{ "uniprot_canonical_ac": "O14788-1", "uniprot_ac": "O14788", "uniprot_id": "TNF11_HUMAN", "mass": { "chemical_mass": 35478.0, "monoisotopic_mass": 35478.0 }, "refseq": { "ac": "NP_003692", "name": "tumor necrosis factor ligand superfamily member 11 isoform 1", "summary": "This gene encodes a member of the tumor necrosis factor (TNF) cytokine family which is a ligand for osteoprotegerin and functions as a key factor for osteoclast differentiation and activation. This protein was shown to be a dentritic cell survival factor and is involved in the regulation of T cell-dependent immune response. T cell activation was reported to induce expression of this gene and lead to an increase of osteoclastogenesis and bone loss. This protein was shown to activate antiapoptotic kinase AKT/PKB through a signaling complex involving SRC kinase and tumor necrosis factor receptor-associated factor (TRAF) 6, which indicated this protein may have a role in the regulation of cell apoptosis. Targeted disruption of the related gene in mice led to severe osteopetrosis and a lack of osteoclasts. The deficient mice exhibited defects in early differentiation of T and B lymphocytes, and failed to form lobulo-alveolar mammary structures during pregnancy. Two alternatively spliced transcript variants have been found. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003692" }, "gene_names": [ { "name": "TNFSF11", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O14788", "id": "O14788" }, { "name": "CD254; hRANKL2; ODF; OPGL; OPTB2; RANKL; sOdf; TNLG6B; TRANCE", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003692", "id": "NP_003692" }, { "name": "OPGL", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O14788", "id": "O14788" }, { "name": "RANKL", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O14788", "id": "O14788" }, { "name": "TNFSF11", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003692", "id": "NP_003692" }, { "name": "TRANCE", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O14788", "id": "O14788" } ], "protein_names": [ { "name": "Tumor necrosis factor ligand superfamily member 11", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O14788" }, { "name": "ODF", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O14788" }, { "name": "OPGL", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O14788" }, { "name": "Osteoclast differentiation factor", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O14788" }, { "name": "Osteoprotegerin ligand", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O14788" }, { "name": "RANKL", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O14788" }, { "name": "Receptor activator of nuclear factor kappa-B ligand", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O14788" }, { "name": "TNF-related activation-induced cytokine; receptor activator of nuclear factor kappa B ligand; osteoclast differentiation factor; osteoprotegerin ligand; tumor necrosis factor (ligand) superfamily, member 11; tumor necrosis factor ligand 6B; tumor necrosis factor superfamily member 11", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003692", "id": "NP_003692" }, { "name": "TNF-related activation-induced cytokine", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O14788" }, { "name": "TRANCE", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O14788" }, { "name": "tumor necrosis factor ligand superfamily member 11 isoform 1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003692", "id": "NP_003692" } ], "function": [ { "annotation": "Cytokine that binds to TNFRSF11B/OPG and to TNFRSF11A/RANK. Osteoclast differentiation and activation factor. Augments the ability of dendritic cells to stimulate naive T-cell proliferation. May be an important regulator of interactions between T-cells and dendritic cells and may play a role in the regulation of the T-cell-dependent immune response. May also play an important role in enhanced bone-resorption in humoral hypercalcemia of malignancy (PubMed:22664871). Induces osteoclastogenesis by activating multiple signaling pathways in osteoclast precursor cells, chief among which is induction of long lasting oscillations in the intracellular concentration of Ca (2+) resulting in the activation of NFATC1, which translocates to the nucleus and induces osteoclast-specific gene transcription to allow differentiation of osteoclasts. During osteoclast differentiation, in a TMEM64 and ATP2A2-dependent manner induces activation of CREB1 and mitochondrial ROS generation necessary for proper osteoclast generation (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "O14788", "url": "https://www.uniprot.org/uniprot/O14788#function" }, { "database": "UniProtKB", "id": "O35235", "url": "https://www.uniprot.org/uniprot/O35235#function" }, { "database": "PubMed", "id": "22664871", "url": "https://glygen.org/publication/PubMed/22664871" } ] }, { "annotation": "Effect of Aerobic/Strength Training on RANKL Gene DNA Methylation Levels. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_003692", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003692" }, { "database": "PubMed", "id": "37295782", "url": "https://glygen.org/publication/PubMed/37295782" } ] }, { "annotation": "MiR-217 regulates autophagy through OPG/RANKL/RANK in giant cell tumors. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_003692", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003692" }, { "database": "PubMed", "id": "37165403", "url": "https://glygen.org/publication/PubMed/37165403" } ] }, { "annotation": "Pulling rank with RNA: RANKL promotes the association of PGC-1beta/RNA complexes with NCoR/HDAC3 to activate gene expression in osteoclasts.", "evidence": [ { "database": "RefSeq", "id": "NP_003692", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003692" }, { "database": "PubMed", "id": "37802020", "url": "https://glygen.org/publication/PubMed/37802020" } ] }, { "annotation": "RANKL/RANK is required for cytokine-induced beta cell death; osteoprotegerin, a RANKL inhibitor, reverses rodent type 1 diabetes.", "evidence": [ { "database": "RefSeq", "id": "NP_003692", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003692" }, { "database": "PubMed", "id": "37910614", "url": "https://glygen.org/publication/PubMed/37910614" } ] }, { "annotation": "The Notch1 signaling pathway directly modulates the human RANKL-induced osteoclastogenesis. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_003692", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003692" }, { "database": "PubMed", "id": "38040752", "url": "https://glygen.org/publication/PubMed/38040752" } ] }, { "annotation": "This gene encodes a member of the tumor necrosis factor (TNF) cytokine family which is a ligand for osteoprotegerin and functions as a key factor for osteoclast differentiation and activation. This protein was shown to be a dentritic cell survival factor and is involved in the regulation of T cell-dependent immune response. T cell activation was reported to induce expression of this gene and lead to an increase of osteoclastogenesis and bone loss. This protein was shown to activate antiapoptotic kinase AKT/PKB through a signaling complex involving SRC kinase and tumor necrosis factor receptor-associated factor (TRAF) 6, which indicated this protein may have a role in the regulation of cell apoptosis. Targeted disruption of the related gene in mice led to severe osteopetrosis and a lack of osteoclasts. The deficient mice exhibited defects in early differentiation of T and B lymphocytes, and failed to form lobulo-alveolar mammary structures during pregnancy. Two alternatively spliced transcript variants have been found. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_003692", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003692" } ] } ], "disease": [ { "disease_id": "DOID:0110943", "recommended_name": { "id": "DOID:0110943", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110943", "name": "autosomal recessive osteopetrosis 2", "description": "An osteopetrosis characterized by autosomal recessive inheritance that has_material_basis_in homozygous mutation in the TNFSF11 gene on chromosome 13q14." }, "synonyms": [ { "id": "DOID:0110943", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110943", "name": "OPTB2", "description": "" }, { "id": "DOID:0110943", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110943", "name": "mild autosomal recessive form osteopetrosis", "description": "" }, { "id": "DOID:0110943", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0110943", "name": "osteoclast-poor osteopetrosis", "description": "" }, { "id": "MONDO:0009816", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009816", "name": "autosomal recessive osteopetrosis 2", "description": "Any autosomal recessive malignant osteopetrosis in which the cause of the disease is a mutation in the TNFSF11 gene." }, { "id": "MONDO:0009816", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009816", "name": "OPTB2", "description": "" }, { "id": "MONDO:0009816", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009816", "name": "TNFSF11 autosomal recessive malignant osteopetrosis", "description": "" }, { "id": "MONDO:0009816", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009816", "name": "TNFSF11 autosomal recessive osteopetrosis", "description": "" }, { "id": "MONDO:0009816", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009816", "name": "autosomal recessive malignant osteopetrosis caused by mutation in TNFSF11", "description": "" }, { "id": "MONDO:0009816", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009816", "name": "autosomal recessive osteopetrosis caused by mutation in TNFSF11", "description": "" }, { "id": "MONDO:0009816", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009816", "name": "autosomal recessive osteopetrosis type 2", "description": "" }, { "id": "MONDO:0009816", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009816", "name": "mild autosomal recessive form osteopetrosis", "description": "" }, { "id": "MONDO:0009816", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009816", "name": "osteoclast-poor osteopetrosis", "description": "" }, { "id": "MONDO:0009816", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009816", "name": "osteopetrosis, autosomal recessive type 2", "description": "" }, { "id": "MONDO:0009816", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009816", "name": "osteopetrosis autosomal recessive 2", "description": "" }, { "id": "MONDO:0009816", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009816", "name": "osteopetrosis osteoclast-poor", "description": "" }, { "id": "MONDO:0009816", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009816", "name": "osteopetrosis, autosomal recessive 2", "description": "" }, { "id": "MONDO:0009816", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009816", "name": "osteopetrosis, mild autosomal recessive form", "description": "" }, { "id": "MONDO:0009816", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0009816", "name": "osteopetrosis, osteoclast-poor", "description": "" }, { "id": "MIM:259710", "resource": "MIM", "url": "https://www.omim.org/entry/259710", "name": "Osteopetrosis, autosomal recessive 2", "description": "Osteopetrosis, autosomal recessive 2" } ], "evidence": [ { "id": "259710", "database": "MIM", "url": "https://www.omim.org/entry/259710" } ] } ], "snv": [ { "evidence": [ { "id": "O14788", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O14788" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 101, "end_pos": 101, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "D", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (DTT->NTT).", "chr_id": "13", "chr_pos": "42600969", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "D101", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1213878506", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1213878506" }, { "id": "rs1213878506", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1213878506#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 198, "end_pos": 198, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NMT->SMT).", "chr_id": "13", "chr_pos": "42606557", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N198", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1450207753", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1450207753" }, { "id": "rs1450207753", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1450207753" }, { "id": "rs1450207753", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1450207753#frequency_tab" }, { "id": "rs1450207753", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1450207753" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 296, "end_pos": 296, "sequence_org": "P", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NPS->NSS).", "chr_id": "13", "chr_pos": "42606850", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P296", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [ { "start_pos": 223, "end_pos": 223, "sequence_org": "R", "sequence_mut": "A", "comment": "Reduces affinity for TNFRSF11B.", "evidence": [ { "database": "UniProtKB", "id": "O14788", "url": "https://www.uniprot.org/uniprot/O14788" }, { "database": "PubMed", "id": "22664871", "url": "https://glygen.org/publication/PubMed/22664871" } ] }, { "start_pos": 257, "end_pos": 257, "sequence_org": "K", "sequence_mut": "A", "comment": "Reduces affinity for TNFRSF11B.", "evidence": [ { "database": "UniProtKB", "id": "O14788", "url": "https://www.uniprot.org/uniprot/O14788" }, { "database": "PubMed", "id": "22664871", "url": "https://glygen.org/publication/PubMed/22664871" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "45.91", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000120659", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000120659" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "45.68", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000120659", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000120659" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "44.32", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000120659", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000120659" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "49.96", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000120659", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000120659" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "52.88", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000120659", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000120659" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "72.43", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000120659", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000120659" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "47.76", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000120659", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000120659" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "37.05", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000120659", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000120659" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "34.47", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000120659", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000120659" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "47.6", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000120659", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000120659" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "55.43", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000120659", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000120659" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "39.01", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000120659", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000120659" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "44.97", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000120659", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000120659" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O14788", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14788" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O14788", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14788" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O14788", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14788" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O14788", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14788" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O14788", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14788" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O14788", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14788" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O14788", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14788" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O14788", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14788" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O14788", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14788" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O14788", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14788" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O14788", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14788" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O14788", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14788" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O14788", "url": "https://www.uniprot.org/uniprot/O14788" } ], "common_name": "Human" } ], "gene": [ { "name": "TNFSF11", "url": "https://www.uniprot.org/uniprot/O14788", "locus": { "chromosome": "13", "start_pos": 42608013, "end_pos": 42562736, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000120659", "url": "https://www.ensembl.org/id/ENSG00000120659" } ] } } ], "crossref": [ { "id": "ENSG00000120659", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000120659", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "O14788", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O14788", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd00184", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00184", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL2364162", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL2364162", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "TNFSF11", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=TNFSF11", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "8600", "url": "https://www.ncbi.nlm.nih.gov/gene/8600", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "11926", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=11926", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O14788", "url": "https://www.ebi.ac.uk/intact/interactors/id:O14788*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR006052", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006052", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008983", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008983", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017355", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017355", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:8600", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:8600", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "259710", "url": "http://www.omim.org/entry/259710", "database": "MIM", "categories": [ "Other" ] }, { "id": "602642", "url": "http://www.omim.org/entry/602642", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O14788", "url": "https://www.nextprot.org/entry/NX_O14788", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "RAQMDPT", "url": "https://omabrowser.org/oma/group/RAQMDPT/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5305009at2759", "url": "http://www.orthodb.org/?query=5305009at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR11471", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11471", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR11471:SF3", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR11471:SF3", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "3URF", "url": "https://www.rcsb.org/structure/3URF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5BNQ", "url": "https://www.rcsb.org/structure/5BNQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00229", "url": "http://pfam.xfam.org/family/PF00229", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O14788", "url": "https://pharos.nih.gov/targets/O14788", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O14788", "url": "http://purl.obolibrary.org/obo/PR_O14788", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-5668541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668541", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5669034", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5669034", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5676594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5676594", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_003692", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003692", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "O14788", "url": "https://www.uniprot.org/uniprot/O14788", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O14788-1", "url": "https://www.uniprot.org/uniprot/O14788-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O14788-2", "url": "https://www.uniprot.org/uniprot/O14788-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O14788-3", "url": "https://www.uniprot.org/uniprot/O14788-3", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MRRASRDYTKYLRGSEEMGGGPGAPHEGPLHAPPPPAPHQPPAASRSMFVALLGLGLGQVVCSVALFFYFRAQMDPNRISEDGTHCIYRILRLHENADFQDTTLESQDTKLIPDSCRRIKQAFQGAVQKELQHIVGSQHIRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID", "length": 317, "header": "sp|O14788-1|TNF11_HUMAN Isoform 1 of Tumor necrosis factor ligand superfamily member 11 OS=Homo sapiens OX=9606 GN=TNFSF11 PE=1 SV=1 CANONICAL=O14788-1" }, "isoforms": [ { "isoform_ac": "O14788-1", "url": "", "sequence": { "sequence": "MRRASRDYTKYLRGSEEMGGGPGAPHEGPLHAPPPPAPHQPPAASRSMFVALLGLGLGQVVCSVALFFYFRAQMDPNRISEDGTHCIYRILRLHENADFQDTTLESQDTKLIPDSCRRIKQAFQGAVQKELQHIVGSQHIRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID", "length": 317, "header": "sp|O14788-1|TNF11_HUMAN Isoform 1 of Tumor necrosis factor ligand superfamily member 11 OS=Homo sapiens OX=9606 GN=TNFSF11 PE=1 SV=1 CANONICAL=O14788-1" }, "locus": { "chromosome": "13", "start_pos": 42606915, "end_pos": 42574304, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000398795.7", "url": "https://www.ensembl.org/id/ENST00000398795.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000381775.3", "url": "https://www.ensembl.org/id/ENSP00000381775.3" } ] } }, { "isoform_ac": "O14788-2", "url": "", "sequence": { "sequence": "MDPNRISEDGTHCIYRILRLHENADFQDTTLESQDTKLIPDSCRRIKQAFQGAVQKELQHIVGSQHIRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID", "length": 244, "header": "sp|O14788-2|TNF11_HUMAN Isoform 2 of Tumor necrosis factor ligand superfamily member 11 OS=Homo sapiens OX=9606 GN=TNFSF11 PE=1 SV=1 CANONICAL=O14788-1" }, "locus": { "chromosome": "13", "start_pos": 42606915, "end_pos": 42581126, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000358545.6", "url": "https://www.ensembl.org/id/ENST00000358545.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000351347.2", "url": "https://www.ensembl.org/id/ENSP00000351347.2" } ] } }, { "isoform_ac": "O14788-3", "url": "", "sequence": { "sequence": "MFVALLGLGLGQVVCSVALFFYFRAQMDPNRISEDGTHCIYRILRLHENADFQDTTLESQDTKLIPDSCRRIKQAFQGAVQKELQHIVGSQHIRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID", "length": 270, "header": "sp|O14788-3|TNF11_HUMAN Isoform 3 of Tumor necrosis factor ligand superfamily member 11 OS=Homo sapiens OX=9606 GN=TNFSF11 PE=1 SV=1 CANONICAL=O14788-1" }, "locus": {} } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 171, "start_aa": "Asn", "end_pos": 171, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn171", "evidence": [ { "id": "O14788", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14788#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 198, "start_aa": "Asn", "end_pos": 198, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn198", "evidence": [ { "id": "O14788", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14788#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "Identification of a new member of the tumor necrosis factor family and its receptor, a human ortholog of mouse GITR.", "journal": "Current biology : CB", "date": "1999", "authors": "Gurney AL, Marsters SA, Huang RM, Pitti RM, Mark DT, Baldwin DT, Gray AM, Dowd AD, Brush AD, Heldens AD, Schow AD, Goddard AD, Wood WI, Baker KP, Godowski PJ, Ashkenazi A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5669034", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5669034" } ], "reference": [ { "type": "PubMed", "id": "10074428", "url": "https://glygen.org/publication/PubMed/10074428" } ] }, { "title": "TWEAK induces angiogenesis and proliferation of endothelial cells.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Lynch CN, Wang YC, Lund JK, Chen YW, Leal JA, Wiley SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5676594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5676594" } ], "reference": [ { "type": "PubMed", "id": "10085077", "url": "https://glygen.org/publication/PubMed/10085077" } ] }, { "title": "BAFF, a novel ligand of the tumor necrosis factor family, stimulates B cell growth.", "journal": "The Journal of experimental medicine", "date": "1999", "authors": "Schneider P, MacKay F, Steiner V, Hofmann K, Bodmer JL, Holler N, Ambrose C, Lawton P, Bixler S, Acha-Orbea H, Valmori D, Romero P, Werner-Favre C, Zubler RH, Browning JL, Tschopp J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5676594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5676594" } ], "reference": [ { "type": "PubMed", "id": "10359578", "url": "https://glygen.org/publication/PubMed/10359578" } ] }, { "title": "BLyS: member of the tumor necrosis factor family and B lymphocyte stimulator.", "journal": "Science (New York, N.Y.)", "date": "1999", "authors": "Moore PA, Belvedere O, Orr A, Pieri K, LaFleur DW, Feng P, Soppet D, Charters M, Gentz R, Parmelee D, Li Y, Galperina O, Giri J, Roschke V, Nardelli B, Carrell J, Sosnovtseva S, Greenfield W, Ruben SM, Olsen HS, Fikes J, Hilbert DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5669034", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5669034" } ], "reference": [ { "type": "PubMed", "id": "10398604", "url": "https://glygen.org/publication/PubMed/10398604" } ] }, { "title": "Ectodysplasin is a collagenous trimeric type II membrane protein with a tumor necrosis factor-like domain and co-localizes with cytoskeletal structures at lateral and apical surfaces of cells.", "journal": "Human molecular genetics", "date": "1999", "authors": "Ezer S, Bayes M, Elomaa O, Schlessinger D, Kere J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5669034", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5669034" } ], "reference": [ { "type": "PubMed", "id": "10484778", "url": "https://glygen.org/publication/PubMed/10484778" } ] }, { "title": "VEGI, a new member of the TNF family activates nuclear factor-kappa B and c-Jun N-terminal kinase and modulates cell growth.", "journal": "Oncogene", "date": "1999", "authors": "Haridas V, Shrivastava A, Su J, Yu GL, Ni J, Liu D, Chen SF, Ni Y, Ruben SM, Gentz R, Aggarwal BB", "evidence": [ { "database": "Reactome", "id": "R-HSA-5669034", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5669034" } ], "reference": [ { "type": "PubMed", "id": "10597252", "url": "https://glygen.org/publication/PubMed/10597252" } ] }, { "title": "Mutations in TNFRSF11A, affecting the signal peptide of RANK, cause familial expansile osteolysis.", "journal": "Nature genetics", "date": "2000", "authors": "Hughes AE, Ralston SH, Marken J, Bell C, MacPherson H, Wallace RG, van Hul W, Whyte MP, Nakatsuka K, Hovy L, Anderson DM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5669034", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5669034" } ], "reference": [ { "type": "PubMed", "id": "10615125", "url": "https://glygen.org/publication/PubMed/10615125" } ] }, { "title": "Cancer cells responsible for humoral hypercalcemia express mRNA encoding a secreted form of ODF/TRANCE that induces osteoclast formation.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2000", "authors": "Nagai M, Kyakumoto S, Sato N", "evidence": [ { "database": "UniProtKB", "id": "O14788", "url": "https://www.uniprot.org/uniprot/O14788" } ], "reference": [ { "type": "PubMed", "id": "10708588", "url": "https://glygen.org/publication/PubMed/10708588" } ] }, { "title": "Ubiquitin protein ligase activity of IAPs and their degradation in proteasomes in response to apoptotic stimuli.", "journal": "Science (New York, N.Y.)", "date": "2000", "authors": "Yang Y, Fang S, Jensen JP, Weissman AM, Ashwell JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668541" } ], "reference": [ { "type": "PubMed", "id": "10797013", "url": "https://glygen.org/publication/PubMed/10797013" } ] }, { "title": "Biologically active APRIL is secreted following intracellular processing in the Golgi apparatus by furin convertase.", "journal": "EMBO reports", "date": "2001", "authors": "Lopez-Fraga M, Fernandez R, Albar JP, Hahne M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5669034", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5669034" } ], "reference": [ { "type": "PubMed", "id": "11571266", "url": "https://glygen.org/publication/PubMed/11571266" } ] }, { "title": "A novel TNF receptor family member binds TWEAK and is implicated in angiogenesis.", "journal": "Immunity", "date": "2001", "authors": "Wiley SR, Cassiano L, Lofton T, Davis-Smith T, Winkles JA, Lindner V, Liu H, Daniel TO, Smith CA, Fanslow WC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5676594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5676594" } ], "reference": [ { "type": "PubMed", "id": "11728344", "url": "https://glygen.org/publication/PubMed/11728344" } ] }, { "title": "Crystal structure of sTALL-1 reveals a virus-like assembly of TNF family ligands.", "journal": "Cell", "date": "2002", "authors": "Liu Y, Xu L, Opalka N, Kappler J, Shu HB, Zhang G", "evidence": [ { "database": "Reactome", "id": "R-HSA-5676594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5676594" } ], "reference": [ { "type": "PubMed", "id": "11853672", "url": "https://glygen.org/publication/PubMed/11853672" } ] }, { "title": "Identification of a novel death domain-containing adaptor molecule for ectodysplasin-A receptor that is mutated in crinkled mice.", "journal": "Current biology : CB", "date": "2002", "authors": "Yan M, Zhang Z, Brady JR, Schilbach S, Fairbrother WJ, Dixit VM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5669034", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5669034" } ], "reference": [ { "type": "PubMed", "id": "11882293", "url": "https://glygen.org/publication/PubMed/11882293" } ] }, { "title": "TL1A is a TNF-like ligand for DR3 and TR6/DcR3 and functions as a T cell costimulator.", "journal": "Immunity", "date": "2002", "authors": "Migone TS, Zhang J, Luo X, Zhuang L, Chen C, Hu B, Hong JS, Perry JW, Chen SF, Zhou JX, Cho YH, Ullrich S, Kanakaraj P, Carrell J, Boyd E, Olsen HS, Hu G, Pukac L, Liu D, Ni J, Kim S, Gentz R, Feng P, Moore PA, Ruben SM, Wei P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5669034", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5669034" } ], "reference": [ { "type": "PubMed", "id": "11911831", "url": "https://glygen.org/publication/PubMed/11911831" } ] }, { "title": "A mutation in the gene TNFRSF11B encoding osteoprotegerin causes an idiopathic hyperphosphatasia phenotype.", "journal": "Human molecular genetics", "date": "2002", "authors": "Cundy T, Hegde M, Naot D, Chong B, King A, Wallace R, Mulley J, Love DR, Seidel J, Fawkner M, Banovic T, Callon KE, Grey AB, Reid IR, Middleton-Hardie CA, Cornish J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5669034", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5669034" } ], "reference": [ { "type": "PubMed", "id": "12189164", "url": "https://glygen.org/publication/PubMed/12189164" } ] }, { "title": "CD40 regulates the processing of NF-kappaB2 p100 to p52.", "journal": "The EMBO journal", "date": "2002", "authors": "Coope HJ, Atkinson PG, Huhse B, Belich M, Janzen J, Holman MJ, Klaus GG, Johnston LH, Ley SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5676594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5676594" } ], "reference": [ { "type": "PubMed", "id": "12374738", "url": "https://glygen.org/publication/PubMed/12374738" } ] }, { "title": "The Fn14 cytoplasmic tail binds tumour-necrosis-factor-receptor-associated factors 1, 2, 3 and 5 and mediates nuclear factor-kappaB activation.", "journal": "The Biochemical journal", "date": "2003", "authors": "Brown SA, Richards CM, Hanscom HN, Feng SL, Winkles JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5676594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5676594" } ], "reference": [ { "type": "PubMed", "id": "12529173", "url": "https://glygen.org/publication/PubMed/12529173" } ] }, { "title": "Endogenous association of TRAF2, TRAF3, cIAP1, and Smac with lymphotoxin beta receptor reveals a novel mechanism of apoptosis.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Kuai J, Nickbarg E, Wooters J, Qiu Y, Wang J, Lin LL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5676594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5676594" } ], "reference": [ { "type": "PubMed", "id": "12571250", "url": "https://glygen.org/publication/PubMed/12571250" } ] }, { "title": "Ligand-receptor binding revealed by the TNF family member TALL-1.", "journal": "Nature", "date": "2003", "authors": "Liu Y, Hong X, Kappler J, Jiang L, Zhang R, Xu L, Pan CH, Martin WE, Murphy RC, Shu HB, Dai S, Zhang G", "evidence": [ { "database": "Reactome", "id": "R-HSA-5676594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5676594" } ], "reference": [ { "type": "PubMed", "id": "12721620", "url": "https://glygen.org/publication/PubMed/12721620" } ] }, { "title": "TWEAK, a member of the TNF superfamily, is a multifunctional cytokine that binds the TweakR/Fn14 receptor.", "journal": "Cytokine & growth factor reviews", "date": "2003", "authors": "Wiley SR, Winkles JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5676594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5676594" } ], "reference": [ { "type": "PubMed", "id": "12787562", "url": "https://glygen.org/publication/PubMed/12787562" } ] }, { "title": "Signalling pathways of the TNF superfamily: a double-edged sword.", "journal": "Nature reviews. Immunology", "date": "2003", "authors": "Aggarwal BB", "evidence": [ { "database": "Reactome", "id": "R-HSA-5669034", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5669034" } ], "reference": [ { "type": "PubMed", "id": "12949498", "url": "https://glygen.org/publication/PubMed/12949498" } ] }, { "title": "The crystal structures of EDA-A1 and EDA-A2: splice variants with distinct receptor specificity.", "journal": "Structure (London, England : 1993)", "date": "2003", "authors": "Hymowitz SG, Compaan DM, Yan M, Wallweber HJ, Dixit VM, Starovasnik MA, de Vos AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5669034", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5669034" } ], "reference": [ { "type": "PubMed", "id": "14656435", "url": "https://glygen.org/publication/PubMed/14656435" } ] }, { "title": "Regulation of the NF-kappaB-inducing kinase by tumor necrosis factor receptor-associated factor 3-induced degradation.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Liao G, Zhang M, Harhaj EW, Sun SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668541" } ], "reference": [ { "type": "PubMed", "id": "15084608", "url": "https://glygen.org/publication/PubMed/15084608" } ] }, { "title": "Cross-talk between activated human NK cells and CD4+ T cells via OX40-OX40 ligand interactions.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2004", "authors": "Zingoni A, Sornasse T, Cocks BG, Tanaka Y, Santoni A, Lanier LL", "evidence": [ { "database": "Reactome", "id": "R-HSA-5669034", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5669034" } ], "reference": [ { "type": "PubMed", "id": "15356117", "url": "https://glygen.org/publication/PubMed/15356117" } ] }, { "title": "BAFF binding to T cell-expressed BAFF-R costimulates T cell proliferation and alloresponses.", "journal": "European journal of immunology", "date": "2004", "authors": "Ye Q, Wang L, Wells AD, Tao R, Han R, Davidson A, Scott ML, Hancock WW", "evidence": [ { "database": "Reactome", "id": "R-HSA-5676594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5676594" } ], "reference": [ { "type": "PubMed", "id": "15368291", "url": "https://glygen.org/publication/PubMed/15368291" } ] }, { "title": "T cell proliferation by direct cross-talk between OX40 ligand on human mast cells and OX40 on human T cells: comparison of gene expression profiles between human tonsillar and lung-cultured mast cells.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2004", "authors": "Kashiwakura J, Yokoi H, Saito H, Okayama Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5669034", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5669034" } ], "reference": [ { "type": "PubMed", "id": "15470070", "url": "https://glygen.org/publication/PubMed/15470070" } ] }, { "title": "Key molecular contacts promote recognition of the BAFF receptor by TNF receptor-associated factor 3: implications for intracellular signaling regulation.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2004", "authors": "Ni CZ, Oganesyan G, Welsh K, Zhu X, Reed JC, Satterthwait AC, Cheng G, Ely KR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5676594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5676594" } ], "reference": [ { "type": "PubMed", "id": "15585864", "url": "https://glygen.org/publication/PubMed/15585864" } ] }, { "title": "An atypical tumor necrosis factor (TNF) receptor-associated factor-binding motif of B cell-activating factor belonging to the TNF family (BAFF) receptor mediates induction of the noncanonical NF-kappaB signaling pathway.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Morrison MD, Reiley W, Zhang M, Sun SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5676594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5676594" } ], "reference": [ { "type": "PubMed", "id": "15644327", "url": "https://glygen.org/publication/PubMed/15644327" } ] }, { "title": "TRAF2 is essential for TNF-alpha-induced osteoclastogenesis.", "journal": "Journal of bone and mineral research : the official journal of the American Society for Bone and Mineral Research", "date": "2005", "authors": "Kanazawa K, Kudo A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5676594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5676594" } ], "reference": [ { "type": "PubMed", "id": "15824857", "url": "https://glygen.org/publication/PubMed/15824857" } ] }, { "title": "Signals from OX40 regulate nuclear factor of activated T cells c1 and T cell helper 2 lineage commitment.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "So T, Song J, Sugie K, Altman A, Croft M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5669034", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5669034" } ], "reference": [ { "type": "PubMed", "id": "16501042", "url": "https://glygen.org/publication/PubMed/16501042" } ] }, { "title": "The T cell activation antigen CD27 is a member of the nerve growth factor/tumor necrosis factor receptor gene family.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1991", "authors": "Camerini D, Walz G, Loenen WA, Borst J, Seed B", "evidence": [ { "database": "Reactome", "id": "R-HSA-5669034", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5669034" } ], "reference": [ { "type": "PubMed", "id": "1655907", "url": "https://glygen.org/publication/PubMed/1655907" } ] }, { "title": "Osteoclast-poor human osteopetrosis due to mutations in the gene encoding RANKL.", "journal": "Nature genetics", "date": "2007", "authors": "Sobacchi C, Frattini A, Guerrini MM, Abinun M, Pangrazio A, Susani L, Bredius R, Mancini G, Cant A, Bishop N, Grabowski P, Del Fattore A, Messina C, Errigo G, Coxon FP, Scott DI, Teti A, Rogers MJ, Vezzoni P, Villa A, Helfrich MH", "evidence": [ { "database": "UniProtKB", "id": "O14788", "url": "https://www.uniprot.org/uniprot/O14788" }, { "database": "Reactome", "id": "R-HSA-5669034", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5669034" } ], "reference": [ { "type": "PubMed", "id": "17632511", "url": "https://glygen.org/publication/PubMed/17632511" } ] }, { "title": "Mechanism of action of certolizumab pegol (CDP870): in vitro comparison with other anti-tumor necrosis factor alpha agents.", "journal": "Inflammatory bowel diseases", "date": "2007", "authors": "Nesbitt A, Fossati G, Bergin M, Stephens P, Stephens S, Foulkes R, Brown D, Robinson M, Bourne T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668541" } ], "reference": [ { "type": "PubMed", "id": "17636564", "url": "https://glygen.org/publication/PubMed/17636564" } ] }, { "title": "The TNF-family receptor DR3 is essential for diverse T cell-mediated inflammatory diseases.", "journal": "Immunity", "date": "2008", "authors": "Meylan F, Davidson TS, Kahle E, Kinder M, Acharya K, Jankovic D, Bundoc V, Hodges M, Shevach EM, Keane-Myers A, Wang EC, Siegel RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5669034", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5669034" } ], "reference": [ { "type": "PubMed", "id": "18571443", "url": "https://glygen.org/publication/PubMed/18571443" } ] }, { "title": "Human osteoclast-poor osteopetrosis with hypogammaglobulinemia due to TNFRSF11A (RANK) mutations.", "journal": "American journal of human genetics", "date": "2008", "authors": "Guerrini MM, Sobacchi C, Cassani B, Abinun M, Kilic SS, Pangrazio A, Moratto D, Mazzolari E, Clayton-Smith J, Orchard P, Coxon FP, Helfrich MH, Crockett JC, Mellis D, Vellodi A, Tezcan I, Notarangelo LD, Rogers MJ, Vezzoni P, Villa A, Frattini A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5669034", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5669034" } ], "reference": [ { "type": "PubMed", "id": "18606301", "url": "https://glygen.org/publication/PubMed/18606301" } ] }, { "title": "Essential cytoplasmic translocation of a cytokine receptor-assembled signaling complex.", "journal": "Science (New York, N.Y.)", "date": "2008", "authors": "Matsuzawa A, Tseng PH, Vallabhapurapu S, Luo JL, Zhang W, Wang H, Vignali DA, Gallagher E, Karin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668541" } ], "reference": [ { "type": "PubMed", "id": "18635759", "url": "https://glygen.org/publication/PubMed/18635759" } ] }, { "title": "Nonredundant and complementary functions of TRAF2 and TRAF3 in a ubiquitination cascade that activates NIK-dependent alternative NF-kappaB signaling.", "journal": "Nature immunology", "date": "2008", "authors": "Vallabhapurapu S, Matsuzawa A, Zhang W, Tseng PH, Keats JJ, Wang H, Vignali DA, Bergsagel PL, Karin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668541" } ], "reference": [ { "type": "PubMed", "id": "18997792", "url": "https://glygen.org/publication/PubMed/18997792" } ] }, { "title": "Noncanonical NF-kappaB activation requires coordinated assembly of a regulatory complex of the adaptors cIAP1, cIAP2, TRAF2 and TRAF3 and the kinase NIK.", "journal": "Nature immunology", "date": "2008", "authors": "Zarnegar BJ, Wang Y, Mahoney DJ, Dempsey PW, Cheung HH, He J, Shiba T, Yang X, Yeh WC, Mak TW, Korneluk RG, Cheng G", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668541" } ], "reference": [ { "type": "PubMed", "id": "18997794", "url": "https://glygen.org/publication/PubMed/18997794" } ] }, { "title": "Solution structure of the cysteine-rich domain in Fn14, a member of the tumor necrosis factor receptor superfamily.", "journal": "Protein science : a publication of the Protein Society", "date": "2009", "authors": "He F, Dang W, Saito K, Watanabe S, Kobayashi N, Guntert P, Kigawa T, Tanaka A, Muto Y, Yokoyama S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5676594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5676594" } ], "reference": [ { "type": "PubMed", "id": "19241374", "url": "https://glygen.org/publication/PubMed/19241374" } ] }, { "title": "Molecular mechanism and function of CD40/CD40L engagement in the immune system.", "journal": "Immunological reviews", "date": "2009", "authors": "Elgueta R, Benson MJ, de Vries VC, Wasiuk A, Guo Y, Noelle RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5676594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5676594" } ], "reference": [ { "type": "PubMed", "id": "19426221", "url": "https://glygen.org/publication/PubMed/19426221" } ] }, { "title": "TRAF2 must bind to cellular inhibitors of apoptosis for tumor necrosis factor (tnf) to efficiently activate nf-{kappa}b and to prevent tnf-induced apoptosis.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Vince JE, Pantaki D, Feltham R, Mace PD, Cordier SM, Schmukle AC, Davidson AJ, Callus BA, Wong WW, Gentle IE, Carter H, Lee EF, Walczak H, Day CL, Vaux DL, Silke J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668541" } ], "reference": [ { "type": "PubMed", "id": "19815541", "url": "https://glygen.org/publication/PubMed/19815541" } ] }, { "title": "The structure of the trimer of human 4-1BB ligand is unique among members of the tumor necrosis factor superfamily.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Won EY, Cha K, Byun JS, Kim DU, Shin S, Ahn B, Kim YH, Rice AJ, Walz T, Kwon BS, Cho HS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5669034", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5669034" } ], "reference": [ { "type": "PubMed", "id": "20032458", "url": "https://glygen.org/publication/PubMed/20032458" } ] }, { "title": "Mutations in EDARADD account for a small proportion of hypohidrotic ectodermal dysplasia cases.", "journal": "The British journal of dermatology", "date": "2010", "authors": "Chassaing N, Cluzeau C, Bal E, Guigue P, Vincent MC, Viot G, Ginisty D, Munnich A, Smahi A, Calvas P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5669034", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5669034" } ], "reference": [ { "type": "PubMed", "id": "20222921", "url": "https://glygen.org/publication/PubMed/20222921" } ] }, { "title": "Control of immunity by the TNFR-related molecule OX40 (CD134).", "journal": "Annual review of immunology", "date": "2010", "authors": "Croft M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5669034", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5669034" } ], "reference": [ { "type": "PubMed", "id": "20307208", "url": "https://glygen.org/publication/PubMed/20307208" } ] }, { "title": "Full-length, membrane-anchored TWEAK can function as a juxtacrine signaling molecule and activate the NF-kappaB pathway.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Brown SA, Ghosh A, Winkles JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5676594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5676594" } ], "reference": [ { "type": "PubMed", "id": "20385556", "url": "https://glygen.org/publication/PubMed/20385556" } ] }, { "title": "Structural and functional insights of RANKL-RANK interaction and signaling.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2010", "authors": "Liu C, Walter TS, Huang P, Zhang S, Zhu X, Wu Y, Wedderburn LR, Tang P, Owens RJ, Stuart DI, Ren J, Gao B", "evidence": [ { "database": "Reactome", "id": "R-HSA-5676594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5676594" } ], "reference": [ { "type": "PubMed", "id": "20483727", "url": "https://glygen.org/publication/PubMed/20483727" } ] }, { "title": "OX40-OX40 ligand interaction in T-cell-mediated immunity and immunopathology.", "journal": "Advances in immunology", "date": "2010", "authors": "Ishii N, Takahashi T, Soroosh P, Sugamura K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5669034", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5669034" } ], "reference": [ { "type": "PubMed", "id": "20510730", "url": "https://glygen.org/publication/PubMed/20510730" } ] }, { "title": "Only four genes (EDA1, EDAR, EDARADD, and WNT10A) account for 90% of hypohidrotic/anhidrotic ectodermal dysplasia cases.", "journal": "Human mutation", "date": "2011", "authors": "Cluzeau C, Hadj-Rabia S, Jambou M, Mansour S, Guigue P, Masmoudi S, Bal E, Chassaing N, Vincent MC, Viot G, Clauss F, Maniere MC, Toupenay S, Le Merrer M, Lyonnet S, Cormier-Daire V, Amiel J, Faivre L, de Prost Y, Munnich A, Bonnefont JP, Bodemer C, Smahi A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5669034", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5669034" } ], "reference": [ { "type": "PubMed", "id": "20979233", "url": "https://glygen.org/publication/PubMed/20979233" } ] }, { "title": "Solution of the structure of the TNF-TNFR2 complex.", "journal": "Science signaling", "date": "2010", "authors": "Mukai Y, Nakamura T, Yoshikawa M, Yoshioka Y, Tsunoda S, Nakagawa S, Yamagata Y, Tsutsumi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668541" } ], "reference": [ { "type": "PubMed", "id": "21081755", "url": "https://glygen.org/publication/PubMed/21081755" } ] }, { "title": "Anti-TNF-alpha agents in the treatment of immune-mediated inflammatory diseases: mechanisms of action and pitfalls.", "journal": "Immunotherapy", "date": "2010", "authors": "Silva LC, Ortigosa LC, Benard G", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668541" } ], "reference": [ { "type": "PubMed", "id": "21091114", "url": "https://glygen.org/publication/PubMed/21091114" } ] }, { "title": "Decoy strategies: the structure of TL1A:DcR3 complex.", "journal": "Structure (London, England : 1993)", "date": "2011", "authors": "Zhan C, Patskovsky Y, Yan Q, Li Z, Ramagopal U, Cheng H, Brenowitz M, Hui X, Nathenson SG, Almo SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5669034", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5669034" } ], "reference": [ { "type": "PubMed", "id": "21300286", "url": "https://glygen.org/publication/PubMed/21300286" } ] }, { "title": "CD27 deficiency is associated with combined immunodeficiency and persistent symptomatic EBV viremia.", "journal": "The Journal of allergy and clinical immunology", "date": "2012", "authors": "van Montfrans JM, Hoepelman AI, Otto S, van Gijn M, van de Corput L, de Weger RA, Monaco-Shawver L, Banerjee PP, Sanders EA, Jol-van der Zijde CM, Betts MR, Orange JS, Bloem AC, Tesselaar K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5669034", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5669034" } ], "reference": [ { "type": "PubMed", "id": "22197273", "url": "https://glygen.org/publication/PubMed/22197273" } ] }, { "title": "Crystal structure of human RANKL complexed with its decoy receptor osteoprotegerin.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "2012", "authors": "Luan X, Lu Q, Jiang Y, Zhang S, Wang Q, Yuan H, Zhao W, Wang J, Wang X", "evidence": [ { "database": "UniProtKB", "id": "O14788", "url": "https://www.uniprot.org/uniprot/O14788" }, { "database": "Reactome", "id": "R-HSA-5669034", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5669034" } ], "reference": [ { "type": "PubMed", "id": "22664871", "url": "https://glygen.org/publication/PubMed/22664871" } ] }, { "title": "Combined immunodeficiency with life-threatening EBV-associated lymphoproliferative disorder in patients lacking functional CD27.", "journal": "Haematologica", "date": "2013", "authors": "Salzer E, Daschkey S, Choo S, Gombert M, Santos-Valente E, Ginzel S, Schwendinger M, Haas OA, Fritsch G, Pickl WF, Forster-Waldl E, Borkhardt A, Boztug K, Bienemann K, Seidel MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-5669034", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5669034" } ], "reference": [ { "type": "PubMed", "id": "22801960", "url": "https://glygen.org/publication/PubMed/22801960" } ] }, { "title": "Crystal structure of human TWEAK in complex with the Fab fragment of a neutralizing antibody reveals insights into receptor binding.", "journal": "PloS one", "date": "2013", "authors": "Lammens A, Baehner M, Kohnert U, Niewoehner J, von Proff L, Schraeml M, Lammens K, Hopfner KP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5676594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5676594" } ], "reference": [ { "type": "PubMed", "id": "23667509", "url": "https://glygen.org/publication/PubMed/23667509" } ] }, { "title": "The ectodysplasin pathway: from diseases to adaptations.", "journal": "Trends in genetics : TIG", "date": "2014", "authors": "Sadier A, Viriot L, Pantalacci S, Laudet V", "evidence": [ { "database": "Reactome", "id": "R-HSA-5669034", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5669034" } ], "reference": [ { "type": "PubMed", "id": "24070496", "url": "https://glygen.org/publication/PubMed/24070496" } ] }, { "title": "Dimerization of LTbetaR by LTalpha1beta2 is necessary and sufficient for signal transduction.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2013", "authors": "Sudhamsu J, Yin J, Chiang EY, Starovasnik MA, Grogan JL, Hymowitz SG", "evidence": [ { "database": "Reactome", "id": "R-HSA-5676594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5676594" } ], "reference": [ { "type": "PubMed", "id": "24248355", "url": "https://glygen.org/publication/PubMed/24248355" } ] }, { "title": "CD40-Mediated Activation of the NF-kappaB2 Pathway.", "journal": "Frontiers in immunology", "date": "2013", "authors": "Hostager BS, Bishop GA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5676594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5676594" } ], "reference": [ { "type": "PubMed", "id": "24298274", "url": "https://glygen.org/publication/PubMed/24298274" } ] }, { "title": "Non-Canonical NF-kappaB Signaling Initiated by BAFF Influences B Cell Biology at Multiple Junctures.", "journal": "Frontiers in immunology", "date": "2014", "authors": "Gardam S, Brink R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5676594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5676594" } ], "reference": [ { "type": "PubMed", "id": "24432023", "url": "https://glygen.org/publication/PubMed/24432023" } ] }, { "title": "TRAF-mediated modulation of NF-kB AND JNK activation by TNFR2.", "journal": "Cellular signalling", "date": "2014", "authors": "Cabal-Hierro L, Rodriguez M, Artime N, Iglesias J, Ugarte L, Prado MA, Lazo PS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668541" } ], "reference": [ { "type": "PubMed", "id": "25152365", "url": "https://glygen.org/publication/PubMed/25152365" } ] }, { "title": "MiR-217 regulates autophagy through OPG/RANKL/RANK in giant cell tumors.", "journal": "Journal of orthopaedic surgery and research", "date": "2023-05-10", "authors": "Meng Chenyang, Jiang Boyong, Liu Wanlin, Wang Lianjuan, Zhao Zhenqun, Bai Rui, Zhao Yan", "evidence": [ { "database": "RefSeq", "id": "NP_003692", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003692" } ], "reference": [ { "type": "PubMed", "id": "37165403", "url": "https://glygen.org/publication/PubMed/37165403" } ] }, { "title": "Effect of Aerobic/Strength Training on RANKL Gene DNA Methylation Levels.", "journal": "Journal of physical activity & health", "date": "2023-10-01", "authors": "Chelly Ameni, Bouzid Amal, Neifar Fadoua, Kammoun Ines, Tekari Adel, Masmoudi Saber, Chtourou Hamdi, Rebai Ahmed", "evidence": [ { "database": "RefSeq", "id": "NP_003692", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003692" } ], "reference": [ { "type": "PubMed", "id": "37295782", "url": "https://glygen.org/publication/PubMed/37295782" } ] }, { "title": "Pulling rank with RNA: RANKL promotes the association of PGC-1\u03b2/RNA complexes with NCoR/HDAC3 to activate gene expression in osteoclasts.", "journal": "Molecular cell", "date": "2023-10-05", "authors": "Torres Haydee M, Yeo Dongwook, Westendorf Jennifer J", "evidence": [ { "database": "RefSeq", "id": "NP_003692", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003692" } ], "reference": [ { "type": "PubMed", "id": "37802020", "url": "https://glygen.org/publication/PubMed/37802020" } ] }, { "title": "RANKL/RANK is required for cytokine-induced beta cell death; osteoprotegerin, a RANKL inhibitor, reverses rodent type 1 diabetes.", "journal": "Science advances", "date": "2023-11-03", "authors": "Kondegowda Nagesha Guthalu, Filipowska Joanna, Do Jeong-Su, Leon-Rivera Nancy, Li Rosemary, Hampton Rollie, Ogyaadu Selassie, Levister Camilla, Penninger Josef M, Reijonen Helena, Levy Carol J, Vasavada Rupangi C", "evidence": [ { "database": "RefSeq", "id": "NP_003692", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003692" } ], "reference": [ { "type": "PubMed", "id": "37910614", "url": "https://glygen.org/publication/PubMed/37910614" } ] }, { "title": "The Notch1 signaling pathway directly modulates the human RANKL-induced osteoclastogenesis.", "journal": "Scientific reports", "date": "2023-12-01", "authors": "Padovano Costanzo, Bianco Salvatore Daniele, Sansico Francesca, De Santis Elisabetta, Tamiro Francesco, Colucci Mattia, Totti Beatrice, Di Iasio Serena, Bruno Gaja, Panelli Patrizio, Miscio Giuseppe, Mazza Tommaso, Giambra Vincenzo", "evidence": [ { "database": "RefSeq", "id": "NP_003692", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003692" } ], "reference": [ { "type": "PubMed", "id": "38040752", "url": "https://glygen.org/publication/PubMed/38040752" } ] }, { "title": "TRAF2-mediated activation of NF-kappa B by TNF receptor 2 and CD40.", "journal": "Science (New York, N.Y.)", "date": "1995", "authors": "Rothe M, Sarma V, Dixit VM, Goeddel DV", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668541" } ], "reference": [ { "type": "PubMed", "id": "7544915", "url": "https://glygen.org/publication/PubMed/7544915" } ] }, { "title": "Association of a RING finger protein with the cytoplasmic domain of the human type-2 tumour necrosis factor receptor.", "journal": "The Biochemical journal", "date": "1995", "authors": "Song HY, Donner DB", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668541" } ], "reference": [ { "type": "PubMed", "id": "7639698", "url": "https://glygen.org/publication/PubMed/7639698" } ] }, { "title": "Identification of a human OX-40 ligand, a costimulator of CD4+ T cells with homology to tumor necrosis factor.", "journal": "The Journal of experimental medicine", "date": "1994", "authors": "Godfrey WR, Fagnoni FF, Harara MA, Buck D, Engleman EG", "evidence": [ { "database": "Reactome", "id": "R-HSA-5669034", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5669034" } ], "reference": [ { "type": "PubMed", "id": "7913952", "url": "https://glygen.org/publication/PubMed/7913952" } ] }, { "title": "The cloning of CD70 and its identification as the ligand for CD27.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1994", "authors": "Bowman MR, Crimmins MA, Yetz-Aldape J, Kriz R, Kelleher K, Herrmann S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5669034", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5669034" } ], "reference": [ { "type": "PubMed", "id": "8120384", "url": "https://glygen.org/publication/PubMed/8120384" } ] }, { "title": "The transmembrane form of tumor necrosis factor is the prime activating ligand of the 80 kDa tumor necrosis factor receptor.", "journal": "Cell", "date": "1995", "authors": "Grell M, Douni E, Wajant H, Lohden M, Clauss M, Maxeiner B, Georgopoulos S, Lesslauer W, Kollias G, Pfizenmaier K, Scheurich P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668541" } ], "reference": [ { "type": "PubMed", "id": "8521496", "url": "https://glygen.org/publication/PubMed/8521496" } ] }, { "title": "TRAF5, an activator of NF-kappaB and putative signal transducer for the lymphotoxin-beta receptor.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Nakano H, Oshima H, Chung W, Williams-Abbott L, Ware CF, Yagita H, Okumura K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5676594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5676594" } ], "reference": [ { "type": "PubMed", "id": "8663299", "url": "https://glygen.org/publication/PubMed/8663299" } ] }, { "title": "Anatomy of TRAF2. Distinct domains for nuclear factor-kappaB activation and association with tumor necrosis factor signaling proteins.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Takeuchi M, Rothe M, Goeddel DV", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668541" } ], "reference": [ { "type": "PubMed", "id": "8702708", "url": "https://glygen.org/publication/PubMed/8702708" } ] }, { "title": "Reverse signaling via CD30 ligand.", "journal": "Journal of immunology (Baltimore, Md. : 1950)", "date": "1996", "authors": "Wiley SR, Goodwin RG, Smith CA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5669034", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5669034" } ], "reference": [ { "type": "PubMed", "id": "8871664", "url": "https://glygen.org/publication/PubMed/8871664" } ] }, { "title": "Lymphotoxin-beta receptor signaling complex: role of tumor necrosis factor receptor-associated factor 3 recruitment in cell death and activation of nuclear factor kappaB.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "VanArsdale TL, VanArsdale SL, Force WR, Walter BN, Mosialos G, Kieff E, Reed JC, Ware CF", "evidence": [ { "database": "Reactome", "id": "R-HSA-5676594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5676594" } ], "reference": [ { "type": "PubMed", "id": "9122217", "url": "https://glygen.org/publication/PubMed/9122217" } ] }, { "title": "Crucial role of tumor necrosis factor (TNF) receptor 2 and membrane-bound TNF in experimental cerebral malaria.", "journal": "European journal of immunology", "date": "1997", "authors": "Lucas R, Juillard P, Decoster E, Redard M, Burger D, Donati Y, Giroud C, Monso-Hinard C, De Kesel T, Buurman WA, Moore MW, Dayer JM, Fiers W, Bluethmann H, Grau GE", "evidence": [ { "database": "Reactome", "id": "R-HSA-5668541", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668541" } ], "reference": [ { "type": "PubMed", "id": "9247583", "url": "https://glygen.org/publication/PubMed/9247583" } ] }, { "title": "TRANCE is a novel ligand of the tumor necrosis factor receptor family that activates c-Jun N-terminal kinase in T cells.", "journal": "J. Biol. Chem.", "date": "1997", "authors": "Wong BR, Rho J, Arron J, Robinson E, Orlinick J, Chao M, Kalachikov S, Cayani E, Bartlett FS 3rd, Frankel WN, Lee SY, Choi Y", "evidence": [ { "database": "UniProtKB", "id": "O14788", "url": "https://www.uniprot.org/uniprot/O14788" } ], "reference": [ { "type": "PubMed", "id": "9312132", "url": "https://glygen.org/publication/PubMed/9312132" } ] }, { "title": "A homologue of the TNF receptor and its ligand enhance T-cell growth and dendritic-cell function.", "journal": "Nature", "date": "1997", "authors": "Anderson DM, Maraskovsky E, Billingsley WL, Dougall WC, Tometsko ME, Roux ER, Teepe MC, DuBose RF, Cosman D, Galibert L", "evidence": [ { "database": "UniProtKB", "id": "O14788", "url": "https://www.uniprot.org/uniprot/O14788" }, { "database": "Reactome", "id": "R-HSA-5676594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5676594" } ], "reference": [ { "type": "PubMed", "id": "9367155", "url": "https://glygen.org/publication/PubMed/9367155" } ] }, { "title": "Osteoprotegerin ligand is a cytokine that regulates osteoclast differentiation and activation.", "journal": "Cell", "date": "1998", "authors": "Lacey DL, Timms E, Tan HL, Kelley MJ, Dunstan CR, Burgess T, Elliott R, Colombero A, Elliott G, Scully S, Hsu H, Sullivan J, Hawkins N, Davy E, Capparelli C, Eli A, Qian YX, Kaufman S, Sarosi I, Shalhoub V, Senaldi G, Guo J, Delaney J, Boyle WJ", "evidence": [ { "database": "UniProtKB", "id": "O14788", "url": "https://www.uniprot.org/uniprot/O14788" } ], "reference": [ { "type": "PubMed", "id": "9568710", "url": "https://glygen.org/publication/PubMed/9568710" } ] }, { "title": "CD40-tumor necrosis factor receptor-associated factor (TRAF) interactions: regulation of CD40 signaling through multiple TRAF binding sites and TRAF hetero-oligomerization.", "journal": "Biochemistry", "date": "1998", "authors": "Pullen SS, Miller HG, Everdeen DS, Dang TT, Crute JJ, Kehry MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5676594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5676594" } ], "reference": [ { "type": "PubMed", "id": "9718306", "url": "https://glygen.org/publication/PubMed/9718306" } ] }, { "title": "The involvement of multiple tumor necrosis factor receptor (TNFR)-associated factors in the signaling mechanisms of receptor activator of NF-kappaB, a member of the TNFR superfamily.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Galibert L, Tometsko ME, Anderson DM, Cosman D, Dougall WC", "evidence": [ { "database": "Reactome", "id": "R-HSA-5676594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5676594" } ], "reference": [ { "type": "PubMed", "id": "9852070", "url": "https://glygen.org/publication/PubMed/9852070" } ] }, { "title": "RANK is the essential signaling receptor for osteoclast differentiation factor in osteoclastogenesis.", "journal": "Biochemical and biophysical research communications", "date": "1998", "authors": "Nakagawa N, Kinosaki M, Yamaguchi K, Shima N, Yasuda H, Yano K, Morinaga T, Higashio K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5669034", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5669034" } ], "reference": [ { "type": "PubMed", "id": "9878548", "url": "https://glygen.org/publication/PubMed/9878548" } ] } ], "pathway": [ { "id": "hsa:8600", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:8600", "resource": "KEGG Pathway" }, { "id": "R-HSA-5668541", "name": "TNFR2 non-canonical NF-kB pathway", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5668541", "resource": "Reactome", "description": "TNFR2 non-canonical NF-kB pathway" }, { "id": "R-HSA-5669034", "name": "TNFs bind their physiological receptors", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5669034", "resource": "Reactome", "description": "TNFs bind their physiological receptors" }, { "id": "R-HSA-5676594", "name": "TNF receptor superfamily (TNFSF) members mediating non-canonical NF-kB pathway", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5676594", "resource": "Reactome", "description": "TNF receptor superfamily (TNFSF) members mediating non-canonical NF-kB pathway" } ], "orthologs": [ { "uniprot_canonical_ac": "F1RJX1-1", "protein_name": "TNF superfamily member 11", "gene_name": "TNFSF11", "tax_id": 9823, "organism": "Sus scrofa", "sequence": { "sequence": "MRRASRDYTKYLRGSEEMGGGGSGAPHEGPLHAPPPPAPPHQPAAASRFTFMALLGLGLGQVVCSVALFLYFRAQMDPNRISEDDTHCINRIFQLHENTDLQDTTLESQDSKLIPDSCKRIKQAFQAAVQKEMQHIVKSQHIRAEKAMVEGSWLDLSRRNKPETQPFAHLTINATDIPSGSHKVSLSCWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGNLDAKYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNHSLLDPDQDATYFGAFKVRDID", "length": 319 }, "evidence": [ { "id": "O14788", "url": "https://omabrowser.org/oma/group/O14788/", "database": "OMA" } ], "common_name": "Pig" }, { "uniprot_canonical_ac": "O35235-1", "protein_name": "Tumor necrosis factor ligand superfamily member 11", "gene_name": "Tnfsf11", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MRRASRDYGKYLRSSEEMGSGPGVPHEGPLHPAPSAPAPAPPPAASRSMFLALLGLGLGQVVCSIALFLYFRAQMDPNRISEDSTHCFYRILRLHENADLQDSTLESEDTLPDSCRRMKQAFQGAVQKELQHIVGPQRFSGAPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID", "length": 316 }, "evidence": [ { "id": "45922549", "url": "http://www.informatics.jax.org/homology/45922549", "database": "MGI" }, { "id": "O14788", "url": "https://omabrowser.org/oma/group/O14788/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9ESE2-1", "protein_name": "Tumor necrosis factor ligand superfamily member 11", "gene_name": "Tnfsf11", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MRRANRDYGKYLRGSEEMGSCPGVPHEGPLHPAPSAPAPAPPPAASRFMFLALLGLGLGQVVCSIALFLYFRAQMDPNRISEDSTRCFYRILRLRENTGLQDSTLESEDTEALPDSCRRMKQAFQGAVQRELQHIVGPQRFSGVPAMMEGSWLDVARRGKPEAQPFAHLTINAADIPSGSHKVSLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSVPADYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISVQVSNPSLLDPDQDATYFGAFKVQDID", "length": 318 }, "evidence": [ { "id": "45922549", "url": "http://www.informatics.jax.org/homology/45922549", "database": "MGI" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 39, "go_terms": [ { "name": "osteoclast differentiation", "id": "GO:0030316", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030316", "evidence": [ { "database": "UniProtKB", "id": "O14788", "url": "https://www.uniprot.org/uniprot/O14788" } ], "pmid": "" }, { "name": "positive regulation of osteoclast development", "id": "GO:2001206", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2001206", "evidence": [ { "database": "UniProtKB", "id": "O14788", "url": "https://www.uniprot.org/uniprot/O14788" } ], "pmid": "" }, { "name": "positive regulation of fever generation by positive regulation of prostaglandin secretion", "id": "GO:0071812", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071812", "evidence": [ { "database": "UniProtKB", "id": "O14788", "url": "https://www.uniprot.org/uniprot/O14788" } ], "pmid": "" }, { "name": "positive regulation of ERK1 and ERK2 cascade via TNFSF11-mediated signaling", "id": "GO:0071848", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071848", "evidence": [ { "database": "UniProtKB", "id": "O14788", "url": "https://www.uniprot.org/uniprot/O14788" } ], "pmid": "" }, { "name": "negative regulation of transcription by RNA polymerase II", "id": "GO:0000122", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000122", "evidence": [ { "database": "UniProtKB", "id": "O14788", "url": "https://www.uniprot.org/uniprot/O14788" } ], "pmid": "" }, { "name": "immune response", "id": "GO:0006955", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006955", "evidence": [ { "database": "UniProtKB", "id": "O14788", "url": "https://www.uniprot.org/uniprot/O14788" } ], "pmid": "" }, { "name": "positive regulation of gene expression", "id": "GO:0010628", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010628", "evidence": [ { "database": "UniProtKB", "id": "O14788", "url": "https://www.uniprot.org/uniprot/O14788" } ], "pmid": "" }, { "name": "calcium-mediated signaling", "id": "GO:0019722", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019722", "evidence": [ { "database": "UniProtKB", "id": "O14788", "url": "https://www.uniprot.org/uniprot/O14788" } ], "pmid": "" }, { "name": "positive regulation of transcription by RNA polymerase II", "id": "GO:0045944", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045944", "evidence": [ { "database": "UniProtKB", "id": "O14788", "url": "https://www.uniprot.org/uniprot/O14788" } ], "pmid": "" }, { "name": "positive regulation of JNK cascade", "id": "GO:0046330", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046330", "evidence": [ { "database": "UniProtKB", "id": "O14788", "url": "https://www.uniprot.org/uniprot/O14788" } ], "pmid": "" }, { "name": "positive regulation of DNA-binding transcription factor activity", "id": "GO:0051091", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051091", "evidence": [ { "database": "UniProtKB", "id": "O14788", "url": "https://www.uniprot.org/uniprot/O14788" } ], "pmid": "" }, { "name": "positive regulation of NF-kappaB transcription factor activity", "id": "GO:0051092", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051092", "evidence": [ { "database": "UniProtKB", "id": "O14788", "url": "https://www.uniprot.org/uniprot/O14788" } ], "pmid": "" }, { "name": "positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction", "id": "GO:0051897", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051897", "evidence": [ { "database": "UniProtKB", "id": "O14788", "url": "https://www.uniprot.org/uniprot/O14788" } ], "pmid": "" }, { "name": "JNK cascade", "id": "GO:0007254", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007254", "evidence": [ { "database": "UniProtKB", "id": "O14788", "url": "https://www.uniprot.org/uniprot/O14788" } ], "pmid": "" }, { "name": "positive regulation of bone resorption", "id": "GO:0045780", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045780", "evidence": [ { "database": "UniProtKB", "id": "O14788", "url": "https://www.uniprot.org/uniprot/O14788" } ], "pmid": "" }, { "name": "cellular response to leukemia inhibitory factor", "id": "GO:1990830", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990830", "evidence": [ { "database": "UniProtKB", "id": "O14788", "url": "https://www.uniprot.org/uniprot/O14788" } ], "pmid": "" }, { "name": "positive regulation of canonical NF-kappaB signal transduction", "id": "GO:0043123", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043123", "evidence": [ { "database": "UniProtKB", "id": "O14788", "url": "https://www.uniprot.org/uniprot/O14788" } ], "pmid": "" }, { "name": "positive regulation of MAP kinase activity", "id": "GO:0043406", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043406", "evidence": [ { "database": "UniProtKB", "id": "O14788", "url": "https://www.uniprot.org/uniprot/O14788" } ], "pmid": "" }, { "name": "ERK1 and ERK2 cascade", "id": "GO:0070371", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070371", "evidence": [ { "database": "UniProtKB", "id": "O14788", "url": "https://www.uniprot.org/uniprot/O14788" } ], "pmid": "" }, { "name": "bone resorption", "id": "GO:0045453", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045453", "evidence": [ { "database": "UniProtKB", "id": "O14788", "url": "https://www.uniprot.org/uniprot/O14788" } ], "pmid": "" }, { "name": "osteoclast proliferation", "id": "GO:0002158", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002158", "evidence": [ { "database": "UniProtKB", "id": "O14788", "url": "https://www.uniprot.org/uniprot/O14788" } ], "pmid": "" }, { "name": "osteoclast development", "id": "GO:0036035", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0036035", "evidence": [ { "database": "UniProtKB", "id": "O14788", "url": "https://www.uniprot.org/uniprot/O14788" } ], "pmid": "" }, { "name": "ossification", "id": "GO:0001503", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001503", "evidence": [ { "database": "UniProtKB", "id": "O14788", "url": "https://www.uniprot.org/uniprot/O14788" } ], "pmid": "" }, { "name": "mammary gland alveolus development", "id": "GO:0060749", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060749", "evidence": [ { "database": "UniProtKB", "id": "O14788", "url": "https://www.uniprot.org/uniprot/O14788" } ], "pmid": "" }, { "name": "positive regulation of corticotropin-releasing hormone secretion", "id": "GO:0051466", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051466", "evidence": [ { "database": "UniProtKB", "id": "O14788", "url": "https://www.uniprot.org/uniprot/O14788" } ], "pmid": "" }, { "name": "canonical NF-kappaB signal transduction", "id": "GO:0007249", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007249", "evidence": [ { "database": "UniProtKB", "id": "O14788", "url": "https://www.uniprot.org/uniprot/O14788" } ], "pmid": "" }, { "name": "tumor necrosis factor-mediated signaling pathway", "id": "GO:0033209", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033209", "evidence": [ { "database": "UniProtKB", "id": "O14788", "url": "https://www.uniprot.org/uniprot/O14788" } ], "pmid": "" }, { "name": "phosphatidylinositol 3-kinase/protein kinase B signal transduction", "id": "GO:0043491", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043491", "evidence": [ { "database": "UniProtKB", "id": "O14788", "url": "https://www.uniprot.org/uniprot/O14788" } ], "pmid": "" }, { "name": "positive regulation of homotypic cell-cell adhesion", "id": "GO:0034112", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034112", "evidence": [ { "database": "UniProtKB", "id": "O14788", "url": "https://www.uniprot.org/uniprot/O14788" } ], "pmid": "" }, { "name": "calcium ion homeostasis", "id": "GO:0055074", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0055074", "evidence": [ { "database": "UniProtKB", "id": "O14788", "url": "https://www.uniprot.org/uniprot/O14788" } ], "pmid": "" }, { "name": "monocyte chemotaxis", "id": "GO:0002548", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002548", "evidence": [ { "database": "UniProtKB", "id": "O14788", "url": "https://www.uniprot.org/uniprot/O14788" } ], "pmid": "" }, { "name": "positive regulation of T cell activation", "id": "GO:0050870", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050870", "evidence": [ { "database": "UniProtKB", "id": "O14788", "url": "https://www.uniprot.org/uniprot/O14788" } ], "pmid": "" }, { "name": "cytokine-mediated signaling pathway", "id": "GO:0019221", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019221", "evidence": [ { "database": "UniProtKB", "id": "O14788", "url": "https://www.uniprot.org/uniprot/O14788" } ], "pmid": "" }, { "name": "paracrine signaling", "id": "GO:0038001", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0038001", "evidence": [ { "database": "UniProtKB", "id": "O14788", "url": "https://www.uniprot.org/uniprot/O14788" } ], "pmid": "" }, { "name": "TNFSF11-mediated signaling pathway", "id": "GO:0071847", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071847", "evidence": [ { "database": "UniProtKB", "id": "O14788", "url": "https://www.uniprot.org/uniprot/O14788" } ], "pmid": "" }, { "name": "positive regulation of intracellular signal transduction", "id": "GO:1902533", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902533", "evidence": [ { "database": "UniProtKB", "id": "O14788", "url": "https://www.uniprot.org/uniprot/O14788" } ], "pmid": "" }, { "name": "positive regulation of osteoclast differentiation", "id": "GO:0045672", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045672", "evidence": [ { "database": "UniProtKB", "id": "O14788", "url": "https://www.uniprot.org/uniprot/O14788" } ], "pmid": "" }, { "name": "tooth eruption", "id": "GO:0044691", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044691", "evidence": [ { "database": "UniProtKB", "id": "O14788", "url": "https://www.uniprot.org/uniprot/O14788" } ], "pmid": "" }, { "name": "mammary gland epithelial cell proliferation", "id": "GO:0033598", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033598", "evidence": [ { "database": "UniProtKB", "id": "O14788", "url": "https://www.uniprot.org/uniprot/O14788" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 4, "go_terms": [ { "name": "extracellular region", "id": "GO:0005576", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005576", "evidence": [ { "database": "UniProtKB", "id": "O14788", "url": "https://www.uniprot.org/uniprot/O14788" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "O14788", "url": "https://www.uniprot.org/uniprot/O14788" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "O14788", "url": "https://www.uniprot.org/uniprot/O14788" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "O14788", "url": "https://www.uniprot.org/uniprot/O14788" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "O14788", "url": "https://www.uniprot.org/uniprot/O14788" } ], "pmid": "" }, { "name": "cytokine activity", "id": "GO:0005125", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005125", "evidence": [ { "database": "UniProtKB", "id": "O14788", "url": "https://www.uniprot.org/uniprot/O14788" } ], "pmid": "" }, { "name": "tumor necrosis factor receptor superfamily binding", "id": "GO:0032813", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032813", "evidence": [ { "database": "UniProtKB", "id": "O14788", "url": "https://www.uniprot.org/uniprot/O14788" } ], "pmid": "" }, { "name": "tumor necrosis factor receptor binding", "id": "GO:0005164", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005164", "evidence": [ { "database": "UniProtKB", "id": "O14788", "url": "https://www.uniprot.org/uniprot/O14788" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 171, "end_pos": 173, "annotation": "n_glycosylation_sequon" }, { "start_pos": 198, "end_pos": 200, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [ 171, 198 ], "o_linked_sites": [], "snv_sites": [ 101, 198, 296 ], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 171, "end_pos": 173 }, { "start_pos": 198, "end_pos": 200 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 81 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }