",
"id": "21378159",
"url": "https://glygen.org/publication/PubMed/21378159"
}
]
},
{
"title": "Cell invasion of highly metastatic MTLn3 cancer cells is dependent on phospholipase D2 (PLD2) and Janus kinase 3 (JAK3).",
"journal": "Journal of molecular biology",
"date": "2011",
"authors": "Henkels KM, Farkaly T, Mahankali M, Segall JE, Gomez-Cambronero J",
"evidence": [
{
"database": "iPTMnet",
"id": "O14939",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14939"
}
],
"reference": [
{
"type": "PubMed",
"id": "21414324",
"url": "https://glygen.org/publication/PubMed/21414324"
}
]
},
{
"title": "The Rac1 exchange factor Dock5 is essential for bone resorption by osteoclasts.",
"journal": "Journal of bone and mineral research : the official journal of the American Society for Bone and Mineral Research",
"date": "2011",
"authors": "Vives V, Laurin M, Cres G, Larrousse P, Morichaud Z, Noel D, Cote JF, Blangy A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "21542010",
"url": "https://glygen.org/publication/PubMed/21542010"
}
]
},
{
"title": "ARHGAP30 is a Wrch-1-interacting protein involved in actin dynamics and cell adhesion.",
"journal": "Biochemical and biophysical research communications",
"date": "2011",
"authors": "Naji L, Pacholsky D, Aspenstrom P",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "21565175",
"url": "https://glygen.org/publication/PubMed/21565175"
}
]
},
{
"title": "Multiple factors confer specific Cdc42 and Rac protein activation by dedicator of cytokinesis (DOCK) nucleotide exchange factors.",
"journal": "The Journal of biological chemistry",
"date": "2011",
"authors": "Kulkarni K, Yang J, Zhang Z, Barford D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "21613211",
"url": "https://glygen.org/publication/PubMed/21613211"
}
]
},
{
"title": "Mitochondrial phosphatase PTPMT1 is essential for cardiolipin biosynthesis.",
"journal": "Cell metabolism",
"date": "2011",
"authors": "Zhang J, Guan Z, Murphy AN, Wiley SE, Perkins GA, Worby CA, Engel JL, Heacock P, Nguyen OK, Wang JH, Raetz CR, Dowhan W, Dixon JE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1483148",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483148"
}
],
"reference": [
{
"type": "PubMed",
"id": "21641550",
"url": "https://glygen.org/publication/PubMed/21641550"
}
]
},
{
"title": "The IQGAP1 protein is a calmodulin-regulated barbed end capper of actin filaments: possible implications in its function in cell migration.",
"journal": "The Journal of biological chemistry",
"date": "2011",
"authors": "Pelikan-Conchaudron A, Le Clainche C, Didry D, Carlier MF",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "21730051",
"url": "https://glygen.org/publication/PubMed/21730051"
}
]
},
{
"title": "ARHGAP18, a GTPase-activating protein for RhoA, controls cell shape, spreading, and motility.",
"journal": "Molecular biology of the cell",
"date": "2011",
"authors": "Maeda M, Hasegawa H, Hyodo T, Ito S, Asano E, Yuang H, Funasaka K, Shimokata K, Hasegawa Y, Hamaguchi M, Senga T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "21865595",
"url": "https://glygen.org/publication/PubMed/21865595"
}
]
},
{
"title": "Dysregulation of Rho GTPases in the alphaPix/Arhgef6 mouse model of X-linked intellectual disability is paralleled by impaired structural and synaptic plasticity and cognitive deficits.",
"journal": "Human molecular genetics",
"date": "2012",
"authors": "Ramakers GJ, Wolfer D, Rosenberger G, Kuchenbecker K, Kreienkamp HJ, Prange-Kiel J, Rune G, Richter K, Langnaese K, Masneuf S, Bosl MR, Fischer KD, Krugers HJ, Lipp HP, van Galen E, Kutsche K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "21989057",
"url": "https://glygen.org/publication/PubMed/21989057"
}
]
},
{
"title": "Detection of Rho GEF and GAP activity through a sensitive split luciferase assay system.",
"journal": "The Biochemical journal",
"date": "2012",
"authors": "Anderson EL, Hamann MJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "22004470",
"url": "https://glygen.org/publication/PubMed/22004470"
}
]
},
{
"title": "ARHGAP25, a novel Rac GTPase-activating protein, regulates phagocytosis in human neutrophilic granulocytes.",
"journal": "Blood",
"date": "2012",
"authors": "Csepanyi-Komi R, Sirokmany G, Geiszt M, Ligeti E",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "22096251",
"url": "https://glygen.org/publication/PubMed/22096251"
}
]
},
{
"title": "The GRAF family member oligophrenin1 is a RhoGAP with BAR domain and regulates Rho GTPases in platelets.",
"journal": "Cardiovascular research",
"date": "2012",
"authors": "Elvers M, Beck S, Fotinos A, Ziegler M, Gawaz M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "22298643",
"url": "https://glygen.org/publication/PubMed/22298643"
}
]
},
{
"title": "RAC1 activation mediates Twist1-induced cancer cell migration.",
"journal": "Nature cell biology",
"date": "2012",
"authors": "Yang WH, Lan HY, Huang CH, Tai SK, Tzeng CH, Kao SY, Wu KJ, Hung MC, Yang MH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "22407364",
"url": "https://glygen.org/publication/PubMed/22407364"
}
]
},
{
"title": "Dock7: a GEF for Rho-family GTPases and a novel myosin VI-binding partner in neuronal PC12 cells.",
"journal": "Biochemistry and cell biology = Biochimie et biologie cellulaire",
"date": "2012",
"authors": "Majewski L, Sobczak M, Havrylov S, Jozwiak J, Redowicz MJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "22475431",
"url": "https://glygen.org/publication/PubMed/22475431"
}
]
},
{
"title": "FMNL2 drives actin-based protrusion and migration downstream of Cdc42.",
"journal": "Current biology : CB",
"date": "2012",
"authors": "Block J, Breitsprecher D, Kuhn S, Winterhoff M, Kage F, Geffers R, Duwe P, Rohn JL, Baum B, Brakebusch C, Geyer M, Stradal TE, Faix J, Rottner K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "22608513",
"url": "https://glygen.org/publication/PubMed/22608513"
}
]
},
{
"title": "Dock3 regulates BDNF-TrkB signaling for neurite outgrowth by forming a ternary complex with Elmo and RhoG.",
"journal": "Genes to cells : devoted to molecular & cellular mechanisms",
"date": "2012",
"authors": "Namekata K, Watanabe H, Guo X, Kittaka D, Kawamura K, Kimura A, Harada C, Harada T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "22734669",
"url": "https://glygen.org/publication/PubMed/22734669"
}
]
},
{
"title": "Lysophospholipid acyltransferases: 1-acylglycerol-3-phosphate O-acyltransferases. From discovery to disease.",
"journal": "Current opinion in lipidology",
"date": "2012",
"authors": "Agarwal AK",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1483166",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166"
}
],
"reference": [
{
"type": "PubMed",
"id": "22777291",
"url": "https://glygen.org/publication/PubMed/22777291"
}
]
},
{
"title": "Roles of SAM and DDHD domains in mammalian intracellular phospholipase A1 KIAA0725p.",
"journal": "Biochimica et biophysica acta",
"date": "2012",
"authors": "Inoue H, Baba T, Sato S, Ohtsuki R, Takemori A, Watanabe T, Tagaya M, Tani K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1483166",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166"
}
],
"reference": [
{
"type": "PubMed",
"id": "22922100",
"url": "https://glygen.org/publication/PubMed/22922100"
}
]
},
{
"title": "Serine-71 phosphorylation of Rac1 modulates downstream signaling.",
"journal": "PloS one",
"date": "2012",
"authors": "Schwarz J, Proff J, Havemeier A, Ladwein M, Rottner K, Barlag B, Pich A, Tatge H, Just I, Gerhard R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "22970203",
"url": "https://glygen.org/publication/PubMed/22970203"
}
]
},
{
"title": "Alteration of fatty-acid-metabolizing enzymes affects mitochondrial form and function in hereditary spastic paraplegia.",
"journal": "American journal of human genetics",
"date": "2012",
"authors": "Tesson C, Nawara M, Salih MA, Rossignol R, Zaki MS, Al Balwi M, Schule R, Mignot C, Obre E, Bouhouche A, Santorelli FM, Durand CM, Oteyza AC, El-Hachimi KH, Al Drees A, Bouslam N, Lamari F, Elmalik SA, Kabiraj MM, Seidahmed MZ, Esteves T, Gaussen M, Monin ML, Gyapay G, Lechner D, Gonzalez M, Depienne C, Mochel F, Lavie J, Schols L, Lacombe D, Yahyaoui M, Al Abdulkareem I, Zuchner S, Yamashita A, Benomar A, Goizet C, Durr A, Gleeson JG, Darios F, Brice A, Stevanin G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1483166",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166"
}
],
"reference": [
{
"type": "PubMed",
"id": "23176821",
"url": "https://glygen.org/publication/PubMed/23176821"
}
]
},
{
"title": "Mutations in DDHD2, encoding an intracellular phospholipase A(1), cause a recessive form of complex hereditary spastic paraplegia.",
"journal": "American journal of human genetics",
"date": "2012",
"authors": "Schuurs-Hoeijmakers JH, Geraghty MT, Kamsteeg EJ, Ben-Salem S, de Bot ST, Nijhof B, van de Vondervoort II, van der Graaf M, Nobau AC, Otte-Holler I, Vermeer S, Smith AC, Humphreys P, Schwartzentruber J, Ali BR, Al-Yahyaee SA, Tariq S, Pramathan T, Bayoumi R, Kremer HP, van de Warrenburg BP, van den Akker WM, Gilissen C, Veltman JA, Janssen IM, Vulto-van Silfhout AT, van der Velde-Visser S, Lefeber DJ, Diekstra A, Erasmus CE, Willemsen MA, Vissers LE, Lammens M, van Bokhoven H, Brunner HG, Wevers RA, Schenck A, Al-Gazali L, de Vries BB, de Brouwer AP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1483166",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166"
}
],
"reference": [
{
"type": "PubMed",
"id": "23176823",
"url": "https://glygen.org/publication/PubMed/23176823"
}
]
},
{
"title": "The novel synaptogenic protein Farp1 links postsynaptic cytoskeletal dynamics and transsynaptic organization.",
"journal": "The Journal of cell biology",
"date": "2012",
"authors": "Cheadle L, Biederer T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "23209303",
"url": "https://glygen.org/publication/PubMed/23209303"
}
]
},
{
"title": "Deciphering the molecular and functional basis of Dbl family proteins: a novel systematic approach toward classification of selective activation of the Rho family proteins.",
"journal": "The Journal of biological chemistry",
"date": "2013",
"authors": "Jaiswal M, Dvorsky R, Ahmadian MR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "23255595",
"url": "https://glygen.org/publication/PubMed/23255595"
}
]
},
{
"title": "Kalirin promotes neointimal hyperplasia by activating Rac in smooth muscle cells.",
"journal": "Arteriosclerosis, thrombosis, and vascular biology",
"date": "2013",
"authors": "Wu JH, Fanaroff AC, Sharma KC, Smith LS, Brian L, Eipper BA, Mains RE, Freedman NJ, Zhang L",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "23288169",
"url": "https://glygen.org/publication/PubMed/23288169"
}
]
},
{
"title": "ARHGDIA: a novel gene implicated in nephrotic syndrome.",
"journal": "Journal of medical genetics",
"date": "2013",
"authors": "Gupta IR, Baldwin C, Auguste D, Ha KC, El Andalousi J, Fahiminiya S, Bitzan M, Bernard C, Akbari MR, Narod SA, Rosenblatt DS, Majewski J, Takano T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "23434736",
"url": "https://glygen.org/publication/PubMed/23434736"
}
]
},
{
"title": "Plekhg4 is a novel Dbl family guanine nucleotide exchange factor protein for rho family GTPases.",
"journal": "The Journal of biological chemistry",
"date": "2013",
"authors": "Gupta M, Kamynina E, Morley S, Chung S, Muakkassa N, Wang H, Brathwaite S, Sharma G, Manor D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "23572525",
"url": "https://glygen.org/publication/PubMed/23572525"
}
]
},
{
"title": "ARF1 controls Rac1 signaling to regulate migration of MDA-MB-231 invasive breast cancer cells.",
"journal": "Cellular signalling",
"date": "2013",
"authors": "Lewis-Saravalli S, Campbell S, Claing A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "23707487",
"url": "https://glygen.org/publication/PubMed/23707487"
}
]
},
{
"title": "Prenylation and membrane localization of Cdc42 are essential for activation by DOCK7.",
"journal": "Biochemistry",
"date": "2013",
"authors": "Zhou Y, Johnson JL, Cerione RA, Erickson JW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "23718289",
"url": "https://glygen.org/publication/PubMed/23718289"
}
]
},
{
"title": "RNA-aptamers that modulate the RhoGEF activity of Tiam1.",
"journal": "Bioorganic & medicinal chemistry",
"date": "2013",
"authors": "Niebel B, Wosnitza CI, Famulok M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013404",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404"
}
],
"reference": [
{
"type": "PubMed",
"id": "23757206",
"url": "https://glygen.org/publication/PubMed/23757206"
}
]
},
{
"title": "Crystal structures and biochemical studies of human lysophosphatidic acid phosphatase type 6.",
"journal": "Protein & cell",
"date": "2013",
"authors": "Li J, Dong Y, Lu X, Wang L, Peng W, Zhang XC, Rao Z",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1483166",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166"
}
],
"reference": [
{
"type": "PubMed",
"id": "23807634",
"url": "https://glygen.org/publication/PubMed/23807634"
}
]
},
{
"title": "The recruitment of p47(phox) and Rac2G12V at the phagosome is transient and phosphatidylserine dependent.",
"journal": "Biology of the cell",
"date": "2013",
"authors": "Faure MC, Sulpice JC, Delattre M, Lavielle M, Prigent M, Cuif MH, Melchior C, Tschirhart E, Nusse O, Dupre-Crochet S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013404",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404"
}
],
"reference": [
{
"type": "PubMed",
"id": "23870057",
"url": "https://glygen.org/publication/PubMed/23870057"
}
]
},
{
"title": "RasGRF2 Rac-GEF activity couples NMDA receptor calcium flux to enhanced synaptic transmission.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2013",
"authors": "Schwechter B, Rosenmund C, Tolias KF",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "23940355",
"url": "https://glygen.org/publication/PubMed/23940355"
}
]
},
{
"title": "The human minor histocompatibility antigen 1 is a RhoGAP.",
"journal": "PloS one",
"date": "2013",
"authors": "de Kreuk BJ, Schaefer A, Anthony EC, Tol S, Fernandez-Borja M, Geerts D, Pool J, Hambach L, Goulmy E, Hordijk PL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "24086303",
"url": "https://glygen.org/publication/PubMed/24086303"
}
]
},
{
"title": "The RhoGAP ARHGAP19 controls cytokinesis and chromosome segregation in T lymphocytes.",
"journal": "Journal of cell science",
"date": "2014",
"authors": "David MD, Petit D, Bertoglio J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "24259668",
"url": "https://glygen.org/publication/PubMed/24259668"
}
]
},
{
"title": "The smooth muscle-selective RhoGAP GRAF3 is a critical regulator of vascular tone and hypertension.",
"journal": "Nature communications",
"date": "2013",
"authors": "Bai X, Lenhart KC, Bird KE, Suen AA, Rojas M, Kakoki M, Li F, Smithies O, Mack CP, Taylor JM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "24335996",
"url": "https://glygen.org/publication/PubMed/24335996"
}
]
},
{
"title": "Rho-GTPase-activating protein interacting with Cdc-42-interacting protein 4 homolog 2 (Rich2): a new Ras-related C3 botulinum toxin substrate 1 (Rac1) GTPase-activating protein that controls dendritic spine morphogenesis.",
"journal": "The Journal of biological chemistry",
"date": "2014",
"authors": "Raynaud F, Moutin E, Schmidt S, Dahl J, Bertaso F, Boeckers TM, Homburger V, Fagni L",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "24352656",
"url": "https://glygen.org/publication/PubMed/24352656"
}
]
},
{
"title": "The phosphatidylserine receptor TIM4 utilizes integrins as coreceptors to effect phagocytosis.",
"journal": "Molecular biology of the cell",
"date": "2014",
"authors": "Flannagan RS, Canton J, Furuya W, Glogauer M, Grinstein S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013404",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404"
}
],
"reference": [
{
"type": "PubMed",
"id": "24623723",
"url": "https://glygen.org/publication/PubMed/24623723"
}
]
},
{
"title": "A Trio-Rac1-Pak1 signalling axis drives invadopodia disassembly.",
"journal": "Nature cell biology",
"date": "2014",
"authors": "Moshfegh Y, Bravo-Cordero JJ, Miskolci V, Condeelis J, Hodgson L",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "24859002",
"url": "https://glygen.org/publication/PubMed/24859002"
}
]
},
{
"title": "ARHGAP22 localizes at endosomes and regulates actin cytoskeleton.",
"journal": "PloS one",
"date": "2014",
"authors": "Mori M, Saito K, Ohta Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "24933155",
"url": "https://glygen.org/publication/PubMed/24933155"
}
]
},
{
"title": "Dynamic control of excitatory synapse development by a Rac1 GEF/GAP regulatory complex.",
"journal": "Developmental cell",
"date": "2014",
"authors": "Um K, Niu S, Duman JG, Cheng JX, Tu YK, Schwechter B, Liu F, Hiles L, Narayanan AS, Ash RT, Mulherkar S, Alpadi K, Smirnakis SM, Tolias KF",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "24960694",
"url": "https://glygen.org/publication/PubMed/24960694"
}
]
},
{
"title": "Alkaline phosphatase: an overview.",
"journal": "Indian journal of clinical biochemistry : IJCB",
"date": "2014",
"authors": "Sharma U, Pal D, Prasad R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1483166",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166"
}
],
"reference": [
{
"type": "PubMed",
"id": "24966474",
"url": "https://glygen.org/publication/PubMed/24966474"
}
]
},
{
"title": "Arhgap36-dependent activation of Gli transcription factors.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2014",
"authors": "Rack PG, Ni J, Payumo AY, Nguyen V, Crapster JA, Hovestadt V, Kool M, Jones DT, Mich JK, Firestone AJ, Pfister SM, Cho YJ, Chen JK",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "25024229",
"url": "https://glygen.org/publication/PubMed/25024229"
}
]
},
{
"title": "Arhgap28 is a RhoGAP that inactivates RhoA and downregulates stress fibers.",
"journal": "PloS one",
"date": "2014",
"authors": "Yeung CY, Taylor SH, Garva R, Holmes DF, Zeef LA, Soininen R, Boot-Handford RP, Kadler KE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "25211221",
"url": "https://glygen.org/publication/PubMed/25211221"
}
]
},
{
"title": "CD147 promotes Src-dependent activation of Rac1 signaling through STAT3/DOCK8 during the motility of hepatocellular carcinoma cells.",
"journal": "Oncotarget",
"date": "2015",
"authors": "Wang SJ, Cui HY, Liu YM, Zhao P, Zhang Y, Fu ZG, Chen ZN, Jiang JL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "25428919",
"url": "https://glygen.org/publication/PubMed/25428919"
}
]
},
{
"title": "Identification of the GTPase-activating protein DEP domain containing 1B (DEPDC1B) as a transcriptional target of Pitx2.",
"journal": "Experimental cell research",
"date": "2015",
"authors": "Wu D, Zhu X, Jimenez-Cowell K, Mold AJ, Sollecito CC, Lombana N, Jiao M, Wei Q",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "25704760",
"url": "https://glygen.org/publication/PubMed/25704760"
}
]
},
{
"title": "Human-specific gene ARHGAP11B promotes basal progenitor amplification and neocortex expansion.",
"journal": "Science (New York, N.Y.)",
"date": "2015",
"authors": "Florio M, Albert M, Taverna E, Namba T, Brandl H, Lewitus E, Haffner C, Sykes A, Wong FK, Peters J, Guhr E, Klemroth S, Prufer K, Kelso J, Naumann R, Nusslein I, Dahl A, Lachmann R, Paabo S, Huttner WB",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "25721503",
"url": "https://glygen.org/publication/PubMed/25721503"
}
]
},
{
"title": "Rho guanine nucleotide exchange factors involved in cyclic-stretch-induced reorientation of vascular endothelial cells.",
"journal": "Journal of cell science",
"date": "2015",
"authors": "Abiko H, Fujiwara S, Ohashi K, Hiatari R, Mashiko T, Sakamoto N, Sato M, Mizuno K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "25795300",
"url": "https://glygen.org/publication/PubMed/25795300"
}
]
},
{
"title": "Dock10, a Cdc42 and Rac1 GEF, induces loss of elongation, filopodia, and ruffles in cervical cancer epithelial HeLa cells.",
"journal": "Biology open",
"date": "2015",
"authors": "Ruiz-Lafuente N, Alcaraz-Garcia MJ, Garcia-Serna AM, Sebastian-Ruiz S, Moya-Quiles MR, Garcia-Alonso AM, Parrado A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "25862245",
"url": "https://glygen.org/publication/PubMed/25862245"
}
]
},
{
"title": "Mitochondrial Dysfunction in Human Leukemic Stem/Progenitor Cells upon Loss of RAC2.",
"journal": "PloS one",
"date": "2015",
"authors": "Capala ME, Maat H, Bonardi F, van den Boom V, Kuipers J, Vellenga E, Giepmans BN, Schuringa JJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013404",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404"
}
],
"reference": [
{
"type": "PubMed",
"id": "26016997",
"url": "https://glygen.org/publication/PubMed/26016997"
}
]
},
{
"title": "A Rac/Cdc42 exchange factor complex promotes formation of lateral filopodia and blood vessel lumen morphogenesis.",
"journal": "Nature communications",
"date": "2015",
"authors": "Abraham S, Scarcia M, Bagshaw RD, McMahon K, Grant G, Harvey T, Yeo M, Esteves FOG, Thygesen HH, Jones PF, Speirs V, Hanby AM, Selby PJ, Lorger M, Dear TN, Pawson T, Marshall CJ, Mavria G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "26129894",
"url": "https://glygen.org/publication/PubMed/26129894"
}
]
},
{
"title": "Myo9b is a key player in SLIT/ROBO-mediated lung tumor suppression.",
"journal": "The Journal of clinical investigation",
"date": "2015",
"authors": "Kong R, Yi F, Wen P, Liu J, Chen X, Ren J, Li X, Shang Y, Nie Y, Wu K, Fan D, Zhu L, Feng W, Wu JY",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "26529257",
"url": "https://glygen.org/publication/PubMed/26529257"
}
]
},
{
"title": "Mitoguardin Regulates Mitochondrial Fusion through MitoPLD and Is Required for Neuronal Homeostasis.",
"journal": "Molecular cell",
"date": "2016",
"authors": "Zhang Y, Liu X, Bai J, Tian X, Zhao X, Liu W, Duan X, Shang W, Fan HY, Tong C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1483166",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166"
}
],
"reference": [
{
"type": "PubMed",
"id": "26711011",
"url": "https://glygen.org/publication/PubMed/26711011"
}
]
},
{
"title": "Differential Rac1 signalling by guanine nucleotide exchange factors implicates FLII in regulating Rac1-driven cell migration.",
"journal": "Nature communications",
"date": "2016",
"authors": "Marei H, Carpy A, Woroniuk A, Vennin C, White G, Timpson P, Macek B, Malliri A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "26887924",
"url": "https://glygen.org/publication/PubMed/26887924"
}
]
},
{
"title": "Oligophrenin1 protects mice against myocardial ischemia and reperfusion injury by modulating inflammation and myocardial apoptosis.",
"journal": "Cellular signalling",
"date": "2016",
"authors": "Niermann C, Gorressen S, Klier M, Gowert NS, Billuart P, Kelm M, Merx MW, Elvers M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "27117132",
"url": "https://glygen.org/publication/PubMed/27117132"
}
]
},
{
"title": "ARHGEF15 overexpression worsens the prognosis in patients with pancreatic ductal adenocarcinoma through enhancing the motility and proliferative activity of the cancer cells.",
"journal": "Molecular cancer",
"date": "2016",
"authors": "Fukushima H, Yasumoto M, Ogasawara S, Akiba J, Kitasato Y, Nakayama M, Naito Y, Ishida Y, Okabe Y, Yasunaga M, Horiuchi H, Sakamoto E, Itadani H, Mizuarai S, Oie S, Yano H",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "27145964",
"url": "https://glygen.org/publication/PubMed/27145964"
}
]
},
{
"title": "Rho GTPase Transcriptome Analysis Reveals Oncogenic Roles for Rho GTPase-Activating Proteins in Basal-like Breast Cancers.",
"journal": "Cancer research",
"date": "2016",
"authors": "Lawson CD, Fan C, Mitin N, Baker NM, George SD, Graham DM, Perou CM, Burridge K, Der CJ, Rossman KL",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "27216196",
"url": "https://glygen.org/publication/PubMed/27216196"
}
]
},
{
"title": "Deciphering the Molecular and Functional Basis of RHOGAP Family Proteins: A SYSTEMATIC APPROACH TOWARD SELECTIVE INACTIVATION OF RHO FAMILY PROTEINS.",
"journal": "The Journal of biological chemistry",
"date": "2016",
"authors": "Amin E, Jaiswal M, Derewenda U, Reis K, Nouri K, Koessmeier KT, Aspenstrom P, Somlyo AV, Dvorsky R, Ahmadian MR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "27481945",
"url": "https://glygen.org/publication/PubMed/27481945"
}
]
},
{
"title": "PLEKHG3 enhances polarized cell migration by activating actin filaments at the cell front.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "2016",
"authors": "Nguyen TT, Park WS, Park BO, Kim CY, Oh Y, Kim JM, Choi H, Kyung T, Kim CH, Lee G, Hahn KM, Meyer T, Heo WD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "27555588",
"url": "https://glygen.org/publication/PubMed/27555588"
}
]
},
{
"title": "Rac GTPase Activating Protein ARHGAP25 Regulates Leukocyte Transendothelial Migration in Mice.",
"journal": "Journal of immunology (Baltimore, Md. : 1950)",
"date": "2016",
"authors": "Csepanyi-Komi R, Wisniewski E, Bartos B, Levai P, Nemeth T, Balazs B, Kurz AR, Bierschenk S, Sperandio M, Ligeti E",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "27566826",
"url": "https://glygen.org/publication/PubMed/27566826"
}
]
},
{
"title": "Disruption of ArhGAP15 results in hyperactive Rac1, affects the architecture and function of hippocampal inhibitory neurons and causes cognitive deficits.",
"journal": "Scientific reports",
"date": "2016",
"authors": "Zamboni V, Armentano M, Saro G, Ciraolo E, Ghigo A, Germena G, Umbach A, Valnegri P, Passafaro M, Carabelli V, Gavello D, Bianchi V, D'Adamo P, de Curtis I, El-Assawi N, Mauro A, Priano L, Ferri N, Hirsch E, Merlo GR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "27713499",
"url": "https://glygen.org/publication/PubMed/27713499"
}
]
},
{
"title": "SWAP70 Organizes the Actin Cytoskeleton and Is Essential for Phagocytosis.",
"journal": "Cell reports",
"date": "2016",
"authors": "Baranov MV, Revelo NH, Dingjan I, Maraspini R, Ter Beest M, Honigmann A, van den Bogaart G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "27806292",
"url": "https://glygen.org/publication/PubMed/27806292"
}
]
},
{
"title": "RhoGTPase Regulators Orchestrate Distinct Stages of Synaptic Development.",
"journal": "PloS one",
"date": "2017",
"authors": "Martin-Vilchez S, Whitmore L, Asmussen H, Zareno J, Horwitz R, Newell-Litwa K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "28114311",
"url": "https://glygen.org/publication/PubMed/28114311"
}
]
},
{
"title": "Characterization of the activation of small GTPases by their GEFs on membranes using artificial membrane tethering.",
"journal": "The Biochemical journal",
"date": "2017",
"authors": "Peurois F, Veyron S, Ferrandez Y, Ladid I, Benabdi S, Zeghouf M, Peyroche G, Cherfils J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "28196833",
"url": "https://glygen.org/publication/PubMed/28196833"
}
]
},
{
"title": "Allosteric inhibition of the guanine nucleotide exchange factor DOCK5 by a small molecule.",
"journal": "Scientific reports",
"date": "2017",
"authors": "Ferrandez Y, Zhang W, Peurois F, Akendengue L, Blangy A, Zeghouf M, Cherfils J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "29089502",
"url": "https://glygen.org/publication/PubMed/29089502"
}
]
},
{
"title": "Cloning and recombinant expression of phospholipase A2 present in rheumatoid arthritic synovial fluid.",
"journal": "The Journal of biological chemistry",
"date": "1989",
"authors": "Seilhamer JJ, Pruzanski W, Vadas P, Plant S, Miller JA, Kloss J, Johnson LK",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1483166",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166"
}
],
"reference": [
{
"type": "PubMed",
"id": "2925608",
"url": "https://glygen.org/publication/PubMed/2925608"
}
]
},
{
"title": "Unraveling the molecular mechanism of interactions of the Rho GTPases Cdc42 and Rac1 with the scaffolding protein IQGAP2.",
"journal": "The Journal of biological chemistry",
"date": "2018",
"authors": "Ozdemir ES, Jang H, Gursoy A, Keskin O, Li Z, Sacks DB, Nussinov R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "29358323",
"url": "https://glygen.org/publication/PubMed/29358323"
}
]
},
{
"title": "ARHGEF39 promotes tumor progression via activation of Rac1/P38 MAPK/ATF2 signaling and predicts poor prognosis in non-small cell lung cancer patients.",
"journal": "Laboratory investigation; a journal of technical methods and pathology",
"date": "2018",
"authors": "Zhou H, Cai L, Zhang X, Li A, Miao Y, Li Q, Qiu X, Wang E",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "29382922",
"url": "https://glygen.org/publication/PubMed/29382922"
}
]
},
{
"title": "Structural Basis for the Dual Substrate Specificity of DOCK7 Guanine Nucleotide Exchange Factor.",
"journal": "Structure (London, England : 1993)",
"date": "2019",
"authors": "Kukimoto-Niino M, Tsuda K, Ihara K, Mishima-Tsumagari C, Honda K, Ohsawa N, Shirouzu M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "30853411",
"url": "https://glygen.org/publication/PubMed/30853411"
}
]
},
{
"title": "Nonconserved miR-608 suppresses prostate cancer progression through RAC2/PAK4/LIMK1 and BCL2L1/caspase-3 pathways by targeting the 3'-UTRs of RAC2/BCL2L1 and the coding region of PAK4.",
"journal": "Cancer medicine",
"date": "2019",
"authors": "Zhang X, Fang J, Chen S, Wang W, Meng S, Liu B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013404",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404"
}
],
"reference": [
{
"type": "PubMed",
"id": "31389670",
"url": "https://glygen.org/publication/PubMed/31389670"
}
]
},
{
"title": "Mapping the proximity interaction network of the Rho-family GTPases reveals signalling pathways and regulatory mechanisms.",
"journal": "Nature cell biology",
"date": "2020",
"authors": "Bagci H, Sriskandarajah N, Robert A, Boulais J, Elkholi IE, Tran V, Lin ZY, Thibault MP, Dube N, Faubert D, Hipfner DR, Gingras AC, Cote JF",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013404",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404"
}
],
"reference": [
{
"type": "PubMed",
"id": "31871319",
"url": "https://glygen.org/publication/PubMed/31871319"
}
]
},
{
"title": "Systems analysis of RhoGEF and RhoGAP regulatory proteins reveals spatially organized RAC1 signalling from integrin adhesions.",
"journal": "Nature cell biology",
"date": "2020",
"authors": "Muller PM, Rademacher J, Bagshaw RD, Wortmann C, Barth C, van Unen J, Alp KM, Giudice G, Eccles RL, Heinrich LE, Pascual-Vargas P, Sanchez-Castro M, Brandenburg L, Mbamalu G, Tucholska M, Spatt L, Czajkowski MT, Welke RW, Zhang S, Nguyen V, Rrustemi T, Trnka P, Freitag K, Larsen B, Popp O, Mertins P, Gingras AC, Roth FP, Colwill K, Bakal C, Pertz O, Pawson T, Petsalaki E, Rocks O",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "32203420",
"url": "https://glygen.org/publication/PubMed/32203420"
}
]
},
{
"title": "Identification and functional analysis of a novel phospholipase D2 gene mutation associated with familial systemic lupus erythematosus.",
"journal": "Zhong nan da xue xue bao. Yi xue ban = Journal of Central South University. Medical sciences",
"date": "2021",
"authors": "Peng L, Yuan X, Chen L, Chen S, Chen K",
"evidence": [
{
"database": "RefSeq",
"id": "NP_001230037",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001230037"
}
],
"reference": [
{
"type": "PubMed",
"id": "33927069",
"url": "https://glygen.org/publication/PubMed/33927069"
}
]
},
{
"title": "Phospholipase D2 is a positive regulator of sirtuin 1 and modulates p53-mediated apoptosis via sirtuin 1.",
"journal": "Experimental & molecular medicine",
"date": "2021",
"authors": "Lee H, Jung TY, Lim SH, Choi EJ, Lee J, Min DS",
"evidence": [
{
"database": "RefSeq",
"id": "NP_001230037",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001230037"
}
],
"reference": [
{
"type": "PubMed",
"id": "34471223",
"url": "https://glygen.org/publication/PubMed/34471223"
}
]
},
{
"title": "Partial sequencing of human adult, human fetal, and bovine intestinal alkaline phosphatases: comparison with the human placental and liver isozymes.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1986",
"authors": "Hua JC, Berger J, Pan YC, Hulmes JD, Udenfriend S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1483166",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166"
}
],
"reference": [
{
"type": "PubMed",
"id": "3458202",
"url": "https://glygen.org/publication/PubMed/3458202"
}
]
},
{
"title": "Phospholipase D and cancer metastasis: A focus on exosomes.",
"journal": "Advances in biological regulation",
"date": "2022-10-14",
"authors": "Wolf Alexander, Tanguy Emeline, Wang Qili, Gasman St\u00e9phane, Vitale Nicolas",
"evidence": [
{
"database": "RefSeq",
"id": "NP_001230037",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001230037"
}
],
"reference": [
{
"type": "PubMed",
"id": "36272918",
"url": "https://glygen.org/publication/PubMed/36272918"
}
]
},
{
"title": "Exosome Secretion and Epithelial-Mesenchymal Transition in Ovarian Cancer Are Regulated by Phospholipase D.",
"journal": "International journal of molecular sciences",
"date": "2022-10-31",
"authors": "Onallah Hadil, Mannully Sheethal Thomas, Davidson Ben, Reich Reuven",
"evidence": [
{
"database": "RefSeq",
"id": "NP_001230037",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001230037"
}
],
"reference": [
{
"type": "PubMed",
"id": "36362078",
"url": "https://glygen.org/publication/PubMed/36362078"
}
]
},
{
"title": "PLD2 deletion alleviates disruption of tight junctions in sepsis-induced ALI by regulating PA/STAT3 phosphorylation pathway.",
"journal": "International immunopharmacology",
"date": "2023-01",
"authors": "Qian Tiantian, Qi Boyang, Fei Yuxin, Li Jun, Luo Liqing, Lv Bingjie, Song Yutong, Sheng Shurui, Xiao Wenhan, Huang Xiao, Wang Xiaozhi",
"evidence": [
{
"database": "RefSeq",
"id": "NP_001230037",
"url": "https://www.ncbi.nlm.nih.gov/protein/NP_001230037"
}
],
"reference": [
{
"type": "PubMed",
"id": "36700766",
"url": "https://glygen.org/publication/PubMed/36700766"
}
]
},
{
"title": "Participation of the microsomal CDP-diglycerides in the mitochondrial biosynthesis of phosphatidylglycerol.",
"journal": "Biochemistry and cell biology = Biochimie et biologie cellulaire",
"date": "1986",
"authors": "Stuhne-Sekalec L, Chudzik J, Stanacev NZ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1483148",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483148"
}
],
"reference": [
{
"type": "PubMed",
"id": "3718705",
"url": "https://glygen.org/publication/PubMed/3718705"
}
]
},
{
"title": "Studies on prophospholipase A2 and its enzyme from human pancreatic juice. Catalytic properties and sequence of the N-terminal region.",
"journal": "European journal of biochemistry",
"date": "1982",
"authors": "Grataroli R, Dijkman R, Dutilh CE, van der Ouderaa F, De Haas GH, Figarella C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1483166",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166"
}
],
"reference": [
{
"type": "PubMed",
"id": "7060561",
"url": "https://glygen.org/publication/PubMed/7060561"
}
]
},
{
"title": "Abr and Bcr are multifunctional regulators of the Rho GTP-binding protein family.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1995",
"authors": "Chuang TH, Xu X, Kaartinen V, Heisterkamp N, Groffen J, Bokoch GM",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "7479768",
"url": "https://glygen.org/publication/PubMed/7479768"
}
]
},
{
"title": "Identification of a novel protein with GDP dissociation inhibitor activity for the ras-like proteins CDC42Hs and rac I.",
"journal": "Genes, chromosomes & cancer",
"date": "1993",
"authors": "Adra CN, Ko J, Leonard D, Wirth LJ, Cerione RA, Lim B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "7512369",
"url": "https://glygen.org/publication/PubMed/7512369"
}
]
},
{
"title": "Tyrosine phosphorylation of phospholipase C-gamma 2 is involved in the activation of phosphoinositide hydrolysis by Fc receptors in human neutrophils.",
"journal": "Biochemical and biophysical research communications",
"date": "1994",
"authors": "Dusi S, Donini M, Della Bianca V, Rossi F",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029485",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485"
}
],
"reference": [
{
"type": "PubMed",
"id": "7517665",
"url": "https://glygen.org/publication/PubMed/7517665"
}
]
},
{
"title": "Molecular cloning of a new member of the p21-Cdc42/Rac-activated kinase (PAK) family.",
"journal": "The Journal of biological chemistry",
"date": "1995",
"authors": "Manser E, Chong C, Zhao ZS, Leung T, Michael G, Hall C, Lim L",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "7559638",
"url": "https://glygen.org/publication/PubMed/7559638"
}
]
},
{
"title": "Bridging Ral GTPase to Rho pathways. RLIP76, a Ral effector with CDC42/Rac GTPase-activating protein activity.",
"journal": "The Journal of biological chemistry",
"date": "1995",
"authors": "Jullien-Flores V, Dorseuil O, Romero F, Letourneur F, Saragosti S, Berger R, Tavitian A, Gacon G, Camonis JH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "7673236",
"url": "https://glygen.org/publication/PubMed/7673236"
}
]
},
{
"title": "Direct involvement of the small GTP-binding protein Rho in lbc oncogene function.",
"journal": "The Journal of biological chemistry",
"date": "1995",
"authors": "Zheng Y, Olson MF, Hall A, Cerione RA, Toksoz D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "7721814",
"url": "https://glygen.org/publication/PubMed/7721814"
}
]
},
{
"title": "A role for Rac in Tiam1-induced membrane ruffling and invasion.",
"journal": "Nature",
"date": "1995",
"authors": "Michiels F, Habets GG, Stam JC, van der Kammen RA, Collard JG",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "7753201",
"url": "https://glygen.org/publication/PubMed/7753201"
}
]
},
{
"title": "The sequence of a human mitochondrial glycerol-3-phosphate dehydrogenase-encoding cDNA.",
"journal": "Gene",
"date": "1994",
"authors": "Lehn DA, Brown LJ, Simonson GD, Moran SM, MacDonald MJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1483166",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166"
}
],
"reference": [
{
"type": "PubMed",
"id": "7821823",
"url": "https://glygen.org/publication/PubMed/7821823"
}
]
},
{
"title": "A dual functional signal mediator showing RhoGAP and phospholipase C-delta stimulating activities.",
"journal": "The EMBO journal",
"date": "1995",
"authors": "Homma Y, Emori Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "7835339",
"url": "https://glygen.org/publication/PubMed/7835339"
}
]
},
{
"title": "Breakpoint cluster region gene product-related domain of n-chimaerin. Discrimination between Rac-binding and GTPase-activating residues by mutational analysis.",
"journal": "The Journal of biological chemistry",
"date": "1994",
"authors": "Ahmed S, Lee J, Wen LP, Zhao Z, Ho J, Best A, Kozma R, Lim L",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "8021274",
"url": "https://glygen.org/publication/PubMed/8021274"
}
]
},
{
"title": "A brain serine/threonine protein kinase activated by Cdc42 and Rac1.",
"journal": "Nature",
"date": "1994",
"authors": "Manser E, Leung T, Salihuddin H, Zhao ZS, Lim L",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "8107774",
"url": "https://glygen.org/publication/PubMed/8107774"
}
]
},
{
"title": "Enzymatic, metabolic and secretory patterns in human islets of type 2 (non-insulin-dependent) diabetic patients.",
"journal": "Diabetologia",
"date": "1994",
"authors": "Fernandez-Alvarez J, Conget I, Rasschaert J, Sener A, Gomis R, Malaisse WJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1483166",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166"
}
],
"reference": [
{
"type": "PubMed",
"id": "8163052",
"url": "https://glygen.org/publication/PubMed/8163052"
}
]
},
{
"title": "Purification of peroxisomal acyl-CoA: dihydroxyacetonephosphate acyltransferase from human placenta.",
"journal": "Biochimica et biophysica acta",
"date": "1994",
"authors": "Ofman R, Wanders RJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1483166",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166"
}
],
"reference": [
{
"type": "PubMed",
"id": "8186247",
"url": "https://glygen.org/publication/PubMed/8186247"
}
]
},
{
"title": "Immunoglobulin G-mediated phagocytosis activates a calcium-independent, phosphatidylethanolamine-specific phospholipase.",
"journal": "Journal of leukocyte biology",
"date": "1993",
"authors": "Lennartz MR, Lefkowith JB, Bromley FA, Brown EJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029485",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485"
}
],
"reference": [
{
"type": "PubMed",
"id": "8228618",
"url": "https://glygen.org/publication/PubMed/8228618"
}
]
},
{
"title": "Cloning and recombinant expression of a novel human low molecular weight Ca(2+)-dependent phospholipase A2.",
"journal": "The Journal of biological chemistry",
"date": "1994",
"authors": "Chen J, Engle SJ, Seilhamer JJ, Tischfield JA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1483166",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166"
}
],
"reference": [
{
"type": "PubMed",
"id": "8300559",
"url": "https://glygen.org/publication/PubMed/8300559"
}
]
},
{
"title": "Cardiolipin is synthesized on the matrix side of the inner membrane in rat liver mitochondria.",
"journal": "The Journal of biological chemistry",
"date": "1993",
"authors": "Schlame M, Haldar D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1483148",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483148"
}
],
"reference": [
{
"type": "PubMed",
"id": "8380172",
"url": "https://glygen.org/publication/PubMed/8380172"
}
]
},
{
"title": "Human ADP-ribosylation factor-activated phosphatidylcholine-specific phospholipase D defines a new and highly conserved gene family.",
"journal": "The Journal of biological chemistry",
"date": "1995",
"authors": "Hammond SM, Altshuller YM, Sung TC, Rudge SA, Rose K, Engebrecht J, Morris AJ, Frohman MA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1483148",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483148"
}
],
"reference": [
{
"type": "PubMed",
"id": "8530346",
"url": "https://glygen.org/publication/PubMed/8530346"
}
]
},
{
"title": "p190-B, a new member of the Rho GAP family, and Rho are induced to cluster after integrin cross-linking.",
"journal": "The Journal of biological chemistry",
"date": "1995",
"authors": "Burbelo PD, Miyamoto S, Utani A, Brill S, Yamada KM, Hall A, Yamada Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "8537347",
"url": "https://glygen.org/publication/PubMed/8537347"
}
]
},
{
"title": "A novel partner for the GTP-bound forms of rho and rac.",
"journal": "FEBS letters",
"date": "1995",
"authors": "Madaule P, Furuyashiki T, Reid T, Ishizaki T, Watanabe G, Morii N, Narumiya S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "8543060",
"url": "https://glygen.org/publication/PubMed/8543060"
}
]
},
{
"title": "The multidomain protein Trio binds the LAR transmembrane tyrosine phosphatase, contains a protein kinase domain, and has separate rac-specific and rho-specific guanine nucleotide exchange factor domains.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1996",
"authors": "Debant A, Serra-Pages C, Seipel K, O'Brien S, Tang M, Park SH, Streuli M",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "8643598",
"url": "https://glygen.org/publication/PubMed/8643598"
}
]
},
{
"title": "Rac GTPase interacts specifically with phosphatidylinositol 3-kinase.",
"journal": "The Biochemical journal",
"date": "1996",
"authors": "Bokoch GM, Vlahos CJ, Wang Y, Knaus UG, Traynor-Kaplan AE",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "8645157",
"url": "https://glygen.org/publication/PubMed/8645157"
}
]
},
{
"title": "Phospholipase C-gamma1 interacts with conserved phosphotyrosyl residues in the linker region of Syk and is a substrate for Syk.",
"journal": "Molecular and cellular biology",
"date": "1996",
"authors": "Law CL, Chandran KA, Sidorenko SP, Clark EA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029485",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485"
}
],
"reference": [
{
"type": "PubMed",
"id": "8657103",
"url": "https://glygen.org/publication/PubMed/8657103"
}
]
},
{
"title": "Rhotekin, a new putative target for Rho bearing homology to a serine/threonine kinase, PKN, and rhophilin in the rho-binding domain.",
"journal": "The Journal of biological chemistry",
"date": "1996",
"authors": "Reid T, Furuyashiki T, Ishizaki T, Watanabe G, Watanabe N, Fujisawa K, Morii N, Madaule P, Narumiya S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "8662891",
"url": "https://glygen.org/publication/PubMed/8662891"
}
]
},
{
"title": "Molecular cloning of human mitochondrial glycerophosphate dehydrogenase gene: genomic structure, chromosomal localization, and existence of a pseudogene.",
"journal": "Biochemical and biophysical research communications",
"date": "1996",
"authors": "Matsutani A, Takeuchi Y, Ishihara H, Kuwano S, Oka Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1483166",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166"
}
],
"reference": [
{
"type": "PubMed",
"id": "8687421",
"url": "https://glygen.org/publication/PubMed/8687421"
}
]
},
{
"title": "The Ras GTPase-activating-protein-related human protein IQGAP2 harbors a potential actin binding domain and interacts with calmodulin and Rho family GTPases.",
"journal": "Molecular and cellular biology",
"date": "1996",
"authors": "Brill S, Li S, Lyman CW, Church DM, Wasmuth JJ, Weissbach L, Bernards A, Snijders AJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "8756646",
"url": "https://glygen.org/publication/PubMed/8756646"
}
]
},
{
"title": "Interaction of the Rho family small G proteins with kinectin, an anchoring protein of kinesin motor.",
"journal": "Biochemical and biophysical research communications",
"date": "1996",
"authors": "Hotta K, Tanaka K, Mino A, Kohno H, Takai Y",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "8769096",
"url": "https://glygen.org/publication/PubMed/8769096"
}
]
},
{
"title": "Identification of IQGAP as a putative target for the small GTPases, Cdc42 and Rac1.",
"journal": "The Journal of biological chemistry",
"date": "1996",
"authors": "Kuroda S, Fukata M, Kobayashi K, Nakafuku M, Nomura N, Iwamatsu A, Kaibuchi K",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "8798539",
"url": "https://glygen.org/publication/PubMed/8798539"
}
]
},
{
"title": "Two GTPases, Cdc42 and Rac, bind directly to a protein implicated in the immunodeficiency disorder Wiskott-Aldrich syndrome.",
"journal": "Current biology : CB",
"date": "1996",
"authors": "Aspenstrom P, Lindberg U, Hall A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "8805223",
"url": "https://glygen.org/publication/PubMed/8805223"
}
]
},
{
"title": "Identification of a novel guanine nucleotide exchange factor for the Rho GTPase.",
"journal": "The Journal of biological chemistry",
"date": "1996",
"authors": "Hart MJ, Sharma S, elMasry N, Qiu RG, McCabe P, Polakis P, Bollag G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "8810315",
"url": "https://glygen.org/publication/PubMed/8810315"
}
]
},
{
"title": "The p160 RhoA-binding kinase ROK alpha is a member of a kinase family and is involved in the reorganization of the cytoskeleton.",
"journal": "Molecular and cellular biology",
"date": "1996",
"authors": "Leung T, Chen XQ, Manser E, Lim L",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "8816443",
"url": "https://glygen.org/publication/PubMed/8816443"
}
]
},
{
"title": "RhoGDI-3 is a new GDP dissociation inhibitor (GDI). Identification of a non-cytosolic GDI protein interacting with the small GTP-binding proteins RhoB and RhoG.",
"journal": "The Journal of biological chemistry",
"date": "1996",
"authors": "Zalcman G, Closson V, Camonis J, Honore N, Rousseau-Merck MF, Tavitian A, Olofsson B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "8939998",
"url": "https://glygen.org/publication/PubMed/8939998"
}
]
},
{
"title": "Phosphotyrosine-dependent activation of Rac-1 GDP/GTP exchange by the vav proto-oncogene product.",
"journal": "Nature",
"date": "1997",
"authors": "Crespo P, Schuebel KE, Ostrom AA, Gutkind JS, Bustelo XR",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "8990121",
"url": "https://glygen.org/publication/PubMed/8990121"
}
]
},
{
"title": "Faciogenital dysplasia protein (FGD1) and Vav, two related proteins required for normal embryonic development, are upstream regulators of Rho GTPases.",
"journal": "Current biology : CB",
"date": "1996",
"authors": "Olson MF, Pasteris NG, Gorski JL, Hall A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "8994827",
"url": "https://glygen.org/publication/PubMed/8994827"
}
]
},
{
"title": "Characterization of two alternately spliced forms of phospholipase D1. Activation of the purified enzymes by phosphatidylinositol 4,5-bisphosphate, ADP-ribosylation factor, and Rho family monomeric GTP-binding proteins and protein kinase C-alpha.",
"journal": "The Journal of biological chemistry",
"date": "1997",
"authors": "Hammond SM, Jenco JM, Nakashima S, Cadwallader K, Gu Q, Cook S, Nozawa Y, Prestwich GD, Frohman MA, Morris AJ",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "9013646",
"url": "https://glygen.org/publication/PubMed/9013646"
}
]
},
{
"title": "Tyrosine phosphorylation of the vav proto-oncogene product links FcepsilonRI to the Rac1-JNK pathway.",
"journal": "The Journal of biological chemistry",
"date": "1997",
"authors": "Teramoto H, Salem P, Robbins KC, Bustelo XR, Gutkind JS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "9099726",
"url": "https://glygen.org/publication/PubMed/9099726"
}
]
},
{
"title": "RhoGDIgamma: a GDP-dissociation inhibitor for Rho proteins with preferential expression in brain and pancreas.",
"journal": "Proceedings of the National Academy of Sciences of the United States of America",
"date": "1997",
"authors": "Adra CN, Manor D, Ko JL, Zhu S, Horiuchi T, Van Aelst L, Cerione RA, Lim B",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013404",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404"
}
],
"reference": [
{
"type": "PubMed",
"id": "9113980",
"url": "https://glygen.org/publication/PubMed/9113980"
}
]
},
{
"title": "A human homolog of the vaccinia virus HindIII K4L gene is a member of the phospholipase D superfamily.",
"journal": "Virus research",
"date": "1997",
"authors": "Cao JX, Koop BF, Upton C",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1483148",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483148"
}
],
"reference": [
{
"type": "PubMed",
"id": "9140189",
"url": "https://glygen.org/publication/PubMed/9140189"
}
]
},
{
"title": "Cloning, chromosomal mapping, and expression of a novel human secretory phospholipase A2.",
"journal": "The Journal of biological chemistry",
"date": "1997",
"authors": "Cupillard L, Koumanov K, Mattei MG, Lazdunski M, Lambeau G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1483166",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166"
}
],
"reference": [
{
"type": "PubMed",
"id": "9188469",
"url": "https://glygen.org/publication/PubMed/9188469"
}
]
},
{
"title": "Cloning and expression of two human lysophosphatidic acid acyltransferase cDNAs that enhance cytokine-induced signaling responses in cells.",
"journal": "DNA and cell biology",
"date": "1997",
"authors": "West J, Tompkins CK, Balantac N, Nudelman E, Meengs B, White T, Bursten S, Coleman J, Kumar A, Singer JW, Leung DW",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1483166",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166"
}
],
"reference": [
{
"type": "PubMed",
"id": "9212163",
"url": "https://glygen.org/publication/PubMed/9212163"
}
]
},
{
"title": "A novel GTPase-activating protein for Rho interacts with a PDZ domain of the protein-tyrosine phosphatase PTPL1.",
"journal": "The Journal of biological chemistry",
"date": "1997",
"authors": "Saras J, Franzen P, Aspenstrom P, Hellman U, Gonez LJ, Heldin CH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "9305890",
"url": "https://glygen.org/publication/PubMed/9305890"
}
]
},
{
"title": "The role of CDP-diacylglycerol synthetase and phosphatidylinositol synthase activity levels in the regulation of cellular phosphatidylinositol content.",
"journal": "The Journal of biological chemistry",
"date": "1997",
"authors": "Lykidis A, Jackson PD, Rock CO, Jackowski S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1483148",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483148"
}
],
"reference": [
{
"type": "PubMed",
"id": "9407135",
"url": "https://glygen.org/publication/PubMed/9407135"
}
]
},
{
"title": "Coupling of Ras and Rac guanosine triphosphatases through the Ras exchanger Sos.",
"journal": "Science (New York, N.Y.)",
"date": "1998",
"authors": "Nimnual AS, Yatsula BA, Bar-Sagi D",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "9438849",
"url": "https://glygen.org/publication/PubMed/9438849"
}
]
},
{
"title": "Characterization of a human lysophosphatidic acid acyltransferase that is encoded by a gene located in the class III region of the human major histocompatibility complex.",
"journal": "The Journal of biological chemistry",
"date": "1998",
"authors": "Aguado B, Campbell RD",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-1483166",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166"
}
],
"reference": [
{
"type": "PubMed",
"id": "9461603",
"url": "https://glygen.org/publication/PubMed/9461603"
}
]
},
{
"title": "Human myosin-IXb is a mechanochemically active motor and a GAP for rho.",
"journal": "Journal of cell science",
"date": "1998",
"authors": "Post PL, Bokoch GM, Mooseker MS",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "9490638",
"url": "https://glygen.org/publication/PubMed/9490638"
}
]
},
{
"title": "MgcRacGAP, a new human GTPase-activating protein for Rac and Cdc42 similar to Drosophila rotundRacGAP gene product, is expressed in male germ cells.",
"journal": "The Journal of biological chemistry",
"date": "1998",
"authors": "Toure A, Dorseuil O, Morin L, Timmons P, Jegou B, Reibel L, Gacon G",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "9497316",
"url": "https://glygen.org/publication/PubMed/9497316"
}
]
},
{
"title": "Oligophrenin-1 encodes a rhoGAP protein involved in X-linked mental retardation.",
"journal": "Nature",
"date": "1998",
"authors": "Billuart P, Bienvenu T, Ronce N, des Portes V, Vinet MC, Zemni R, Roest Crollius H, Carrie A, Fauchereau F, Cherry M, Briault S, Hamel B, Fryns JP, Beldjord C, Kahn A, Moraine C, Chelly J",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "9582072",
"url": "https://glygen.org/publication/PubMed/9582072"
}
]
},
{
"title": "Cloning and initial characterization of a human phospholipase D2 (hPLD2). ADP-ribosylation factor regulates hPLD2.",
"journal": "The Journal of biological chemistry",
"date": "1998",
"authors": "Lopez I, Arnold RS, Lambeth JD",
"evidence": [
{
"database": "UniProtKB",
"id": "O14939",
"url": "https://www.uniprot.org/uniprot/O14939"
},
{
"database": "Reactome",
"id": "R-HSA-1483166",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166"
}
],
"reference": [
{
"type": "PubMed",
"id": "9582313",
"url": "https://glygen.org/publication/PubMed/9582313"
}
]
},
{
"title": "PAK kinases are directly coupled to the PIX family of nucleotide exchange factors.",
"journal": "Molecular cell",
"date": "1998",
"authors": "Manser E, Loo TH, Koh CG, Zhao ZS, Chen XQ, Tan L, Tan I, Leung T, Lim L",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "9659915",
"url": "https://glygen.org/publication/PubMed/9659915"
}
]
},
{
"title": "Activation of RhoA and SAPK/JNK signalling pathways by the RhoA-specific exchange factor mNET1.",
"journal": "The EMBO journal",
"date": "1998",
"authors": "Alberts AS, Treisman R",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "9670022",
"url": "https://glygen.org/publication/PubMed/9670022"
}
]
},
{
"title": "Structural requirements for PAK activation by Rac GTPases.",
"journal": "The Journal of biological chemistry",
"date": "1998",
"authors": "Knaus UG, Wang Y, Reilly AM, Warnock D, Jackson JH",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013404",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404"
}
],
"reference": [
{
"type": "PubMed",
"id": "9705280",
"url": "https://glygen.org/publication/PubMed/9705280"
}
]
},
{
"title": "Characterization of human PLD2 and the analysis of PLD isoform splice variants.",
"journal": "FASEB J.",
"date": "1998",
"authors": "Steed PM, Clark KL, Boyar WC, Lasala DJ",
"evidence": [
{
"database": "UniProtKB",
"id": "O14939",
"url": "https://www.uniprot.org/uniprot/O14939"
},
{
"database": "Reactome",
"id": "R-HSA-1483148",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483148"
}
],
"reference": [
{
"type": "PubMed",
"id": "9761774",
"url": "https://glygen.org/publication/PubMed/9761774"
}
]
},
{
"title": "Citron rho-interacting kinase, a novel tissue-specific ser/thr kinase encompassing the Rho-Rac-binding protein Citron.",
"journal": "The Journal of biological chemistry",
"date": "1998",
"authors": "Di Cunto F, Calautti E, Hsiao J, Ong L, Topley G, Turco E, Dotto GP",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "9792683",
"url": "https://glygen.org/publication/PubMed/9792683"
}
]
},
{
"title": "PAK4, a novel effector for Cdc42Hs, is implicated in the reorganization of the actin cytoskeleton and in the formation of filopodia.",
"journal": "The EMBO journal",
"date": "1998",
"authors": "Abo A, Qu J, Cammarano MS, Dan C, Fritsch A, Baud V, Belisle B, Minden A",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "9822598",
"url": "https://glygen.org/publication/PubMed/9822598"
}
]
},
{
"title": "PLD2 complexes with the EGF receptor and undergoes tyrosine phosphorylation at a single site upon agonist stimulation.",
"journal": "The Journal of biological chemistry",
"date": "1998",
"authors": "Slaaby R, Jensen T, Hansen HS, Frohman MA, Seedorf K",
"evidence": [
{
"database": "iPTMnet",
"id": "O14939-1",
"url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14939-1"
}
],
"reference": [
{
"type": "PubMed",
"id": "9837959",
"url": "https://glygen.org/publication/PubMed/9837959"
}
]
},
{
"title": "WAVE, a novel WASP-family protein involved in actin reorganization induced by Rac.",
"journal": "The EMBO journal",
"date": "1998",
"authors": "Miki H, Suetsugu S, Takenawa T",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "9843499",
"url": "https://glygen.org/publication/PubMed/9843499"
}
]
},
{
"title": "Fc gamma receptor-mediated activation of phospholipase D regulates macrophage phagocytosis of IgG-opsonized particles.",
"journal": "Journal of immunology (Baltimore, Md. : 1950)",
"date": "1999",
"authors": "Kusner DJ, Hall CF, Jackson S",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-2029485",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485"
}
],
"reference": [
{
"type": "PubMed",
"id": "9973503",
"url": "https://glygen.org/publication/PubMed/9973503"
}
]
},
{
"title": "Loop 6 of RhoA confers specificity for effector binding, stress fiber formation, and cellular transformation.",
"journal": "The Journal of biological chemistry",
"date": "1999",
"authors": "Zong H, Raman N, Mickelson-Young LA, Atkinson SJ, Quilliam LA",
"evidence": [
{
"database": "Reactome",
"id": "R-HSA-9013149",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149"
}
],
"reference": [
{
"type": "PubMed",
"id": "9988689",
"url": "https://glygen.org/publication/PubMed/9988689"
}
]
}
],
"pathway": [
{
"id": "R-HSA-1483148",
"name": "Synthesis of PG",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483148",
"resource": "Reactome",
"description": "Synthesis of PG"
},
{
"id": "R-HSA-1483166",
"name": "Synthesis of PA",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483166",
"resource": "Reactome",
"description": "Synthesis of PA"
},
{
"id": "R-HSA-2029485",
"name": "Role of phospholipids in phagocytosis",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029485",
"resource": "Reactome",
"description": "Role of phospholipids in phagocytosis"
},
{
"id": "R-HSA-9013149",
"name": "RAC1 GTPase cycle",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013149",
"resource": "Reactome",
"description": "RAC1 GTPase cycle"
},
{
"id": "R-HSA-9013404",
"name": "RAC2 GTPase cycle",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013404",
"resource": "Reactome",
"description": "RAC2 GTPase cycle"
}
],
"orthologs": [
{
"uniprot_canonical_ac": "P70498-1",
"protein_name": "Phospholipase D2",
"gene_name": "Pld2",
"tax_id": 10116,
"organism": "Rattus norvegicus",
"sequence": {
"sequence": "MTVTQTDLFPYGDYLNSSQLHMEPDVVDTLKEGEDPADRMHPFLAIYDLQPLRAHPLVFAPGVPVIAQVVGTERYTSGSKVGTCTLYSVRLTHGDFTWTTKKKFRHFQELHRDLQRHKVLMSLLNLARFAAAHSPAREAANENIPSLPRGGSEGSARHTASKQKYLENYLNRLLTMSFYRNYHAMTEFLEVSQLSFIPDLGSKGLEGVIRKRSGGHRVPGFTCCGRDQVCYRWSKRWLVVKDSFLLYMRPETGAISFVQLFDPGFEVQVGKRSTEARYGVRIDTSHRSLILKCSSYRQARWWGQEITELAQGPGRDFLQLHQHDSYAPPRPGTLARWFVNGAGYFAAVADAILRAREEIFITDWWLSPEIYLKRPAHSDDWRLDIMLKRKAEEGVRVSILLFKEVELALGINSGYSKRTLMLLHPNIKVMRHPDLVTLWAHHEKLLVVDQAVAFLGGLDLAYGRWDDVQYRLTDLGDPSESADSQTPTPGSDPAATPDLSHNHFFWLGKDYSNLITKDWVQLDRPFEDFIDRETTPRMPWRDVGVVVHGVAARDLARHFIQRWNFTKTIKARYKIPQYPYLLPKSASTANHLPFIIPGGQCATVQVLRSVDRWSAGTLESSILNAYLHTIRESQHFLYIENQFFISCSDGRTVLNKVGDEIVDRILKAHEQGQCFRVYVLLPLLPGFEGDISTGGGNSIQAILHFTYRTLCRGEYSILHRLKAAMGTAWRDYMSICGLRTHGELGGHPISELIYIHSKLLIADDRTVIIGSANINDRSLLGKRDSELAILIKDTEMEPSLMDGVEYQAGRFALSLRGRCFSVILGANTWPDLDLRDPVCDDFFQLWQETAENNATIYEQIFRCLPSNATRSLRALREYVAVESLATVSPSLAQSELAHIRGHLVHFPLKFLEDESLLPHWGAKRGMIPLEVWT",
"length": 933
},
"evidence": [
{
"id": "45920257",
"url": "http://www.informatics.jax.org/homology/45920257",
"database": "MGI"
}
],
"common_name": "Rat"
},
{
"uniprot_canonical_ac": "P97813-1",
"protein_name": "Phospholipase D2",
"gene_name": "Pld2",
"tax_id": 10090,
"organism": "Mus musculus",
"sequence": {
"sequence": "MTVTQKNLFPYGDYLNSSQLHMEPDEVDTLREGEDPADRMHPYLAIYDLQPLKAHPLVFAPGVPVIAQVVGTERYTSGSKVGTCTLYSVRLTHGDFTWTTKKKFRHFQELHRDLQRHKVLMSLLPLARFAVTHSPAREAAAEDIPSLPRGGSEGSARHTASKQKYLENYLNRLLTMSFYRNYHAMTEFLEVSQLSFIPDLGSKGLEGVIRKRSGGHRVPGFTFCGRDQVCYRWSKRWLVVKDSFLLYMRPETGAISFVQLFDPGFEVQVGKRSTETRYGVRIDTSHRSLILKCSSYRQARWWGQEITELAQGSGRDFLQLHQHDSYAPPRPGTLARWFVNGAGYFAAVADAILRAQEEIFITDWWLSPEIYLKRPAHSDDWRLDIMLKRKAEEGVRVSILLFKEVELALGINSGYSKRTLMLLHPNIKVMRHPDLVTLWAHHEKLLVVDQVVAFLGGLDLAFGRWDDVQYRLTDLGDPSEPVHLQTPTLGSDPAATPDLSHNQFFWLGKDYSNLITKDWVQLDRPFEDFIDRETTPRMPWRDVGVVVHGVAARDLARHFIQRWNFTKTTKARYKTPLYPYLLPKSTSTANNLPFMIPGGQCATVQVLRSVDRWSAGTLENSILNAYLHTIRESQHFLYIENQFFISCSDGRTVLNKVGDEIVDRILKAHEQGQCFRVYLLLPLLPGFEGDISTGGGNSIQAILHFTYRTLCRGEHSILHRLKAAMGTAWRDYMSICGLRTHGELGGHPISELIYIHSKMLIADDRTVIIGSANINDRSLLGKRDSELAILIKDTEMEPSLMDGVEYQAGRFALSLRKHCFSVILGANTWPDLDLRDPVCDDFFQLWQETAENNATIYEQIFRCLPSNATRSLRALREYVAVESLATVSPSLAQSELAHIQGHLVHFPLKFLEDESLLPPLGSKEGMIPLEVWT",
"length": 933
},
"evidence": [
{
"id": "45920257",
"url": "http://www.informatics.jax.org/homology/45920257",
"database": "MGI"
}
],
"common_name": "Mouse"
}
],
"go_annotation": {
"categories": [
{
"name": "Molecular Function",
"total": 3,
"go_terms": [
{
"name": "N-acylphosphatidylethanolamine-specific phospholipase D activity",
"id": "GO:0070290",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070290",
"evidence": [
{
"database": "UniProtKB",
"id": "O14939",
"url": "https://www.uniprot.org/uniprot/O14939"
}
],
"pmid": ""
},
{
"name": "phospholipase D activity",
"id": "GO:0004630",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004630",
"evidence": [
{
"database": "UniProtKB",
"id": "O14939",
"url": "https://www.uniprot.org/uniprot/O14939"
}
],
"pmid": ""
},
{
"name": "phosphatidylinositol binding",
"id": "GO:0035091",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035091",
"evidence": [
{
"database": "UniProtKB",
"id": "O14939",
"url": "https://www.uniprot.org/uniprot/O14939"
}
],
"pmid": ""
}
]
},
{
"name": "Biological Process",
"total": 8,
"go_terms": [
{
"name": "lipid catabolic process",
"id": "GO:0016042",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016042",
"evidence": [
{
"database": "UniProtKB",
"id": "O14939",
"url": "https://www.uniprot.org/uniprot/O14939"
}
],
"pmid": ""
},
{
"name": "phosphatidic acid biosynthetic process",
"id": "GO:0006654",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006654",
"evidence": [
{
"database": "UniProtKB",
"id": "O14939",
"url": "https://www.uniprot.org/uniprot/O14939"
}
],
"pmid": ""
},
{
"name": "phospholipid catabolic process",
"id": "GO:0009395",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009395",
"evidence": [
{
"database": "UniProtKB",
"id": "O14939",
"url": "https://www.uniprot.org/uniprot/O14939"
}
],
"pmid": ""
},
{
"name": "cytoskeleton organization",
"id": "GO:0007010",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007010",
"evidence": [
{
"database": "UniProtKB",
"id": "O14939",
"url": "https://www.uniprot.org/uniprot/O14939"
}
],
"pmid": ""
},
{
"name": "small GTPase mediated signal transduction",
"id": "GO:0007264",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007264",
"evidence": [
{
"database": "UniProtKB",
"id": "O14939",
"url": "https://www.uniprot.org/uniprot/O14939"
}
],
"pmid": ""
},
{
"name": "Fc-gamma receptor signaling pathway involved in phagocytosis",
"id": "GO:0038096",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0038096",
"evidence": [
{
"database": "UniProtKB",
"id": "O14939",
"url": "https://www.uniprot.org/uniprot/O14939"
}
],
"pmid": ""
},
{
"name": "regulation of vesicle-mediated transport",
"id": "GO:0060627",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060627",
"evidence": [
{
"database": "UniProtKB",
"id": "O14939",
"url": "https://www.uniprot.org/uniprot/O14939"
}
],
"pmid": ""
},
{
"name": "synaptic vesicle recycling",
"id": "GO:0036465",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0036465",
"evidence": [
{
"database": "UniProtKB",
"id": "O14939",
"url": "https://www.uniprot.org/uniprot/O14939"
}
],
"pmid": ""
}
]
},
{
"name": "Cellular Component",
"total": 4,
"go_terms": [
{
"name": "plasma membrane",
"id": "GO:0005886",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886",
"evidence": [
{
"database": "UniProtKB",
"id": "O14939",
"url": "https://www.uniprot.org/uniprot/O14939"
}
],
"pmid": ""
},
{
"name": "intracellular membrane-bounded organelle",
"id": "GO:0043231",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043231",
"evidence": [
{
"database": "UniProtKB",
"id": "O14939",
"url": "https://www.uniprot.org/uniprot/O14939"
}
],
"pmid": ""
},
{
"name": "endoplasmic reticulum membrane",
"id": "GO:0005789",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789",
"evidence": [
{
"database": "UniProtKB",
"id": "O14939",
"url": "https://www.uniprot.org/uniprot/O14939"
}
],
"pmid": ""
},
{
"name": "presynapse",
"id": "GO:0098793",
"url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098793",
"evidence": [
{
"database": "UniProtKB",
"id": "O14939",
"url": "https://www.uniprot.org/uniprot/O14939"
}
],
"pmid": ""
}
]
}
]
},
"pro_annotation": [],
"site_annotation": [
{
"start_pos": 564,
"end_pos": 566,
"annotation": "n_glycosylation_sequon"
},
{
"start_pos": 867,
"end_pos": 869,
"annotation": "n_glycosylation_sequon"
}
],
"ptm_annotation": [],
"interactions": [],
"reactions": [
{
"id": "14445",
"name": "",
"equation": "a 1,2-diacyl-sn-glycero-3-phosphocholine + H2O = a 1,2-diacyl-sn-glycero-3-phosphate + choline + H(+)",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P70498-1",
"P70496-1",
"O14939-1",
"Q13393-1",
"Q9Z280-1",
"P97813-1",
"P36126-1",
"Q54K50-1",
"Q54SA1-1",
"Q54UK0-1",
"Q54WR4-1",
"Q54Z25-1",
"B7YZT5-1"
],
"evidence": [
{
"id": "14445",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/14445"
}
]
},
{
"id": "44872",
"name": "",
"equation": "1,2-dihexadecanoyl-sn-glycero-3-phosphocholine + H2O = 1,2-dihexadecanoyl-sn-glycero-3-phosphate + choline + H(+)",
"summary": "",
"cellular_location": "",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"P70498-1",
"P70496-1",
"O14939-1",
"Q13393-1",
"P97813-1",
"Q9Z280-1"
],
"evidence": [
{
"id": "44872",
"database": "Rhea",
"url": "https://www.rhea-db.org/rhea/44872"
}
]
},
{
"id": "R-HSA-1483142",
"name": "PC is transphosphatidylated to PG by PLD1-4/6",
"equation": "",
"summary": "In the endoplasmic reticulum (ER) membrane, phospholipase D1-4,6 (PLD1-4,6) transphosphatidylates phosphatidylcholine (PC) with glycerol to displace choline (Cho) and form phosphatidylglycerol (PG). This reaction is inferred from rats, but PLD enzymes are present in humans (Hammond et al. 1995, Steed et al. 1998, Cao et al. 1997).",
"cellular_location": "cytosol, endoplasmic reticulum membrane",
"input_participant_list": [
"R-ALL-76116",
"R-ALL-426925"
],
"output_participant_list": [
"R-ALL-1483256"
],
"enzyme_list": [
"O14939-1",
"Q13393-1",
"Q8N2A8-1",
"Q96BZ4-1",
"Q8IV08-1"
],
"evidence": [
{
"id": "R-HSA-1483142",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483142"
}
]
},
{
"id": "R-HSA-1483182",
"name": "PC is hydrolyzed to PA and choline by PLD1/2",
"equation": "",
"summary": "Phosphatidylcholine (PC) is hydrolyzed to phosphatidic acid (PA) and choline (Cho) by the enzymes phospholipase D1/2 (PLD1/2), at the endoplasmic reticulum (ER) membrane (Lopez et al. 1998, Hammond et al. 1995).",
"cellular_location": "cytosol, endoplasmic reticulum membrane",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"O14939-1",
"Q13393-1"
],
"evidence": [
{
"id": "R-HSA-1483182",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1483182"
}
]
},
{
"id": "R-HSA-2029471",
"name": "Hydrolysis of PC to PA by PLD",
"equation": "",
"summary": "Phospholipase D (PLD) catalyses the hydrolysis of the membrane phospholipid, phosphatidylcholine (PC) to generate choline and metabolically active phosphatidic acid (PA) (Lennartz 1999). Pharmacological inhibition studies show that PLD participates in FCGR-mediated phagocytosis (Kusner et al. 1996). There is an increase in the activity of PLD following the activation of phagocytosis via FCGR (Kusner et al. 1999). Following activation of FCGR, PLD translocates to the plasma membrane at the phagocytic cup and generate PA. This PA can be converted to DAG through the action of phosphatidic acid phosphatase-1 (PAP-1). Thus activation of PLD may be an additional pathway leading to PKC activation.
The two isoforms PLD1 and PLD2 are both shown to be essential for the formation of phagosome at different stages. PLD1 is localized on the endosomal/lysosomal compartment and PLD2 is localized at the plasma membrane. PLD2 may be linked to phagosome formation whereas PLD1 may be involved in the focal exocytosis at the plasma membrane and also in the maturation process (Carrotte et al. 2006).",
"cellular_location": "cytosol, plasma membrane",
"input_participant_list": [
"R-ALL-429802"
],
"output_participant_list": [],
"enzyme_list": [
"O14939-1",
"Q13393-1",
"Q96BZ4-1",
"Q8IV08-1"
],
"evidence": [
{
"id": "R-HSA-2029471",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2029471"
}
]
},
{
"id": "R-HSA-9013145",
"name": "RAC1 binds effectors at the plasma membrane",
"equation": "",
"summary": "In its GTP bound active form, plasma membrane associated RAC1 binds to the following cytosolic and plasma membrane effectors:
BAIAP2 (Lewis Saravalli et al. 2013, Bagci et al. 2020)
CAV1 (Nethe et al. 2010, Bagci et al. 2020)
CDC42BPA (Schwarz et al. 2012)
CIT (Madaule et al. 1995)
CIT 3 (Di Cunto et al. 1998)
CYFIP1 (Schneck et al. 2003, Bagci et al. 2020)
FMNL1 (Yayoshi Yamamoto et al. 2000)
IQGAP1 (Kuroda et al. 1996, Pelikan Conchaudron et al. 2011)
IQGAP2 (Brill et al. 1996, Ozdemir et al. 2018)
IQGAP3 (Wang et al. 2007)
KIAA0355 (Bagci et al. 2020: interaction studied in detail)
NISCH (Reddig et al. 2005)
NOX1 complex (Cheng et al. 2006, Miyano et al. 2006, Kao et al. 2008)
NOX2 complex (Ushio Fukai et al. 2002)
NOX3 complex (Ueyama et al. 2006, Miyano and Sumimoto 2007, Kao et al. 2008)
PAK1 (Parrini et al. 2002)
PAK2 (Manser et al. 1994, Manser et al. 1995, Bagci et al. 2020)
PAK3 (Manser et al. 1995)
PAK4 (Abo et al. 1998, Bagci et al. 2020)
PAK5 (Dan et al. 2002)
PAK6 (Lee et al. 2002)
PARD6A (Qiu et al. 2000)
PI3K alpha (Bokoch et at al. 1996, Murga et al. 2002)
PKN1 (Owen et al. 2003, Modha et al. 2008)
PKN2 (Zong et al. 1999)
PLD1 (Hammond et al. 1997)
PLD2 (Hiroyama and Exton 2005)
WAVE complex (Miki et al. 1998, Suetsugu et al. 2006, Bagci et al. 2020)
The following RAC1 effectors are annotated as candidate effectors either because of opposing finding reported in different studies or because they have only been reported in the high throughput screen by Bagci et al. 2020:
ABI1 (Bagci et al. 2020)
ABL2 (Bagci et al. 2020)
AMIGO2 (Bagci et al. 2020)
ARAP2 (Bagci et al. 2020)
BAIAP2L1 (Bagci et al. 2020)
BRK1 (Bagci et al. 2020)
CDC42 (Bagci et al. 2020)
CDC42EP1 (Bagci et al. 2020: binding to activated RAC1; Joberty et al. 1999: no binding to activated RAC1)
CDC42EP4 (Bagci et al. 2020: binding to activated RAC1; Joberty et al. 1999: no binding to activated RAC1)
DEPDC1B (Bagci et al. 2020)
DIAPH3 (Bagci et al. 2020)
EPHA2 (Bagci et al. 2020)
ERBIN (Bagci et al. 2020)
FERMT2 (Bagci et al. 2020)
GIT1 (Bagci et al. 2020)
GIT2 (Bagci et al. 2020)
ITGB1 (Bagci et al. 2020)
JAG1 (Bagci et al. 2020)
LAMTOR1 (Bagci et al. 2020)
MCAM (Bagci et al. 2020)
MPP7 (Bagci et al. 2020)
NCKAP1 (Bagci et al. 2020)
NHS (Bagci et al. 2020)
PLEKHG3 (Bagci et al. 2020)
PLEKHG4 (Bagci et al. 2020)
RAB7A (Bagci et al. 2020)
SLC1A5 (Bagci et al. 2020)
SNAP23 (Bagci et al. 2020)
SWAP70 (Bagci et al. 2020)
TAOK3 (Bagci et al. 2020)
TFRC (Bagci et al. 2020)
TMPO (Bagci et al. 2020)
VAMP3 (Bagci et al. 2020)
VANGL1 (Bagci et al. 2020)
WIP WASP complex (WAS, also known as WASP, a component of the WIP WASP complex, was reported to interact with active RAC1 by Aspenstrom et al. 1996 and Vastrik et al. 1999, but no interaction has been reported between RAC1 and WIP components of the complex, WIPF1, WIPF2 or WIPF3)
Active RAC1 does not bind the following RHO GTPase effectors:
ANKLE2 (Bagci et al. 2020)
ARFGAP3 (Bagci et al. 2020)
ARMCX3 (Bagci et al. 2020)
CDC42EP2 (Joberty et al. 1999)
CDC42EP3 (Joberty et al. 1999)
CDC42EP5 (Joberty et al. 1999)
DSG2 (Bagci et al. 2020)
DIAPH1 (Higashi et al. 2008)
DOCK1 (Bagci et al. 2020)
DOCK5 (Bagci et al. 2020)
ELMO2 (Bagci et al. 2020)
FMNL2 (Block et al. 2012)
HSPE1 (Bagci et al. 2020)
IL32 (Bagci et al. 2020)
LETM1 (Bagci et al. 2020)
LMAN1 (Bagci et al. 2020)
NDUFA5 (Bagci et al. 2020)
NDUFS3 (Bagci et al. 2020)
PGRMC2 (Bagci et al. 2020)
RAPGEF1 (Bagci et al. 2020)
ROCK1 (Leung et al. 1996)
ROCK2 (Leung et al. 1996)
RTKN (Reid et al. 1996)
SHMT2 (Bagci et al. 2020)
SLK (Yamada et al. 2000)
SLITRK3 (Bagci et al. 2020)
SLITRK5 (Bagci et al. 2020)
STBD1 (Bagci et al. 2020)
STX5 (Bagci et al. 2020)
VAPB (Bagci et al. 2020)",
"cellular_location": "cytosol, plasma membrane",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"O14939-1",
"Q13393-1",
"Q9HBY0-1",
"O14578-1",
"P42336-1",
"Q9H2K8-1",
"P42684-1",
"P60953-2",
"P63000-1",
"Q16512-1",
"Q13153-1",
"Q13177-1",
"Q9P286-1",
"O75914-1",
"O96013-1",
"Q5VT25-1",
"P04839-1",
"P29317-1",
"Q9Y5S8-1",
"Q9NQU5-1",
"Q16513-1",
"P51149-1"
],
"evidence": [
{
"id": "R-HSA-9013145",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9013145"
}
]
},
{
"id": "R-HSA-9014294",
"name": "RAC2 binds effectors at the plasma membrane",
"equation": "",
"summary": "In its GTP bound active form, plasma membrane associated RAC2 binds to the following effectors:
IQGAP1 (Meng et al. 2007)
KIAA0355 (Bagci et al. 2020: interaction tested in detail)
PAK1 (Knaus et al. 1998; Hoppe and Swanson 2004; Carstanjen et al. 2005)
PAK4 (Zhang et al. 2019; Bagci et al. 2020)
PI3K alpha (Bokoch et al. 1996)
PLD2 (Peng et al. 2011)
The following candidate RAC2 effectors have so far only been reported in the high throughput screen by Bagci et al. 2020:
ABI1 (Bagci et al. 2020)
ABI2 (Bagci et al. 2020)
BAIAP2L1 (Bagci et al. 2020)
CAV1 (Bagci et al. 2020)
CDC42 (Bagci et al. 2020)
CDC42EP1 (Bagci et al. 2020)
CDC42EP4 (Bagci et al. 2020)
DEPDC1B (Bagci et al. 2020)
DIAPH3 (Bagci et al. 2020)
DSG2 (Bagci et al. 2020)
EPHA2 (Bagci et al. 2020)
ERBIN (Bagci et al. 2020)
GIT1 (Bagci et al. 2020)
GIT2 (Bagci et al. 2020)
ITGB1 (Bagci et al. 2020)
LAMTOR1 (Bagci et al. 2020)
MCAM (Bagci et al. 2020)
MPP7 (Bagci et al. 2020)
NCKAP1 (Bagci et al. 2020)
NHS (Bagci et al. 2020)
PAK2 (Bagci et al. 2020)
RAB7A (Bagci et al. 2020)
SLITRK5 (Bagci et al. 2020)
STBD1 (Bagci et al. 2020)
STX5 (Bagci et al. 2020)
SWAP70 (Bagci et al. 2020)
TAOK3 (Bagci et al. 2020)
TFRC (Bagci et al. 2020)
TMPO (Bagci et al. 2020)
VAMP3 (Bagci et al. 2020)
VANGL1 (Bagci et al. 2020)
WAVE2 regulatory complex (interacts with subunits CYFIP1 and WASF2) (Bagci et al. 2020)
RAC2 does not bind the following RHO GTPase effectors:
ABL2 (Bagci et al. 2020)
AMIGO2 (Bagci et al. 2020)
ARAP2 (Bagci et al. 2020)
ARFGAP3 (Bagci et al. 2020)
BAIAP2 (Bagci et al. 2020)
BRK1 (Bagci et al. 2020)
DOCK1 (Bagci et al. 2020)
DOCK5 (Bagci et al. 2020)
ELMO2 (Bagci et al. 2020)
FERMT2 (Bagci et al. 2020)
HSPE1 (Bagci et al. 2020)
IL32 (Bagci et al. 2020)
JAG1 (Bagci et al. 2020)
LETM1 (Bagci et al. 2020)
NDUFA5 (Bagci et al. 2020)
NDUFS3 (Bagci et al. 2020)
PLEKHG3 (Bagci et al. 2020)
PLEKHG4 (Bagci et al. 2020)
RAPGEF1 (Bagci et al. 2020)
SHMT2 (Bagci et al. 2020)
SLC1A5 (Bagci et al. 2020)
SLITRK3 (Bagci et al. 2020)
SNAP23 (Bagci et al. 2020)
WAVE1 complex subunit WASF1 (Bagci et al. 2020)
YKT6 (Bagci et al. 2020)",
"cellular_location": "cytosol, plasma membrane",
"input_participant_list": [],
"output_participant_list": [],
"enzyme_list": [
"O14939-1",
"P42336-1",
"Q9H2K8-1",
"P60953-2",
"Q13153-1",
"Q13177-1",
"O96013-1",
"P29317-1",
"P51149-1"
],
"evidence": [
{
"id": "R-HSA-9014294",
"database": "Reactome",
"url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9014294"
}
]
}
],
"reaction_participants": [
{
"participant_id": "R-ALL-1483256",
"participant_name": "PG [endoplasmic reticulum membrane]",
"crossref": [
{
"id": "64716",
"database": "ChEBI",
"url": ""
},
{
"id": "64716",
"database": "ChEBI",
"url": ""
},
{
"id": "64716",
"database": "ChEBI",
"url": ""
},
{
"id": "64716",
"database": "ChEBI",
"url": ""
},
{
"id": "64716",
"database": "ChEBI",
"url": ""
},
{
"id": "64716",
"database": "ChEBI",
"url": ""
},
{
"id": "64716",
"database": "ChEBI",
"url": ""
}
]
},
{
"participant_id": "R-ALL-426925",
"participant_name": "PC [endoplasmic reticulum membrane]",
"crossref": [
{
"id": "C00157",
"database": "COMPOUND",
"url": ""
},
{
"id": "57643",
"database": "ChEBI",
"url": ""
},
{
"id": "C00157",
"database": "COMPOUND",
"url": ""
},
{
"id": "57643",
"database": "ChEBI",
"url": ""
},
{
"id": "C00157",
"database": "COMPOUND",
"url": ""
},
{
"id": "57643",
"database": "ChEBI",
"url": ""
},
{
"id": "C00157",
"database": "COMPOUND",
"url": ""
},
{
"id": "57643",
"database": "ChEBI",
"url": ""
},
{
"id": "57643",
"database": "ChEBI",
"url": ""
},
{
"id": "C00157",
"database": "COMPOUND",
"url": ""
},
{
"id": "C00157",
"database": "COMPOUND",
"url": ""
},
{
"id": "57643",
"database": "ChEBI",
"url": ""
},
{
"id": "C00157",
"database": "COMPOUND",
"url": ""
},
{
"id": "57643",
"database": "ChEBI",
"url": ""
}
]
},
{
"participant_id": "R-ALL-429802",
"participant_name": "PC [plasma membrane]",
"crossref": [
{
"id": "57643",
"database": "ChEBI",
"url": ""
},
{
"id": "C00157",
"database": "COMPOUND",
"url": ""
},
{
"id": "C00157",
"database": "COMPOUND",
"url": ""
},
{
"id": "57643",
"database": "ChEBI",
"url": ""
},
{
"id": "57643",
"database": "ChEBI",
"url": ""
},
{
"id": "C00157",
"database": "COMPOUND",
"url": ""
},
{
"id": "C00157",
"database": "COMPOUND",
"url": ""
},
{
"id": "57643",
"database": "ChEBI",
"url": ""
},
{
"id": "C00157",
"database": "COMPOUND",
"url": ""
},
{
"id": "57643",
"database": "ChEBI",
"url": ""
},
{
"id": "C00157",
"database": "COMPOUND",
"url": ""
},
{
"id": "57643",
"database": "ChEBI",
"url": ""
},
{
"id": "C00157",
"database": "COMPOUND",
"url": ""
},
{
"id": "57643",
"database": "ChEBI",
"url": ""
}
]
},
{
"participant_id": "R-ALL-76116",
"participant_name": "Glycerol [cytosol]",
"crossref": [
{
"id": "C00116",
"database": "COMPOUND",
"url": ""
},
{
"id": "17754",
"database": "ChEBI",
"url": ""
},
{
"id": "5195",
"database": "Guide to Pharmacology - Ligands",
"url": ""
},
{
"id": "HMDB0000131",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "8144020",
"database": "PubChem Substance",
"url": ""
},
{
"id": "000000895048",
"database": "ZINC",
"url": ""
},
{
"id": "C00116",
"database": "COMPOUND",
"url": ""
},
{
"id": "17754",
"database": "ChEBI",
"url": ""
},
{
"id": "5195",
"database": "Guide to Pharmacology - Ligands",
"url": ""
},
{
"id": "HMDB0000131",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "8144020",
"database": "PubChem Substance",
"url": ""
},
{
"id": "000000895048",
"database": "ZINC",
"url": ""
},
{
"id": "C00116",
"database": "COMPOUND",
"url": ""
},
{
"id": "17754",
"database": "ChEBI",
"url": ""
},
{
"id": "5195",
"database": "Guide to Pharmacology - Ligands",
"url": ""
},
{
"id": "HMDB0000131",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "8144020",
"database": "PubChem Substance",
"url": ""
},
{
"id": "000000895048",
"database": "ZINC",
"url": ""
},
{
"id": "C00116",
"database": "COMPOUND",
"url": ""
},
{
"id": "17754",
"database": "ChEBI",
"url": ""
},
{
"id": "5195",
"database": "Guide to Pharmacology - Ligands",
"url": ""
},
{
"id": "HMDB0000131",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "8144020",
"database": "PubChem Substance",
"url": ""
},
{
"id": "000000895048",
"database": "ZINC",
"url": ""
},
{
"id": "C00116",
"database": "COMPOUND",
"url": ""
},
{
"id": "17754",
"database": "ChEBI",
"url": ""
},
{
"id": "5195",
"database": "Guide to Pharmacology - Ligands",
"url": ""
},
{
"id": "HMDB0000131",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "8144020",
"database": "PubChem Substance",
"url": ""
},
{
"id": "000000895048",
"database": "ZINC",
"url": ""
},
{
"id": "5195",
"database": "Guide to Pharmacology - Ligands",
"url": ""
},
{
"id": "HMDB0000131",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "8144020",
"database": "PubChem Substance",
"url": ""
},
{
"id": "000000895048",
"database": "ZINC",
"url": ""
},
{
"id": "17754",
"database": "ChEBI",
"url": ""
},
{
"id": "C00116",
"database": "COMPOUND",
"url": ""
},
{
"id": "C00116",
"database": "COMPOUND",
"url": ""
},
{
"id": "17754",
"database": "ChEBI",
"url": ""
},
{
"id": "5195",
"database": "Guide to Pharmacology - Ligands",
"url": ""
},
{
"id": "HMDB0000131",
"database": "HMDB Metabolite",
"url": ""
},
{
"id": "8144020",
"database": "PubChem Substance",
"url": ""
},
{
"id": "000000895048",
"database": "ZINC",
"url": ""
}
]
}
],
"reaction_enzymes": [
{
"uniprot_ac": "B7YZT5",
"gene_name": "Pld",
"activity": [
{
"ec_number": "3.1.4.4",
"activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a 1-acyl-sn-glycero-3-phosphate + choline + H(+).",
"evidence": [
{
"id": "B7YZT5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/B7YZT5"
}
]
},
{
"ec_number": "3.1.4.4",
"activity": "",
"evidence": [
{
"id": "B7YZT5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/B7YZT5"
}
]
}
]
},
{
"uniprot_ac": "O14578",
"gene_name": "CIT",
"activity": [
{
"ec_number": "2.7.11.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "O14578",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O14578"
}
]
},
{
"ec_number": "2.7.11.1",
"activity": "",
"evidence": [
{
"id": "O14578",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O14578"
}
]
}
]
},
{
"uniprot_ac": "O14939",
"gene_name": "PLD2",
"activity": [
{
"ec_number": "3.1.4.4",
"activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a 1-acyl-sn-glycero-3-phosphate + choline + H(+).",
"evidence": [
{
"id": "O14939",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O14939"
}
]
},
{
"ec_number": "3.1.4.4",
"activity": "",
"evidence": [
{
"id": "O14939",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O14939"
}
]
}
]
},
{
"uniprot_ac": "O75914",
"gene_name": "PAK3",
"activity": [
{
"ec_number": "2.7.11.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "O75914",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O75914"
}
]
},
{
"ec_number": "2.7.11.1",
"activity": "",
"evidence": [
{
"id": "O75914",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O75914"
}
]
}
]
},
{
"uniprot_ac": "O96013",
"gene_name": "PAK4",
"activity": [
{
"ec_number": "2.7.11.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "O96013",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O96013"
}
]
},
{
"ec_number": "2.7.11.1",
"activity": "",
"evidence": [
{
"id": "O96013",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/O96013"
}
]
}
]
},
{
"uniprot_ac": "P04839",
"gene_name": "CYBB",
"activity": [
{
"ec_number": "1.-.-.-",
"activity": "",
"evidence": [
{
"id": "P04839",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P04839"
}
]
}
]
},
{
"uniprot_ac": "P29317",
"gene_name": "EPHA2",
"activity": [
{
"ec_number": "2.7.10.1",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P29317",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P29317"
}
]
},
{
"ec_number": "2.7.10.1",
"activity": "",
"evidence": [
{
"id": "P29317",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P29317"
}
]
}
]
},
{
"uniprot_ac": "P36126",
"gene_name": "SPO14",
"activity": [
{
"ec_number": "3.1.4.4",
"activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a 1-acyl-sn-glycero-3-phosphate + choline + H(+).",
"evidence": [
{
"id": "P36126",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P36126"
}
]
},
{
"ec_number": "3.1.4.4",
"activity": "",
"evidence": [
{
"id": "P36126",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P36126"
}
]
}
]
},
{
"uniprot_ac": "P42336",
"gene_name": "PIK3CA",
"activity": [
{
"ec_number": "2.7.1.153",
"activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-4,5-bisphosphate) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3,4,5-trisphosphate) + ADP + H(+).",
"evidence": [
{
"id": "P42336",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P42336"
}
]
},
{
"ec_number": "2.7.1.153",
"activity": "",
"evidence": [
{
"id": "P42336",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P42336"
}
]
},
{
"ec_number": "2.7.11.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "P42336",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P42336"
}
]
},
{
"ec_number": "2.7.1.137",
"activity": "a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol) + ATP = a 1,2-diacyl-sn-glycero-3-phospho-(1D-myo-inositol-3-phosphate) + ADP + H(+).",
"evidence": [
{
"id": "P42336",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P42336"
}
]
},
{
"ec_number": "2.7.1.137",
"activity": "",
"evidence": [
{
"id": "P42336",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P42336"
}
]
}
]
},
{
"uniprot_ac": "P42684",
"gene_name": "ABL2",
"activity": [
{
"ec_number": "2.7.10.2",
"activity": "ATP + L-tyrosyl-[protein] = ADP + H(+) + O-phospho-L-tyrosyl-[protein].",
"evidence": [
{
"id": "P42684",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P42684"
}
]
},
{
"ec_number": "2.7.10.2",
"activity": "",
"evidence": [
{
"id": "P42684",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P42684"
}
]
}
]
},
{
"uniprot_ac": "P51149",
"gene_name": "RAB7A",
"activity": [
{
"ec_number": "3.6.5.2",
"activity": "GTP + H2O = GDP + H(+) + phosphate.",
"evidence": [
{
"id": "P51149",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P51149"
}
]
},
{
"ec_number": "3.6.5.2",
"activity": "",
"evidence": [
{
"id": "P51149",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P51149"
}
]
}
]
},
{
"uniprot_ac": "P60953",
"gene_name": "CDC42",
"activity": [
{
"ec_number": "3.6.5.2",
"activity": "GTP + H2O = GDP + H(+) + phosphate.",
"evidence": [
{
"id": "P60953",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P60953"
}
]
},
{
"ec_number": "3.6.5.2",
"activity": "",
"evidence": [
{
"id": "P60953",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P60953"
}
]
}
]
},
{
"uniprot_ac": "P63000",
"gene_name": "RAC1",
"activity": [
{
"ec_number": "3.6.5.2",
"activity": "GTP + H2O = GDP + H(+) + phosphate.",
"evidence": [
{
"id": "P63000",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P63000"
}
]
},
{
"ec_number": "3.6.5.2",
"activity": "",
"evidence": [
{
"id": "P63000",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P63000"
}
]
}
]
},
{
"uniprot_ac": "P70496",
"gene_name": "Pld1",
"activity": [
{
"ec_number": "3.1.4.4",
"activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a 1-acyl-sn-glycero-3-phosphate + choline + H(+).",
"evidence": [
{
"id": "P70496",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P70496"
}
]
},
{
"ec_number": "3.1.4.4",
"activity": "",
"evidence": [
{
"id": "P70496",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P70496"
}
]
}
]
},
{
"uniprot_ac": "P70498",
"gene_name": "Pld2",
"activity": [
{
"ec_number": "3.1.4.4",
"activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a 1-acyl-sn-glycero-3-phosphate + choline + H(+).",
"evidence": [
{
"id": "P70498",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P70498"
}
]
},
{
"ec_number": "3.1.4.4",
"activity": "",
"evidence": [
{
"id": "P70498",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P70498"
}
]
}
]
},
{
"uniprot_ac": "P97813",
"gene_name": "Pld2",
"activity": [
{
"ec_number": "3.1.4.4",
"activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a 1-acyl-sn-glycero-3-phosphate + choline + H(+).",
"evidence": [
{
"id": "P97813",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P97813"
}
]
},
{
"ec_number": "3.1.4.4",
"activity": "",
"evidence": [
{
"id": "P97813",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/P97813"
}
]
}
]
},
{
"uniprot_ac": "Q13153",
"gene_name": "PAK1",
"activity": [
{
"ec_number": "2.7.11.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q13153",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q13153"
}
]
},
{
"ec_number": "2.7.11.1",
"activity": "",
"evidence": [
{
"id": "Q13153",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q13153"
}
]
}
]
},
{
"uniprot_ac": "Q13177",
"gene_name": "PAK2",
"activity": [
{
"ec_number": "2.7.11.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q13177",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q13177"
}
]
},
{
"ec_number": "2.7.11.1",
"activity": "",
"evidence": [
{
"id": "Q13177",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q13177"
}
]
}
]
},
{
"uniprot_ac": "Q13393",
"gene_name": "PLD1",
"activity": [
{
"ec_number": "3.1.4.4",
"activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a 1-acyl-sn-glycero-3-phosphate + choline + H(+).",
"evidence": [
{
"id": "Q13393",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q13393"
}
]
},
{
"ec_number": "3.1.4.4",
"activity": "",
"evidence": [
{
"id": "Q13393",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q13393"
}
]
}
]
},
{
"uniprot_ac": "Q16512",
"gene_name": "PKN1",
"activity": [
{
"ec_number": "2.7.11.13",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q16512",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q16512"
}
]
},
{
"ec_number": "2.7.11.13",
"activity": "",
"evidence": [
{
"id": "Q16512",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q16512"
}
]
}
]
},
{
"uniprot_ac": "Q16513",
"gene_name": "PKN2",
"activity": [
{
"ec_number": "2.7.11.13",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q16513",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q16513"
}
]
},
{
"ec_number": "2.7.11.13",
"activity": "",
"evidence": [
{
"id": "Q16513",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q16513"
}
]
}
]
},
{
"uniprot_ac": "Q54K50",
"gene_name": "pldY",
"activity": [
{
"ec_number": "3.1.4.4",
"activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a 1-acyl-sn-glycero-3-phosphate + choline + H(+).",
"evidence": [
{
"id": "Q54K50",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q54K50"
}
]
},
{
"ec_number": "3.1.4.4",
"activity": "",
"evidence": [
{
"id": "Q54K50",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q54K50"
}
]
}
]
},
{
"uniprot_ac": "Q54SA1",
"gene_name": "pldZ",
"activity": [
{
"ec_number": "3.1.4.4",
"activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a 1-acyl-sn-glycero-3-phosphate + choline + H(+).",
"evidence": [
{
"id": "Q54SA1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q54SA1"
}
]
},
{
"ec_number": "3.1.4.4",
"activity": "",
"evidence": [
{
"id": "Q54SA1",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q54SA1"
}
]
}
]
},
{
"uniprot_ac": "Q54UK0",
"gene_name": "pldA",
"activity": [
{
"ec_number": "3.1.4.4",
"activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a 1-acyl-sn-glycero-3-phosphate + choline + H(+).",
"evidence": [
{
"id": "Q54UK0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q54UK0"
}
]
},
{
"ec_number": "3.1.4.4",
"activity": "",
"evidence": [
{
"id": "Q54UK0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q54UK0"
}
]
}
]
},
{
"uniprot_ac": "Q54WR4",
"gene_name": "pldB",
"activity": [
{
"ec_number": "3.1.4.4",
"activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a 1-acyl-sn-glycero-3-phosphate + choline + H(+).",
"evidence": [
{
"id": "Q54WR4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q54WR4"
}
]
},
{
"ec_number": "3.1.4.4",
"activity": "",
"evidence": [
{
"id": "Q54WR4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q54WR4"
}
]
}
]
},
{
"uniprot_ac": "Q54Z25",
"gene_name": "pldC",
"activity": [
{
"ec_number": "3.1.4.4",
"activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a 1-acyl-sn-glycero-3-phosphate + choline + H(+).",
"evidence": [
{
"id": "Q54Z25",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q54Z25"
}
]
},
{
"ec_number": "3.1.4.4",
"activity": "",
"evidence": [
{
"id": "Q54Z25",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q54Z25"
}
]
}
]
},
{
"uniprot_ac": "Q5VT25",
"gene_name": "CDC42BPA",
"activity": [
{
"ec_number": "2.7.11.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q5VT25",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5VT25"
}
]
},
{
"ec_number": "2.7.11.1",
"activity": "",
"evidence": [
{
"id": "Q5VT25",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q5VT25"
}
]
}
]
},
{
"uniprot_ac": "Q8IV08",
"gene_name": "PLD3",
"activity": [
{
"ec_number": "3.1.16.1",
"activity": "Exonucleolytic cleavage in the 5'- to 3'-direction to yield nucleoside 3'-phosphates.",
"evidence": [
{
"id": "Q8IV08",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8IV08"
}
]
},
{
"ec_number": "3.1.16.1",
"activity": "",
"evidence": [
{
"id": "Q8IV08",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8IV08"
}
]
}
]
},
{
"uniprot_ac": "Q8N2A8",
"gene_name": "PLD6",
"activity": [
{
"ec_number": "3.1.4.-",
"activity": "",
"evidence": [
{
"id": "Q8N2A8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q8N2A8"
}
]
}
]
},
{
"uniprot_ac": "Q96BZ4",
"gene_name": "PLD4",
"activity": [
{
"ec_number": "3.1.16.1",
"activity": "Exonucleolytic cleavage in the 5'- to 3'-direction to yield nucleoside 3'-phosphates.",
"evidence": [
{
"id": "Q96BZ4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q96BZ4"
}
]
},
{
"ec_number": "3.1.16.1",
"activity": "",
"evidence": [
{
"id": "Q96BZ4",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q96BZ4"
}
]
}
]
},
{
"uniprot_ac": "Q9H2K8",
"gene_name": "TAOK3",
"activity": [
{
"ec_number": "2.7.11.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q9H2K8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9H2K8"
}
]
},
{
"ec_number": "2.7.11.1",
"activity": "",
"evidence": [
{
"id": "Q9H2K8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9H2K8"
}
]
}
]
},
{
"uniprot_ac": "Q9HBY0",
"gene_name": "NOX3",
"activity": [
{
"ec_number": "1.6.3.-",
"activity": "",
"evidence": [
{
"id": "Q9HBY0",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9HBY0"
}
]
}
]
},
{
"uniprot_ac": "Q9NQU5",
"gene_name": "PAK6",
"activity": [
{
"ec_number": "2.7.11.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q9NQU5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9NQU5"
}
]
},
{
"ec_number": "2.7.11.1",
"activity": "",
"evidence": [
{
"id": "Q9NQU5",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9NQU5"
}
]
}
]
},
{
"uniprot_ac": "Q9P286",
"gene_name": "PAK5",
"activity": [
{
"ec_number": "2.7.11.1",
"activity": "ATP + L-seryl-[protein] = ADP + H(+) + O-phospho-L-seryl-[protein].",
"evidence": [
{
"id": "Q9P286",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9P286"
}
]
},
{
"ec_number": "2.7.11.1",
"activity": "",
"evidence": [
{
"id": "Q9P286",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9P286"
}
]
}
]
},
{
"uniprot_ac": "Q9Y5S8",
"gene_name": "NOX1",
"activity": [
{
"ec_number": "1.6.3.-",
"activity": "",
"evidence": [
{
"id": "Q9Y5S8",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Y5S8"
}
]
}
]
},
{
"uniprot_ac": "Q9Z280",
"gene_name": "Pld1",
"activity": [
{
"ec_number": "3.1.4.4",
"activity": "a 1-acyl-sn-glycero-3-phosphocholine + H2O = a 1-acyl-sn-glycero-3-phosphate + choline + H(+).",
"evidence": [
{
"id": "Q9Z280",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Z280"
}
]
},
{
"ec_number": "3.1.4.4",
"activity": "",
"evidence": [
{
"id": "Q9Z280",
"database": "UniProtKB",
"url": "https://www.uniprot.org/uniprot/Q9Z280"
}
]
}
]
}
],
"biomarkers": [],
"synthesized_glycans": [],
"cluster_types": [
{
"name": "isoformset.uniprotkb",
"label": "Isoforms"
},
{
"name": "homologset.mgi",
"label": "MGI Homologs"
}
],
"sequence_features": {
"n_linked_sites": [],
"o_linked_sites": [],
"snv_sites": [],
"glycation_sites": [],
"phosphorylation_sites": [
72,
99,
100,
104,
134,
146,
175,
179,
243,
252,
296,
415,
566,
609
],
"sequon_annotation_sites": [
{
"start_pos": 564,
"end_pos": 566
},
{
"start_pos": 867,
"end_pos": 869
}
]
},
"section_stats": [
{
"table_id": "glycosylation",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_reported_with_glycan",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_predicted",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "glycosylation_automatic_literature_mining",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
},
{
"field": "n_linked_glycans",
"count": 0
},
{
"field": "n_linked_glycan_sites",
"count": 0
},
{
"field": "o_linked_glycans",
"count": 0
},
{
"field": "o_linked_glycan_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "phosphorylation",
"table_stats": [
{
"field": "total",
"count": 19
},
{
"field": "total_sites",
"count": 14
}
],
"sort_fields": [
"start_pos",
"end_pos",
"kinase_uniprot_canonical_ac",
"kinase_gene_name",
"residue",
"comment",
"site_lbl"
]
},
{
"table_id": "snv",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "snv_disease",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "snv_non_disease",
"table_stats": [
{
"field": "total",
"count": 0
},
{
"field": "total_sites",
"count": 0
}
],
"sort_fields": []
},
{
"table_id": "publication",
"table_stats": [
{
"field": "total",
"count": 325
}
],
"sort_fields": [
"title",
"journal",
"date",
"authors"
]
}
]
}