{ "uniprot_canonical_ac": "O14786-1", "uniprot_ac": "O14786", "uniprot_id": "NRP1_HUMAN", "mass": { "chemical_mass": 103134.0, "monoisotopic_mass": 103134.0 }, "refseq": { "ac": "NP_001019799", "name": "neuropilin-1 isoform b precursor", "summary": "This gene encodes one of two neuropilins, which contain specific protein domains which allow them to participate in several different types of signaling pathways that control cell migration. Neuropilins contain a large N-terminal extracellular domain, made up of complement-binding, coagulation factor V/VIII, and meprin domains. These proteins also contains a short membrane-spanning domain and a small cytoplasmic domain. Neuropilins bind many ligands and various types of co-receptors; they affect cell survival, migration, and attraction. Some of the ligands and co-receptors bound by neuropilins are vascular endothelial growth factor (VEGF) and semaphorin family members. This protein has also been determined to act as a co-receptor for SARS-CoV-2 (which causes COVID-19) to infect host cells. [provided by RefSeq, Nov 2020].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001019799" }, "gene_names": [ { "name": "NRP1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O14786", "id": "O14786" }, { "name": "BDCA4; CD304; NP1; NRP; VEGF165R", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001019799", "id": "NP_001019799" }, { "name": "NRP1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001019799", "id": "NP_001019799" }, { "name": "NRP", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O14786", "id": "O14786" }, { "name": "VEGF165R", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O14786", "id": "O14786" } ], "protein_names": [ { "name": "Neuropilin-1", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O14786" }, { "name": "Vascular endothelial cell growth factor 165 receptor", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O14786" }, { "name": "neuropilin-1 isoform b precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001019799", "id": "NP_001019799" }, { "name": "transmembrane receptor; vascular endothelial cell growth factor 165 receptor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001019799", "id": "NP_001019799" } ], "function": [ { "annotation": "(Microbial infection) Acts as a host factor for human coronavirus SARS-CoV-2 infection. Recognizes and binds to CendR motif RRAR on SARS-CoV-2 spike protein S1 which enhances SARS-CoV-2 infection.", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786#function" }, { "database": "PubMed", "id": "33082294", "url": "https://glygen.org/publication/PubMed/33082294" }, { "database": "PubMed", "id": "33082293", "url": "https://glygen.org/publication/PubMed/33082293" } ] }, { "annotation": "Binds VEGF-165 and may inhibit its binding to cells (PubMed:10748121, PubMed:26503042). May induce apoptosis by sequestering VEGF-165 (PubMed:10748121). May bind as well various members of the semaphorin family. Its expression has an averse effect on blood vessel number and integrity.", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786#function" }, { "database": "PubMed", "id": "26503042", "url": "https://glygen.org/publication/PubMed/26503042" }, { "database": "PubMed", "id": "10748121", "url": "https://glygen.org/publication/PubMed/10748121" } ] }, { "annotation": "Biophysical investigation of interactions between SARS-CoV-2 spike protein and neuropilin-1.", "evidence": [ { "database": "RefSeq", "id": "NP_001019799", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001019799" }, { "database": "PubMed", "id": "37656811", "url": "https://glygen.org/publication/PubMed/37656811" } ] }, { "annotation": "Cell-surface receptor involved in the development of the cardiovascular system, in angiogenesis, in the formation of certain neuronal circuits and in organogenesis outside the nervous system. Mediates the chemorepulsant activity of semaphorins (PubMed:9288753, PubMed:9529250, PubMed:10688880). Recognizes a C-end rule (CendR) motif R/KXXR/K on its ligands which causes cellular internalization and vascular leakage (PubMed:19805273). It binds to semaphorin 3A, the PLGF-2 isoform of PGF, the VEGF165 isoform of VEGFA and VEGFB (PubMed:9288753, PubMed:9529250, PubMed:10688880, PubMed:19805273). Coexpression with KDR results in increased VEGF165 binding to KDR as well as increased chemotaxis. Regulates VEGF-induced angiogenesis. Binding to VEGFA initiates a signaling pathway needed for motor neuron axon guidance and cell body migration, including for the caudal migration of facial motor neurons from rhombomere 4 to rhombomere 6 during embryonic development (By similarity). Regulates mitochondrial iron transport via interaction with ABCB8/MITOSUR (PubMed:30623799).", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786#function" }, { "database": "PubMed", "id": "10688880", "url": "https://glygen.org/publication/PubMed/10688880" }, { "database": "UniProtKB", "id": "P97333", "url": "https://www.uniprot.org/uniprot/P97333#function" }, { "database": "PubMed", "id": "19805273", "url": "https://glygen.org/publication/PubMed/19805273" }, { "database": "PubMed", "id": "30623799", "url": "https://glygen.org/publication/PubMed/30623799" }, { "database": "PubMed", "id": "9288753", "url": "https://glygen.org/publication/PubMed/9288753" }, { "database": "PubMed", "id": "9529250", "url": "https://glygen.org/publication/PubMed/9529250" } ] }, { "annotation": "NRP1 Induces Enhanced Stemness and Chemoresistance in Glioma Cells via YAP.", "evidence": [ { "database": "RefSeq", "id": "NP_001019799", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001019799" }, { "database": "PubMed", "id": "38220212", "url": "https://glygen.org/publication/PubMed/38220212" } ] }, { "annotation": "NRP1 regulates autophagy and proliferation of gastric cancer through Wnt/beta-catenin signaling pathway.", "evidence": [ { "database": "RefSeq", "id": "NP_001019799", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001019799" }, { "database": "PubMed", "id": "37702613", "url": "https://glygen.org/publication/PubMed/37702613" } ] }, { "annotation": "Neuropilin-1 is a host factor for SARS-CoV-2 infection.", "evidence": [ { "database": "RefSeq", "id": "NP_001019799", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001019799" }, { "database": "PubMed", "id": "33082294", "url": "https://glygen.org/publication/PubMed/33082294" } ] }, { "annotation": "This gene encodes one of two neuropilins, which contain specific protein domains which allow them to participate in several different types of signaling pathways that control cell migration. Neuropilins contain a large N-terminal extracellular domain, made up of complement-binding, coagulation factor V/VIII, and meprin domains. These proteins also contains a short membrane-spanning domain and a small cytoplasmic domain. Neuropilins bind many ligands and various types of co-receptors; they affect cell survival, migration, and attraction. Some of the ligands and co-receptors bound by neuropilins are vascular endothelial growth factor (VEGF) and semaphorin family members. This protein has also been determined to act as a co-receptor for SARS-CoV-2 (which causes COVID-19) to infect host cells. [provided by RefSeq, Nov 2020].", "evidence": [ { "database": "RefSeq", "id": "NP_001019799", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001019799" } ] }, { "annotation": "VEGF/Nrp1/HIF-1alpha promotes proliferation of hepatocellular carcinoma through a positive feedback loop. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001019799", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001019799" }, { "database": "PubMed", "id": "37875691", "url": "https://glygen.org/publication/PubMed/37875691" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs1221143595", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1221143595" }, { "id": "rs1221143595", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1221143595" }, { "id": "rs1221143595", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1221143595" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 844, "end_pos": 844, "sequence_org": "S", "sequence_mut": "F", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NIS->NIF); o-glyco-site-loss (S->F).", "chr_id": "10", "chr_pos": "33180317", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S844", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O14786", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O14786" }, { "id": "rs767829083", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767829083" }, { "id": "rs767829083", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767829083" }, { "id": "rs767829083", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs767829083" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 181, "end_pos": 181, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "K", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (KMS->NMS).", "chr_id": "10", "chr_pos": "33263761", "ref_nt": "C", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "K181", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] }, { "evidence": [ { "id": "rs1478416024", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1478416024" }, { "id": "rs1478416024", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1478416024#frequency_tab" }, { "id": "rs1478416024", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1478416024" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 263, "end_pos": 263, "sequence_org": "S", "sequence_mut": "C", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->NYC).", "chr_id": "10", "chr_pos": "33256343", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S263", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1478416024", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1478416024" }, { "id": "rs1478416024", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1478416024#frequency_tab" }, { "id": "rs1478416024", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1478416024" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 263, "end_pos": 263, "sequence_org": "S", "sequence_mut": "G", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NYS->NYG).", "chr_id": "10", "chr_pos": "33256343", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S263", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs778394341", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778394341" }, { "id": "rs778394341", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs778394341" }, { "id": "rs778394341", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs778394341" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 311, "end_pos": 311, "sequence_org": "P", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NYP->NYS).", "chr_id": "10", "chr_pos": "33254078", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "P311", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs748142955", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748142955" }, { "id": "rs748142955", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs748142955" }, { "id": "rs748142955", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs748142955" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 347, "end_pos": 347, "sequence_org": "K", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (KET->NET).", "chr_id": "10", "chr_pos": "33226230", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "K347", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs756440174", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756440174" }, { "id": "rs756440174", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs756440174" }, { "id": "rs756440174", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs756440174#frequency_tab" }, { "id": "rs756440174", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs756440174" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 361, "end_pos": 361, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DVS->NVS).", "chr_id": "10", "chr_pos": "33226190", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D361", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1425527048", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1425527048" }, { "id": "rs1425527048", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1425527048" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 458, "end_pos": 458, "sequence_org": "M", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NWM->NWT).", "chr_id": "10", "chr_pos": "33213627", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "M458", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1588737721", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1588737721" }, { "id": "rs1588737721", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1588737721" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 522, "end_pos": 522, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->SGS).", "chr_id": "10", "chr_pos": "33213435", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N522", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1205457813", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1205457813" }, { "id": "rs1205457813", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1205457813#frequency_tab" }, { "id": "rs1205457813", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1205457813" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 523, "end_pos": 523, "sequence_org": "G", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NNG->NNS).", "chr_id": "10", "chr_pos": "33213433", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "G523", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs117525057", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs117525057" }, { "id": "rs117525057", "database": "1000Genomes", "url": "https://www.ensembl.org/homo_sapiens/Variation/Explore?v=rs117525057" }, { "id": "rs117525057", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs117525057" }, { "id": "rs117525057", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs117525057#frequency_tab" }, { "id": "rs117525057", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs117525057" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 524, "end_pos": 524, "sequence_org": "S", "sequence_mut": "L", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NGS->NGL).", "chr_id": "10", "chr_pos": "33213429", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "0.007987", "site_lbl": "S524", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O14786", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O14786" }, { "id": "rs1222857683", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1222857683" }, { "id": "rs1222857683", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1222857683" }, { "id": "rs1222857683", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1222857683" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 531, "end_pos": 531, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "D", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (DDS->NDS).", "chr_id": "10", "chr_pos": "33213409", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "D531", "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi" ] }, { "evidence": [ { "id": "rs776830169", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776830169" }, { "id": "rs776830169", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776830169" }, { "id": "rs776830169", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs776830169#frequency_tab" }, { "id": "rs776830169", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs776830169" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 612, "end_pos": 612, "sequence_org": "S", "sequence_mut": "C", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->C).", "chr_id": "10", "chr_pos": "33202921", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S612", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs776830169", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776830169" }, { "id": "rs776830169", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs776830169" }, { "id": "rs776830169", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs776830169#frequency_tab" }, { "id": "rs776830169", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs776830169" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 612, "end_pos": 612, "sequence_org": "S", "sequence_mut": "G", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->G).", "chr_id": "10", "chr_pos": "33202921", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S612", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs145594886", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs145594886" }, { "id": "rs145594886", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs145594886" }, { "id": "rs145594886", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs145594886#frequency_tab" }, { "id": "rs145594886", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs145594886" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 636, "end_pos": 636, "sequence_org": "D", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (DST->NST).", "chr_id": "10", "chr_pos": "33197668", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "D636", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1488877452", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1488877452" }, { "id": "rs1488877452", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1488877452#frequency_tab" }, { "id": "rs1488877452", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1488877452" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 637, "end_pos": 637, "sequence_org": "S", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (S->R).", "chr_id": "10", "chr_pos": "33197663", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S637", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O14786", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O14786" }, { "id": "rs779467840", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs779467840" }, { "id": "rs779467840", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs779467840" }, { "id": "rs779467840", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs779467840" }, { "id": "rs779467840", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs779467840" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 719, "end_pos": 719, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "A", "sequence_mut": "T", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (NSA->NST).", "chr_id": "10", "chr_pos": "33186396", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "A719", "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi" ] }, { "evidence": [ { "id": "O14786", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O14786" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 803, "end_pos": 803, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "H", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (HIS->NIS).", "chr_id": "10", "chr_pos": "33185652", "ref_nt": "G", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "H803", "disease": [ { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs759421479", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs759421479" }, { "id": "rs759421479", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs759421479" }, { "id": "rs759421479", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs759421479" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 827, "end_pos": 827, "sequence_org": "T", "sequence_mut": "R", "comment": "Germline mutation passed 1 out of 1 filters: o-glyco-site-loss (T->R).", "chr_id": "10", "chr_pos": "33182700", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T827", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O14786", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O14786" }, { "id": "rs750320738", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750320738" }, { "id": "rs750320738", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750320738" }, { "id": "rs750320738", "database": "NCI-TCGA", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs750320738" }, { "id": "rs750320738", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs750320738" } ], "glycoeffect": [ "o-glyco-site-loss" ], "start_pos": 830, "end_pos": 830, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "T", "sequence_mut": "M", "comment": "Somatic mutation passed 1 out of 6 filters: o-glyco-site-loss (T->M).", "chr_id": "10", "chr_pos": "33180359", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "T830", "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] }, { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease", "ebi", "germline" ] }, { "evidence": [ { "id": "rs767096379", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767096379" }, { "id": "rs767096379", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs767096379" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 96, "end_pos": 96, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NEN->NES).", "chr_id": "10", "chr_pos": "33270818", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N96", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "91.33", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000099250", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000099250" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "81.37", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000099250", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000099250" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "89.03", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000099250", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000099250" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "80.41", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000099250", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000099250" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "93.3", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000099250", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000099250" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "91.01", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000099250", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000099250" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "68.48", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000099250", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000099250" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "87.13", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000099250", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000099250" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "94.28", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000099250", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000099250" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "93.01", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000099250", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000099250" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "93.99", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000099250", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000099250" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "85.91", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000099250", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000099250" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "93.58", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000099250", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000099250" } ] } ], "expression_disease": [ { "significant": "No", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O14786", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14786" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O14786", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14786" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O14786", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14786" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O14786", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14786" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O14786", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14786" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O14786", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14786" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O14786", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14786" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O14786", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14786" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O14786", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14786" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O14786", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14786" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O14786", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14786" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O14786", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14786" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "common_name": "Human" } ], "gene": [ { "name": "NRP1", "url": "https://www.uniprot.org/uniprot/O14786", "locus": { "chromosome": "10", "start_pos": 33177492, "end_pos": 33336262, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000099250", "url": "https://www.ensembl.org/id/ENSG00000099250" } ] } } ], "crossref": [ { "id": "ENSG00000099250", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000099250", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "O14786", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O14786", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "cd00041", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00041", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd00057", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00057", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd06263", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd06263", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CHEMBL5174", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL5174", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "NRP1", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=NRP1", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "8829", "url": "https://www.ncbi.nlm.nih.gov/gene/8829", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "1557", "url": "https://glyconnect.expasy.org/browser/proteins/1557", "database": "GlyConnect", "categories": [ "Glycoproteomics", "Glycan" ] }, { "id": "8004", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=8004", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "E9PEP6", "url": "https://www.ebi.ac.uk/intact/interactors/id:E9PEP6*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "O14786", "url": "https://www.ebi.ac.uk/intact/interactors/id:O14786*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000421", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000421", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000859", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000859", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000998", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000998", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR008979", "url": "https://www.ebi.ac.uk/interpro/entry/IPR008979", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR013320", "url": "https://www.ebi.ac.uk/interpro/entry/IPR013320", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR014648", "url": "https://www.ebi.ac.uk/interpro/entry/IPR014648", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR022579", "url": "https://www.ebi.ac.uk/interpro/entry/IPR022579", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR035914", "url": "https://www.ebi.ac.uk/interpro/entry/IPR035914", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:8829", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:8829", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "602069", "url": "http://www.omim.org/entry/602069", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O14786", "url": "https://www.nextprot.org/entry/NX_O14786", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "QEDCTKP", "url": "https://omabrowser.org/oma/group/QEDCTKP/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5293253at2759", "url": "http://www.orthodb.org/?query=5293253at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR46806", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46806", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR46806:SF4", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR46806:SF4", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1KEX", "url": "https://www.rcsb.org/structure/1KEX", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2QQI", "url": "https://www.rcsb.org/structure/2QQI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2QQM", "url": "https://www.rcsb.org/structure/2QQM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2QQN", "url": "https://www.rcsb.org/structure/2QQN", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3I97", "url": "https://www.rcsb.org/structure/3I97", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4DEQ", "url": "https://www.rcsb.org/structure/4DEQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "4RN5", "url": "https://www.rcsb.org/structure/4RN5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5C7G", "url": "https://www.rcsb.org/structure/5C7G", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5IJR", "url": "https://www.rcsb.org/structure/5IJR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5IYY", "url": "https://www.rcsb.org/structure/5IYY", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5J1X", "url": "https://www.rcsb.org/structure/5J1X", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5JGI", "url": "https://www.rcsb.org/structure/5JGI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5JGQ", "url": "https://www.rcsb.org/structure/5JGQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5JHK", "url": "https://www.rcsb.org/structure/5JHK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5L73", "url": "https://www.rcsb.org/structure/5L73", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6FMC", "url": "https://www.rcsb.org/structure/6FMC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6FMF", "url": "https://www.rcsb.org/structure/6FMF", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6TKK", "url": "https://www.rcsb.org/structure/6TKK", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7JJC", "url": "https://www.rcsb.org/structure/7JJC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7O1N", "url": "https://www.rcsb.org/structure/7O1N", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7P5U", "url": "https://www.rcsb.org/structure/7P5U", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8PFE", "url": "https://www.rcsb.org/structure/8PFE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00431", "url": "http://pfam.xfam.org/family/PF00431", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00629", "url": "http://pfam.xfam.org/family/PF00629", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00754", "url": "http://pfam.xfam.org/family/PF00754", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF11980", "url": "http://pfam.xfam.org/family/PF11980", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O14786", "url": "https://pharos.nih.gov/targets/O14786", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR:000050705", "url": "https://proconsortium.org/app/entry/PR:000050705", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000050706", "url": "https://proconsortium.org/app/entry/PR:000050706", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000050707", "url": "https://proconsortium.org/app/entry/PR:000050707", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000050708", "url": "https://proconsortium.org/app/entry/PR:000050708", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR:000050709", "url": "https://proconsortium.org/app/entry/PR:000050709", "database": "PRO", "categories": [ "Glycoproteomics" ] }, { "id": "PR_O14786", "url": "http://purl.obolibrary.org/obo/PR_O14786", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-194306", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-194306", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-376176", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-376176", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-399954", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-399954", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-399955", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-399955", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-399956", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-399956", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-447041", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-447041", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001019799", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001019799", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "O14786", "url": "DISABLED", "database": "UniCarbKB", "categories": [ "Glycoproteomics" ] }, { "id": "E7EX60", "url": "https://www.uniprot.org/uniprot/E7EX60", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E7EX60-1", "url": "https://www.uniprot.org/uniprot/E7EX60-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PEP6", "url": "https://www.uniprot.org/uniprot/E9PEP6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PEP6-1", "url": "https://www.uniprot.org/uniprot/E9PEP6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0Y4A0", "url": "https://www.uniprot.org/uniprot/H0Y4A0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0Y4A0-1", "url": "https://www.uniprot.org/uniprot/H0Y4A0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0Y4N6", "url": "https://www.uniprot.org/uniprot/H0Y4N6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0Y4N6-1", "url": "https://www.uniprot.org/uniprot/H0Y4N6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0Y7Z2", "url": "https://www.uniprot.org/uniprot/H0Y7Z2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0Y7Z2-1", "url": "https://www.uniprot.org/uniprot/H0Y7Z2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O14786-1", "url": "https://www.uniprot.org/uniprot/O14786-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O14786-2", "url": "https://www.uniprot.org/uniprot/O14786-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O14786-3", "url": "https://www.uniprot.org/uniprot/O14786-3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5JWQ2", "url": "https://www.uniprot.org/uniprot/Q5JWQ2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5JWQ2-1", "url": "https://www.uniprot.org/uniprot/Q5JWQ2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5JWQ4", "url": "https://www.uniprot.org/uniprot/Q5JWQ4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5JWQ4-1", "url": "https://www.uniprot.org/uniprot/Q5JWQ4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5JWQ6", "url": "https://www.uniprot.org/uniprot/Q5JWQ6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5JWQ6-1", "url": "https://www.uniprot.org/uniprot/Q5JWQ6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5T7F0", "url": "https://www.uniprot.org/uniprot/Q5T7F0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q5T7F0-1", "url": "https://www.uniprot.org/uniprot/Q5T7F0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "V9GYL7", "url": "https://www.uniprot.org/uniprot/V9GYL7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "V9GYL7-1", "url": "https://www.uniprot.org/uniprot/V9GYL7-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MERGLPLLCAVLALVLAPAGAFRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLIQAPDPYQRIMINFNPHFDLEDRDCKYDYVEVFDGENENGHFRGKFCGKIAPPPVVSSGPFLFIKFVSDYETHGAGFSIRYEIFKRGPECSQNYTTPSGVIKSPGFPEKYPNSLECTYIVFVPKMSEIILEFESFDLEPDSNPPGGMFCRYDRLEIWDGFPDVGPHIGRYCGQKTPGRIRSSSGILSMVFYTDSAIAKEGFSANYSVLQSSVSEDFKCMEALGMESGEIHSDQITASSQYSTNWSAERSRLNYPENGWTPGEDSYREWIQVDLGLLRFVTAVGTQGAISKETKKKYYVKTYKIDVSSNGEDWITIKEGNKPVLFQGNTNPTDVVVAVFPKPLITRFVRIKPATWETGISMRFEVYGCKITDYPCSGMLGMVSGLISDSQITSSNQGDRNWMPENIRLVTSRSGWALPPAPHSYINEWLQIDLGEEKIVRGIIIQGGKHRENKVFMRKFKIGYSNNGSDWKMIMDDSKRKAKSFEGNNNYDTPELRTFPALSTRFIRIYPERATHGGLGLRMELLGCEVEAPTAGPTTPNGNLVDECDDDQANCHSGTGDDFQLTGGTTVLATEKPTVIDSTIQSEFPTYGFNCEFGWGSHKTFCHWEHDNHVQLKWSVLTSKTGPIQDHTGDGNFIYSQADENQKGKVARLVSPVVYSQNSAHCMTFWYHMSGSHVGTLRVKLRYQKPEEYDQLVWMAIGHQGDHWKEGRVLLHKSLKLYQVIFEGEIGKGNLGGIAVDDISINNHISQEDCAKPADLDKKNPEIKIDETGSTPGYEGEGEGDKNISRKPGNVLKTLDPILITIIAMSALGVLLGAVCGVVLYCACWHNGMSERNLSALENYNFELVDGVKLKKDKLNTQSTYSEA", "length": 923, "header": "sp|O14786-1|NRP1_HUMAN Isoform 1 of Neuropilin-1 OS=Homo sapiens OX=9606 GN=NRP1 PE=1 SV=3 CANONICAL=O14786-1" }, "isoforms": [ { "isoform_ac": "E7EX60-1", "url": "", "sequence": { "sequence": "MERGLPLLCAVLALVLAPAGAFRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLIQAPDPYQRIMINFNPHFDLEDRDCKYDYVEVFDGENENGHFRGKFCGKIAPPPVVSSGPFLFIKFVSDYETHGAGFSIRYEIFKRGPECSQNYTTPSGVIKSPGFPEKYPNSLECTYIVFVPKMSEIILEFESFDLEPDSNPPGGMFCRYDRLEIWDGFPDVGPHIGRYCGQKTPGRIRSSSGILSMVFYTDSAIAKEGFSANYSVLQSSVSEDFKCMEALGMESGEIHSDQITASSQYSTNWSAERSRLNYPENGWTPGEDSYREWIQVDLGLLRFVTAVGTQGAISKETKKKYYVKTYKIDVSSNGEDWITIKEGNKPVLFQGNTNPTDVVVAVFPKPLITRFVRIKPATWETGISMRFEVYGCKITDYPCSGMLGMVSGLISDSQITSSNQGDRNWMPENIRLVTSRSGWALPPAPHSYINEWLQIDLGEEKIVRGIIIQGGKHRENKVFMRKFKIGYSNNGSDWKMIMDDSKRKAKSFEGNNNYDTPELRTFPALSTRFIRIYPERATHGGLGLRMELLGCEVEGTINTDQECPCARALAKDAKKKKRWADSTHCRCVRSIHGEMWSSGKGVCSLDANL", "length": 641, "header": "tr|E7EX60-1|NRP1_HUMAN Computationally mapped isoform of Neuropilin-1 OS=Homo sapiens OX=9606 GN=NRP1 PE=1 SV=1 CANONICAL=O14786-1" }, "locus": { "chromosome": "10", "start_pos": 33334382, "end_pos": 33206190, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000374816.7", "url": "https://www.ensembl.org/id/ENST00000374816.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000363949.3", "url": "https://www.ensembl.org/id/ENSP00000363949.3" } ] } }, { "isoform_ac": "E9PEP6-1", "url": "", "sequence": { "sequence": "MERGLPLLCAVLALVLAPAGAFRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLIQAPDPYQRIMINFNPHFDLEDRDCKYDYVEVFDGENENGHFRGKFCGKIAPPPVVSSGPFLFIKFVSDYETHGAGFSIRYEIFKRGPECSQNYTTPSGVIKSPGFPEKYPNSLECTYIVFVPKMSEIILEFESFDLEPDSNPPGGMFCRYDRLEIWDGFPDVGPHIGRYCGQKTPGRIRSSSGILSMVFYTDSAIAKEGFSANYSVLQSSVSEDFKCMEALGMESGEIHSDQITASSQYSTNWSAERSRLNYPENGWTPGEDSYREWIQVDLGLLRFVTAVGTQGAISKETKKKYYVKTYKIDVSSNGEDWITIKEGNKPVLFQGNTNPTDVVVAVFPKPLITRFVRIKPATWETGISMRFEVYGCKITDYPCSGMLGMVSGLISDSQITSSNQGDRNWMPENIRLVTSRSGWALPPAPHSYINEWLQIDLGEEKIVRGIIIQGGKHRENKVFMRKFKIGYSNNGSDWKMIMDDSKRKAKSFEGNNNYDTPELRTFPALSTRFIRIYPERATHGGLGLRMELLGCEVEAPTAGPTTPNGNLVDECDDDQANCHSGTGDDFQLTGGTTVLATEKPTVIDSTIQSEFPTYGFNCEFGWGSHKTFCHWEHDNHVQLKWSVLTSKTGPIQDHTGDGNFIYSQADENQKGKVARLVSPVVYSQNSAHCMTFWYHMSGSHVGTLRVKLRYQKPEEYDQLVWMAIGHQGDHWKEGRVLLHKSLKLYQVIFEGEIGKGNLGGIAVDDISINNHISQEDCARSTPGYEGEGEGDKNISRKPGNVLKTLDPILITIIAMSALGVLLGAVCGVVLYCACWHNGMSERNLSALENYNFELVDGVKLKKDKLNTQSTYSEA", "length": 906, "header": "tr|E9PEP6-1|NRP1_HUMAN Computationally mapped isoform of Neuropilin-1 OS=Homo sapiens OX=9606 GN=NRP1 PE=1 SV=2 CANONICAL=O14786-1" }, "locus": { "chromosome": "10", "start_pos": 33334382, "end_pos": 33180079, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000395995.5", "url": "https://www.ensembl.org/id/ENST00000395995.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000379317.1", "url": "https://www.ensembl.org/id/ENSP00000379317.1" } ] } }, { "isoform_ac": "H0Y4A0-1", "url": "", "sequence": { "sequence": "XPGGMFCRYDRLEIWDGFPDVGPHIGRYCGQKTPGRIRSSSGILSMVFYTDSAIAKEGFSANYSVLQSSVSEDFKCMEALGMESGEIHSDQITASSQYSTNWSAERSRLNYPENGWTPGEDSYREWIQDAKYRLRVSVVRSKSSSSSTSLEPRPLSSLKLSFFSYKIKIT", "length": 170, "header": "tr|H0Y4A0-1|H0Y4A0_HUMAN Computationally mapped isoform of Neuropilin 1 OS=Homo sapiens OX=9606 GN=NRP1 PE=1 SV=1 CANONICAL=O14786-1" }, "locus": { "chromosome": "10", "start_pos": 33263704, "end_pos": 33249422, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000455749.1", "url": "https://www.ensembl.org/id/ENST00000455749.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000390567.1", "url": "https://www.ensembl.org/id/ENSP00000390567.1" } ] } }, { "isoform_ac": "H0Y4N6-1", "url": "", "sequence": { "sequence": "XTHGGLGLRMELLGCEVEAPTAGPTTPNGNLVDECDDDQANCHSGTGDDFQLTGGTTVLATEKPTVIDSTIQSGSRFFKHHHKQQSMRPQNLHHNSILLL", "length": 100, "header": "tr|H0Y4N6-1|NRP1_HUMAN Computationally mapped isoform of Neuropilin-1 OS=Homo sapiens OX=9606 GN=NRP1 PE=1 SV=1 CANONICAL=O14786-1" }, "locus": { "chromosome": "10", "start_pos": 33207625, "end_pos": 33195496, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000431894.5", "url": "https://www.ensembl.org/id/ENST00000431894.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000393071.1", "url": "https://www.ensembl.org/id/ENSP00000393071.1" } ] } }, { "isoform_ac": "H0Y7Z2-1", "url": "", "sequence": { "sequence": "XPTAGPTTPNGNLVDECDDDQANCHSGTGDDFQLTGGTTVLATEKPTVIDSTIQSARLEVSTLNLSLHNPPQQKALI", "length": 77, "header": "tr|H0Y7Z2-1|NRP1_HUMAN Computationally mapped isoform of Neuropilin-1 OS=Homo sapiens OX=9606 GN=NRP1 PE=1 SV=1 CANONICAL=O14786-1" }, "locus": { "chromosome": "10", "start_pos": 33202995, "end_pos": 33194715, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000418675.5", "url": "https://www.ensembl.org/id/ENST00000418675.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000416147.1", "url": "https://www.ensembl.org/id/ENSP00000416147.1" } ] } }, { "isoform_ac": "O14786-1", "url": "", "sequence": { "sequence": "MERGLPLLCAVLALVLAPAGAFRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLIQAPDPYQRIMINFNPHFDLEDRDCKYDYVEVFDGENENGHFRGKFCGKIAPPPVVSSGPFLFIKFVSDYETHGAGFSIRYEIFKRGPECSQNYTTPSGVIKSPGFPEKYPNSLECTYIVFVPKMSEIILEFESFDLEPDSNPPGGMFCRYDRLEIWDGFPDVGPHIGRYCGQKTPGRIRSSSGILSMVFYTDSAIAKEGFSANYSVLQSSVSEDFKCMEALGMESGEIHSDQITASSQYSTNWSAERSRLNYPENGWTPGEDSYREWIQVDLGLLRFVTAVGTQGAISKETKKKYYVKTYKIDVSSNGEDWITIKEGNKPVLFQGNTNPTDVVVAVFPKPLITRFVRIKPATWETGISMRFEVYGCKITDYPCSGMLGMVSGLISDSQITSSNQGDRNWMPENIRLVTSRSGWALPPAPHSYINEWLQIDLGEEKIVRGIIIQGGKHRENKVFMRKFKIGYSNNGSDWKMIMDDSKRKAKSFEGNNNYDTPELRTFPALSTRFIRIYPERATHGGLGLRMELLGCEVEAPTAGPTTPNGNLVDECDDDQANCHSGTGDDFQLTGGTTVLATEKPTVIDSTIQSEFPTYGFNCEFGWGSHKTFCHWEHDNHVQLKWSVLTSKTGPIQDHTGDGNFIYSQADENQKGKVARLVSPVVYSQNSAHCMTFWYHMSGSHVGTLRVKLRYQKPEEYDQLVWMAIGHQGDHWKEGRVLLHKSLKLYQVIFEGEIGKGNLGGIAVDDISINNHISQEDCAKPADLDKKNPEIKIDETGSTPGYEGEGEGDKNISRKPGNVLKTLDPILITIIAMSALGVLLGAVCGVVLYCACWHNGMSERNLSALENYNFELVDGVKLKKDKLNTQSTYSEA", "length": 923, "header": "sp|O14786-1|NRP1_HUMAN Isoform 1 of Neuropilin-1 OS=Homo sapiens OX=9606 GN=NRP1 PE=1 SV=3 CANONICAL=O14786-1" }, "locus": { "chromosome": "10", "start_pos": 33334382, "end_pos": 33180079, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000265371.8", "url": "https://www.ensembl.org/id/ENST00000265371.8" }, { "database": "Ensembl Peptide", "id": "ENSP00000265371.3", "url": "https://www.ensembl.org/id/ENSP00000265371.3" } ] } }, { "isoform_ac": "O14786-2", "url": "", "sequence": { "sequence": "MERGLPLLCAVLALVLAPAGAFRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLIQAPDPYQRIMINFNPHFDLEDRDCKYDYVEVFDGENENGHFRGKFCGKIAPPPVVSSGPFLFIKFVSDYETHGAGFSIRYEIFKRGPECSQNYTTPSGVIKSPGFPEKYPNSLECTYIVFVPKMSEIILEFESFDLEPDSNPPGGMFCRYDRLEIWDGFPDVGPHIGRYCGQKTPGRIRSSSGILSMVFYTDSAIAKEGFSANYSVLQSSVSEDFKCMEALGMESGEIHSDQITASSQYSTNWSAERSRLNYPENGWTPGEDSYREWIQVDLGLLRFVTAVGTQGAISKETKKKYYVKTYKIDVSSNGEDWITIKEGNKPVLFQGNTNPTDVVVAVFPKPLITRFVRIKPATWETGISMRFEVYGCKITDYPCSGMLGMVSGLISDSQITSSNQGDRNWMPENIRLVTSRSGWALPPAPHSYINEWLQIDLGEEKIVRGIIIQGGKHRENKVFMRKFKIGYSNNGSDWKMIMDDSKRKAKSFEGNNNYDTPELRTFPALSTRFIRIYPERATHGGLGLRMELLGCEVEAPTAGPTTPNGNLVDECDDDQANCHSGTGDDFQLTGGTTVLATEKPTVIDSTIQSGIK", "length": 644, "header": "sp|O14786-2|NRP1_HUMAN Isoform 2 of Neuropilin-1 OS=Homo sapiens OX=9606 GN=NRP1 PE=1 SV=3 CANONICAL=O14786-1" }, "locus": { "chromosome": "10", "start_pos": 33334382, "end_pos": 33197642, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000374822.8", "url": "https://www.ensembl.org/id/ENST00000374822.8" }, { "database": "Ensembl Peptide", "id": "ENSP00000363955.4", "url": "https://www.ensembl.org/id/ENSP00000363955.4" } ] } }, { "isoform_ac": "O14786-3", "url": "", "sequence": { "sequence": "MERGLPLLCAVLALVLAPAGAFRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLIQAPDPYQRIMINFNPHFDLEDRDCKYDYVEVFDGENENGHFRGKFCGKIAPPPVVSSGPFLFIKFVSDYETHGAGFSIRYEIFKRGPECSQNYTTPSGVIKSPGFPEKYPNSLECTYIVFVPKMSEIILEFESFDLEPDSNPPGGMFCRYDRLEIWDGFPDVGPHIGRYCGQKTPGRIRSSSGILSMVFYTDSAIAKEGFSANYSVLQSSVSEDFKCMEALGMESGEIHSDQITASSQYSTNWSAERSRLNYPENGWTPGEDSYREWIQVDLGLLRFVTAVGTQGAISKETKKKYYVKTYKIDVSSNGEDWITIKEGNKPVLFQGNTNPTDVVVAVFPKPLITRFVRIKPATWETGISMRFEVYGCKITDYPCSGMLGMVSGLISDSQITSSNQGDRNWMPENIRLVTSRSGWALPPAPHSYINEWLQIDLGEEKIVRGIIIQGGKHRENKVFMRKFKIGYSNNGSDWKMIMDDSKRKAKSFEGNNNYDTPELRTFPALSTRFIRIYPERATHGGLGLRMELLGCEVEGGTTVLATEKPTVIDSTIQSGIK", "length": 609, "header": "sp|O14786-3|NRP1_HUMAN Isoform 3 of Neuropilin-1 OS=Homo sapiens OX=9606 GN=NRP1 PE=1 SV=3 CANONICAL=O14786-1" }, "locus": { "chromosome": "10", "start_pos": 33334382, "end_pos": 33197642, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000374821.9", "url": "https://www.ensembl.org/id/ENST00000374821.9" }, { "database": "Ensembl Peptide", "id": "ENSP00000363954.5", "url": "https://www.ensembl.org/id/ENSP00000363954.5" } ] } }, { "isoform_ac": "Q5JWQ2-1", "url": "", "sequence": { "sequence": "NHISQEDCARSTPGYEGEGEGDKNISRKPGNVLKTLDPILITIIAMSALGVLLGAVCGVVLYCACWHNGMSERNLSALENYNFELVDGVKLKKDKLNTQSTYSEA", "length": 105, "header": "tr|Q5JWQ2-1|NRP1_HUMAN Computationally mapped isoform of Neuropilin-1 OS=Homo sapiens OX=9606 GN=NRP1 PE=1 SV=1 CANONICAL=O14786-1" }, "locus": { "chromosome": "10", "start_pos": 33185655, "end_pos": 33180079, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000413802.1", "url": "https://www.ensembl.org/id/ENST00000413802.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000390447.1", "url": "https://www.ensembl.org/id/ENSP00000390447.1" } ] } }, { "isoform_ac": "Q5JWQ4-1", "url": "", "sequence": { "sequence": "MERGLPLLCAVLALVLAPAGAFRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLIQAPDPYQRIMINFNPHFDLEDRDCKYDYVEVFDGENENGHFRGKFCGKIAPPPVVSSGPFLFIKFVSDYETHGAGFSIRYEIFKRGPECSQNYTTPSGVIKSPGFPEKYPNSLECTYIVFVPKMSEIILEFESFDLEPDSNPPGGMFCRYDRLEIWDGFPDVGPHIGRYCGQKTPGRIRSSSGILSMVFYTDSAIAKEGFSANYSVLQSSVSEDFKCMEALGMESGEIHSDQITASSQYSTNWSAERSRLNYPENGWTPGEDSYREWIQVDLGLLRFVTAVGTQGAISKETKKKYYVKTYKIDVSSNGEDWITIKEGNKPVLFQGNTNPTDVVVAVFPKPLITRFVRIKPATWETGISMRFEVYGCKITDYPCSGMLGMVSGLISDSQITSSNQGDRNWMPENIRLVTSRSGWALPPAPHSYINEWLQIDLGEEKIVRGIIIQGGKHRENKVFMRKFKIGYSNNGSDWKMIMDDSKRKAKVRAGDWEEVIPYVLDFNQGPLAFSRGRASYFLPAMTLEEVCDGVSKTLDSRKTGIWHEK", "length": 597, "header": "tr|Q5JWQ4-1|Q5JWQ4_HUMAN Computationally mapped isoform of Neuropilin 1 OS=Homo sapiens OX=9606 GN=NRP1 PE=1 SV=2 CANONICAL=O14786-1" }, "locus": { "chromosome": "10", "start_pos": 33334382, "end_pos": 33213209, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000432372.6", "url": "https://www.ensembl.org/id/ENST00000432372.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000408911.2", "url": "https://www.ensembl.org/id/ENSP00000408911.2" } ] } }, { "isoform_ac": "Q5JWQ6-1", "url": "", "sequence": { "sequence": "MSEIILEFESFDLEPDSNPPGGMFCRYDRLEIWDGFPDVGPHIGRYCGQKTPGRIRSSSGILSMVFYTDSAIAKEGFSANYSVLQSSVSEDFKCMEALGMESGEIHSDQITASSQYSTNWSAERSRLNYPENGWTPGEDSYREWIQVDLGLLRFVTAVGTQGAISKETKKKYYVKTYKIDVSSNGEDWITIKEGNKPVLFQGNTNPTDVVVAVFPKPLITRFVRIKPATWETGISMRFEVYGCKITDYPCSGMLGMVSGLISDSQITSSNQGDRNWMPENIRLVTSRSGWALPPAPHSYINEWLQIDLGEEKIVRGIIIQGGKHRENKVFMRKFKIGYSNNGSDWKMIMDDSKRKAKSFEGNNNYDTPELRTFPALSTRFIRIYPERATHGGLGLRMELLGCEVEAPTAGPTTPNGNLVDECDDDQANCHSGTGGTTVLATEKPTVIDSTIQSEFPTYGFNCEFGWGSHKTFCHWEHDNHVQLKWSVLTSKTGPIQDHTGDGNFIYSQADENQKGKVARLVSPVVYSQNSAHCMTFWYHMSGSHVGTLRVKLRYQKPEEYDQLVWMAIGHQGDHWKEGRVLLHKSLKLYQVIFEGEIGKGNLGGIAVDDISINNHISQEDCAKPADLDKKNPEIKIDETGSTPGYEGEGEGDKNISRKPGNVLKTLDPILITIIAMSALGVLLGAVCGVVLYCACWHNGMSERNLSALENYNFELVDGVKLKKDKLNTQSTYSEA", "length": 735, "header": "tr|Q5JWQ6-1|Q5JWQ6_HUMAN Computationally mapped isoform of Neuropilin OS=Homo sapiens OX=9606 GN=NRP1 PE=1 SV=1 CANONICAL=O14786-1" }, "locus": { "chromosome": "10", "start_pos": 33263760, "end_pos": 33180079, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000374875.5", "url": "https://www.ensembl.org/id/ENST00000374875.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000364009.1", "url": "https://www.ensembl.org/id/ENSP00000364009.1" } ] } }, { "isoform_ac": "Q5T7F0-1", "url": "", "sequence": { "sequence": "MERGLPLLCAVLALVLAPAGAFRNDKCGDTIKIESPGYLTSPGYPHSYHPSEKCEWLIQAPDPYQRIMINFNPHFDLEDRDCKYDYVEVFDGENENGHFRGKFCGKIAPPPVVSSGPFLFIKFVSDYETHGAGFSIRYEIFKRGPECSQNYTTPSGVIKSPGFPEKYPNSLECTYIVFVPKMSEIILEFESFDLEPDSNPPGGMFCRYDRLEIWDGFPDVGPHIGRYCGQKTPGRIRSSSGILSMVFYTDSAIAKEGFSANYSVLQSSVSEDFKCMEALGMESGEIHSDQITASSQYSTNWSAERSRLNYPENGWTPGEDSYREWIQVDLGLLRFVTAVGTQGAISKETKKKYYVKTYKIDVSSNGEDWITIKEGNKPVLFQGNTNPTDVVVAVFPKPLITRFVRIKPATWETGISMRFEVYGCKITDYPCSGMLGMVSGLISDSQITSSNQGDRNWMPENIRLVTSRSGWALPPAPHSYINEWLQIDLGEEKIVRGIIIQGGKHRENKVFMRKFKIGYSNNGSDWKMIMDDSKRKAKSFEGNNNYDTPELRTFPALSTRFIRIYPERATHGGLGLRMELLGCEVEAPTAGPTTPNGNLVDECDDDQANCHSGTGDDFQLTGAETIFIPLLYHFSSCLSWDQLTPVCVLVTPHGRELPRNRSCLARTRASSFPHVIWIDELFLIATTICNNNLSHFESQRLGLS", "length": 704, "header": "tr|Q5T7F0-1|Q5T7F0_HUMAN Computationally mapped isoform of Neuropilin OS=Homo sapiens OX=9606 GN=NRP1 PE=1 SV=1 CANONICAL=O14786-1" }, "locus": { "chromosome": "10", "start_pos": 33334382, "end_pos": 33202643, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000374823.9", "url": "https://www.ensembl.org/id/ENST00000374823.9" }, { "database": "Ensembl Peptide", "id": "ENSP00000363956.5", "url": "https://www.ensembl.org/id/ENSP00000363956.5" } ] } }, { "isoform_ac": "V9GYL7-1", "url": "", "sequence": { "sequence": "XINEWLQIDLGEEKIVRGIIIQGGKHRENKVFMRKFKIGYSNNGSDWKMIMDDSKRKALI", "length": 60, "header": "tr|V9GYL7-1|NRP1_HUMAN Computationally mapped isoform of Neuropilin-1 OS=Homo sapiens OX=9606 GN=NRP1 PE=1 SV=1 CANONICAL=O14786-1" }, "locus": { "chromosome": "10", "start_pos": 33213561, "end_pos": 33194715, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000466932.1", "url": "https://www.ensembl.org/id/ENST00000466932.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000476896.1", "url": "https://www.ensembl.org/id/ENSP00000476896.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G06356OH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 150, "start_aa": "Asn", "end_pos": 150, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn150", "evidence": [ { "id": "1557", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1557" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G15169WU", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 150, "start_aa": "Asn", "end_pos": 150, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn150", "evidence": [ { "id": "1557", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1557" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G37868ZX", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 150, "start_aa": "Asn", "end_pos": 150, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn150", "evidence": [ { "id": "1557", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1557" }, { "id": "32125861", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "glytoucan_ac": "G39595FH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 150, "start_aa": "Asn", "end_pos": 150, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn150", "evidence": [ { "id": "1557", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1557" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "G59626AS", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 150, "start_aa": "Asn", "end_pos": 150, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn150", "evidence": [ { "id": "O14786", "database": "UniCarbKB", "url": "" }, { "id": "29671580", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 150, "start_aa": "Asn", "end_pos": 150, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn150", "evidence": [ { "id": "O14786", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14786#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "16335952", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16335952" }, { "id": "17989695", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17989695" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "1557", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1557" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 261, "start_aa": "Asn", "end_pos": 261, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn261", "evidence": [ { "id": "O14786", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14786#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "17989695", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/17989695" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 300, "start_aa": "Asn", "end_pos": 300, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn300", "evidence": [ { "id": "O14786", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14786#ptm_processing" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 521, "start_aa": "Asn", "end_pos": 521, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn521", "evidence": [ { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "G84452RH", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 522, "start_aa": "Asn", "end_pos": 522, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn522", "evidence": [ { "id": "1557", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1557" }, { "id": "29741879", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 522, "start_aa": "Asn", "end_pos": 522, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn522", "evidence": [ { "id": "O14786", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14786#ptm_processing" }, { "id": "19159218", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/19159218" }, { "id": "23090970", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23090970" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" } ] }, { "glytoucan_ac": "G57317CE", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 589, "start_aa": "Thr", "end_pos": 589, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr589", "evidence": [ { "id": "O14786", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "site_category": "reported", "site_seq": "S", "relation": "attached", "comment": "O-linked (Xyl...) (heparan sulfate) serine; alternate", "start_pos": 612, "start_aa": "Ser", "end_pos": 612, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser612", "evidence": [ { "id": "O14786", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14786#ptm_processing" }, { "id": "16763549", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/16763549" }, { "id": "27798666", "database": "Automatic Literature Mining", "url": "https://research.bioinformatics.udel.edu/glyco/pmid/27798666" }, { "id": "27798666", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/27798666" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "ATEKPTVIDSTIQSEFPTY", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 628, "start_aa": "Ala", "end_pos": 646, "end_aa": "Tyr", "evidence": [ { "id": "O14786", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G53434XO", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "", "start_pos": 637, "start_aa": "Ser", "end_pos": 637, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser637", "evidence": [ { "id": "O14786", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 638, "start_aa": "Thr", "end_pos": 638, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr638", "evidence": [ { "id": "O14786", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "IDETGSTPGYEGEGEGDK", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 824, "start_aa": "Ile", "end_pos": 841, "end_aa": "Lys", "evidence": [ { "id": "O14786", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "IDETGSTPGYEGEGEGDKNISR", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 824, "start_aa": "Ile", "end_pos": 845, "end_aa": "Arg", "evidence": [ { "id": "O14786", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 827, "start_aa": "Thr", "end_pos": 827, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr827", "evidence": [ { "id": "O14786", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 829, "start_aa": "Ser", "end_pos": 829, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser829", "evidence": [ { "id": "O14786", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "", "type": "O-linked", "subtype": "", "site_category": "reported", "site_seq": "S", "relation": "attached", "comment": "O-linked (Xyl...) (chondroitin sulfate) serine", "start_pos": 829, "start_aa": "Ser", "end_pos": 829, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser829", "evidence": [ { "id": "O14786", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14786#ptm_processing" }, { "id": "36213313", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/36213313" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "ST", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 829, "start_aa": "Ser", "end_pos": 830, "end_aa": "Thr", "evidence": [ { "id": "O14786", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G43417UB", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "", "start_pos": 830, "start_aa": "Thr", "end_pos": 830, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr830", "evidence": [ { "id": "O14786", "database": "UniCarbKB", "url": "" }, { "id": "30459171", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "T", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 830, "start_aa": "Thr", "end_pos": 830, "end_aa": "Thr", "residue": "Thr", "site_lbl": "Thr830", "evidence": [ { "id": "O14786", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 842, "start_aa": "Asn", "end_pos": 842, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn842", "evidence": [ { "id": "O14786", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14786#ptm_processing" } ] }, { "glytoucan_ac": "G57321FI", "type": "O-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "S", "relation": "attached", "comment": "Data provided by GlycoDomainViewer", "start_pos": 844, "start_aa": "Ser", "end_pos": 844, "end_aa": "Ser", "residue": "Ser", "site_lbl": "Ser844", "evidence": [ { "id": "O14786", "database": "UniCarbKB", "url": "" }, { "id": "23584533", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23584533" }, { "id": "10.1038/emboj.2013.79", "database": "DOI", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "glytoucan_ac": "G48414YA", "type": "N-linked", "subtype": "", "site_category": "reported_with_glycan", "site_seq": "N", "relation": "attached", "comment": "", "start_pos": 892, "start_aa": "Asn", "end_pos": 892, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn892", "evidence": [ { "id": "1557", "database": "GlyConnect", "url": "https://glyconnect.expasy.org/browser/proteins/1557" }, { "id": "29391424", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/29391424" } ] } ], "phosphorylation": [ { "start_pos": 894, "end_pos": 894, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" }, { "database": "iPTMnet", "id": "O14786", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14786" }, { "database": "PubMed", "id": "18578522", "url": "https://glygen.org/publication/PubMed/18578522" } ], "site_lbl": "Ser894" }, { "start_pos": 899, "end_pos": 899, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O14786", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14786" }, { "database": "PubMed", "id": "18578522", "url": "https://glygen.org/publication/PubMed/18578522" } ], "site_lbl": "Tyr899" }, { "start_pos": 920, "end_pos": 920, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "phospho.ELM", "id": "O14786", "url": "http://phospho.elm.eu.org/byAccession/O14786.html" }, { "database": "iPTMnet", "id": "O14786", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14786" }, { "database": "PubMed", "id": "18083107", "url": "https://glygen.org/publication/PubMed/18083107" } ], "site_lbl": "Tyr920" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan", "glycoprotein_predicted", "glycoprotein_reported" ], "publication": [ { "title": "Precision mapping of the human O-GalNAc glycoproteome through SimpleCell technology", "journal": "EMBO J", "date": "2013", "authors": "Steentoft C., Vakhrushev S.Y., Joshi H.J., Kong Y., Vester-Christensen M.B., Schjoldager K.T., Lavrsen K., Dabelsteen S., Pedersen N.B., Marcos-Silva L., Gupta R., Bennett E.P., Mandel U., Brunak S., Wandall H.H., Levery S.B., Clausen H.", "evidence": [ { "database": "UniCarbKB", "id": "O14786", "url": "" } ], "reference": [ { "type": "DOI", "id": "10.1038/emboj.2013.79", "url": "https://glygen.org/publication/DOI/10.1038/emboj.2013.79" } ] }, { "title": "Multisite autophosphorylation of p21-activated protein kinase gamma-PAK as a function of activation.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Gatti A, Huang Z, Tuazon PT, Traugh JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-399954", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-399954" } ], "reference": [ { "type": "PubMed", "id": "10075701", "url": "https://glygen.org/publication/PubMed/10075701" } ] }, { "title": "Biochemical purification of a mammalian slit protein as a positive regulator of sensory axon elongation and branching.", "journal": "Cell", "date": "1999", "authors": "Wang KH, Brose K, Arnott D, Kidd T, Goodman CS, Henzel W, Tessier-Lavigne M", "evidence": [ { "database": "Reactome", "id": "R-HSA-376176", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-376176" } ], "reference": [ { "type": "PubMed", "id": "10102266", "url": "https://glygen.org/publication/PubMed/10102266" } ] }, { "title": "Slit proteins bind Robo receptors and have an evolutionarily conserved role in repulsive axon guidance.", "journal": "Cell", "date": "1999", "authors": "Brose K, Bland KS, Wang KH, Arnott D, Henzel W, Goodman CS, Tessier-Lavigne M, Kidd T", "evidence": [ { "database": "Reactome", "id": "R-HSA-376176", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-376176" } ], "reference": [ { "type": "PubMed", "id": "10102268", "url": "https://glygen.org/publication/PubMed/10102268" } ] }, { "title": "Plexins are a large family of receptors for transmembrane, secreted and GPI-anchored semaphorins in vertebrates.", "journal": "Cell", "date": "1999", "authors": "Tamagnone L, Artigiani S, Chen H, He Z, Ming GI, Song H, Chedotal A, Winberg ML, Goodman CS, Poo M, Tessier-Lavigne M, Comoglio PM", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "reference": [ { "type": "PubMed", "id": "10520995", "url": "https://glygen.org/publication/PubMed/10520995" } ] }, { "title": "Activation of LIM-kinase by Pak1 couples Rac/Cdc42 GTPase signalling to actin cytoskeletal dynamics.", "journal": "Nature cell biology", "date": "1999", "authors": "Edwards DC, Sanders LC, Bokoch GM, Gill GN", "evidence": [ { "database": "Reactome", "id": "R-HSA-399954", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-399954" } ], "reference": [ { "type": "PubMed", "id": "10559936", "url": "https://glygen.org/publication/PubMed/10559936" } ] }, { "title": "Homophilic NCAM interactions interfere with L1 stimulated neurite outgrowth.", "journal": "FEBS letters", "date": "1999", "authors": "Kristiansen LV, Marques FA, Soroka V, Ronn LC, Kiselyov V, Pedersen N, Berezin V, Bock E", "evidence": [ { "database": "Reactome", "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144" } ], "reference": [ { "type": "PubMed", "id": "10611478", "url": "https://glygen.org/publication/PubMed/10611478" } ] }, { "title": "Semaphorins and their receptors in vertebrates and invertebrates.", "journal": "Current opinion in neurobiology", "date": "2000", "authors": "Raper JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-399955", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-399955" } ], "reference": [ { "type": "PubMed", "id": "10679438", "url": "https://glygen.org/publication/PubMed/10679438" } ] }, { "title": "Identification of a natural soluble neuropilin-1 that binds vascular endothelial growth factor: In vivo expression and antitumor activity.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2000-03-14", "authors": "Gagnon M L, Bielenberg D R, Gechtman Z, Miao H Q, Takashima S, Soker S, Klagsbrun M", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "reference": [ { "type": "PubMed", "id": "10688880", "url": "https://glygen.org/publication/PubMed/10688880" } ] }, { "title": "Neuropilin-2 is a receptor for the vascular endothelial growth factor (VEGF) forms VEGF-145 and VEGF-165 [corrected].", "journal": "The Journal of biological chemistry", "date": "2000-06-16", "authors": "Gluzman-Poltorak Z, Cohen T, Herzog Y, Neufeld G", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "reference": [ { "type": "PubMed", "id": "10748121", "url": "https://glygen.org/publication/PubMed/10748121" } ] }, { "title": "A MAP kinase-signaling pathway mediates neurite outgrowth on L1 and requires Src-dependent endocytosis.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2000", "authors": "Schmid RS, Pruitt WM, Maness PF", "evidence": [ { "database": "Reactome", "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144" } ], "reference": [ { "type": "PubMed", "id": "10818153", "url": "https://glygen.org/publication/PubMed/10818153" } ] }, { "title": "The interaction of neuropilin-1 with vascular endothelial growth factor and its receptor flt-1.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Fuh G, Garcia KC, de Vos AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-194306", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-194306" } ], "reference": [ { "type": "PubMed", "id": "10842181", "url": "https://glygen.org/publication/PubMed/10842181" } ] }, { "title": "Repulsive axon guidance: Abelson and Enabled play opposing roles downstream of the roundabout receptor.", "journal": "Cell", "date": "2000", "authors": "Bashaw GJ, Kidd T, Murray D, Pawson T, Goodman CS", "evidence": [ { "database": "Reactome", "id": "R-HSA-376176", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-376176" } ], "reference": [ { "type": "PubMed", "id": "10892742", "url": "https://glygen.org/publication/PubMed/10892742" } ] }, { "title": "Molecular basis of semaphorin-mediated axon guidance.", "journal": "Journal of neurobiology", "date": "2000", "authors": "Nakamura F, Kalb RG, Strittmatter SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-399955", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-399955" } ], "reference": [ { "type": "PubMed", "id": "10934324", "url": "https://glygen.org/publication/PubMed/10934324" } ] }, { "title": "Phosphorylation of cofilin by LIM-kinase is necessary for semaphorin 3A-induced growth cone collapse.", "journal": "Nature neuroscience", "date": "2001", "authors": "Aizawa H, Wakatsuki S, Ishii A, Moriyama K, Sasaki Y, Ohashi K, Sekine-Aizawa Y, Sehara-Fujisawa A, Mizuno K, Goshima Y, Yahara I", "evidence": [ { "database": "Reactome", "id": "R-HSA-399954", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-399954" } ], "reference": [ { "type": "PubMed", "id": "11276226", "url": "https://glygen.org/publication/PubMed/11276226" } ] }, { "title": "Vascular endothelial growth factor receptor-1 and neuropilin-2 form complexes.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Gluzman-Poltorak Z, Cohen T, Shibuya M, Neufeld G", "evidence": [ { "database": "Reactome", "id": "R-HSA-194306", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-194306" } ], "reference": [ { "type": "PubMed", "id": "11278319", "url": "https://glygen.org/publication/PubMed/11278319" } ] }, { "title": "The mechanism of PAK activation. Autophosphorylation events in both regulatory and kinase domains control activity.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Chong C, Tan L, Lim L, Manser E", "evidence": [ { "database": "Reactome", "id": "R-HSA-399954", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-399954" } ], "reference": [ { "type": "PubMed", "id": "11278486", "url": "https://glygen.org/publication/PubMed/11278486" } ] }, { "title": "Characterization of Slit protein interactions with glypican-1.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Ronca F, Andersen JS, Paech V, Margolis RU", "evidence": [ { "database": "Reactome", "id": "R-HSA-376176", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-376176" } ], "reference": [ { "type": "PubMed", "id": "11375980", "url": "https://glygen.org/publication/PubMed/11375980" } ] }, { "title": "Plexin signaling via off-track and rho family GTPases.", "journal": "Neuron", "date": "2001", "authors": "Whitford KL, Ghosh A", "evidence": [ { "database": "Reactome", "id": "R-HSA-399954", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-399954" } ], "reference": [ { "type": "PubMed", "id": "11604131", "url": "https://glygen.org/publication/PubMed/11604131" } ] }, { "title": "Selective induction of neuropilin-1 by vascular endothelial growth factor (VEGF): a mechanism contributing to VEGF-induced angiogenesis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2002", "authors": "Oh H, Takagi H, Otani A, Koyama S, Kemmochi S, Uemura A, Honda Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-194306", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-194306" } ], "reference": [ { "type": "PubMed", "id": "11756651", "url": "https://glygen.org/publication/PubMed/11756651" } ] }, { "title": "VEGF165 mediates formation of complexes containing VEGFR-2 and neuropilin-1 that enhance VEGF165-receptor binding.", "journal": "Journal of cellular biochemistry", "date": "2002", "authors": "Soker S, Miao HQ, Nomi M, Takashima S, Klagsbrun M", "evidence": [ { "database": "Reactome", "id": "R-HSA-194306", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-194306" } ], "reference": [ { "type": "PubMed", "id": "11948691", "url": "https://glygen.org/publication/PubMed/11948691" } ] }, { "title": "Neuropilin-1 binds vascular endothelial growth factor 165, placenta growth factor-2, and heparin via its b1b2 domain.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Mamluk R, Gechtman Z, Kutcher ME, Gasiunas N, Gallagher J, Klagsbrun M", "evidence": [ { "database": "Reactome", "id": "R-HSA-194306", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-194306" } ], "reference": [ { "type": "PubMed", "id": "11986311", "url": "https://glygen.org/publication/PubMed/11986311" } ] }, { "title": "Involvement of Fes/Fps tyrosine kinase in semaphorin3A signaling.", "journal": "The EMBO journal", "date": "2002", "authors": "Mitsui N, Inatome R, Takahashi S, Goshima Y, Yamamura H, Yanagi S", "evidence": [ { "database": "Reactome", "id": "R-HSA-399956", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-399956" } ], "reference": [ { "type": "PubMed", "id": "12093729", "url": "https://glygen.org/publication/PubMed/12093729" } ] }, { "title": "Fyn and Cdk5 mediate semaphorin-3A signaling, which is involved in regulation of dendrite orientation in cerebral cortex.", "journal": "Neuron", "date": "2002", "authors": "Sasaki Y, Cheng C, Uchida Y, Nakajima O, Ohshima T, Yagi T, Taniguchi M, Nakayama T, Kishida R, Kudo Y, Ohno S, Nakamura F, Goshima Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-399956", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-399956" } ], "reference": [ { "type": "PubMed", "id": "12372285", "url": "https://glygen.org/publication/PubMed/12372285" } ] }, { "title": "Type I gamma phosphatidylinositol phosphate kinase targets and regulates focal adhesions.", "journal": "Nature", "date": "2002", "authors": "Ling K, Doughman RL, Firestone AJ, Bunce MW, Anderson RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-399955", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-399955" } ], "reference": [ { "type": "PubMed", "id": "12422220", "url": "https://glygen.org/publication/PubMed/12422220" } ] }, { "title": "Cis and trans interactions of L1 with neuropilin-1 control axonal responses to semaphorin 3A.", "journal": "The EMBO journal", "date": "2002", "authors": "Castellani V, De Angelis E, Kenwrick S, Rougon G", "evidence": [ { "database": "Reactome", "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144" } ], "reference": [ { "type": "PubMed", "id": "12456642", "url": "https://glygen.org/publication/PubMed/12456642" } ] }, { "title": "Movement through Slits: cellular migration via the Slit family.", "journal": "BioEssays : news and reviews in molecular, cellular and developmental biology", "date": "2003", "authors": "Piper M, Little M", "evidence": [ { "database": "Reactome", "id": "R-HSA-376176", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-376176" } ], "reference": [ { "type": "PubMed", "id": "12508280", "url": "https://glygen.org/publication/PubMed/12508280" } ] }, { "title": "Crystal structure of the human neuropilin-1 b1 domain.", "journal": "Structure", "date": "2003", "authors": "Lee Christian C, Kreusch Andreas, McMullan Daniel, Ng Ken, Spraggon Glen", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "reference": [ { "type": "PubMed", "id": "12517344", "url": "https://glygen.org/publication/PubMed/12517344" } ] }, { "title": "Structural bases for CRMP function in plexin-dependent semaphorin3A signaling.", "journal": "The EMBO journal", "date": "2004", "authors": "Deo RC, Schmidt EF, Elhabazi A, Togashi H, Burley SK, Strittmatter SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-399956", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-399956" } ], "reference": [ { "type": "PubMed", "id": "14685275", "url": "https://glygen.org/publication/PubMed/14685275" } ] }, { "title": "Activation of EGF receptor kinase by L1-mediated homophilic cell interactions.", "journal": "Molecular biology of the cell", "date": "2004", "authors": "Islam R, Kristiansen LV, Romani S, Garcia-Alonso L, Hortsch M", "evidence": [ { "database": "Reactome", "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144" } ], "reference": [ { "type": "PubMed", "id": "14718570", "url": "https://glygen.org/publication/PubMed/14718570" } ] }, { "title": "Characterization of severe acute respiratory syndrome-associated coronavirus (SARS-CoV) spike glycoprotein-mediated viral entry.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Simmons G, Reeves JD, Rennekamp AJ, Amberg SM, Piefer AJ, Bates P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "15010527", "url": "https://glygen.org/publication/PubMed/15010527" } ] }, { "title": "Structural determinants of heparan sulfate interactions with Slit proteins.", "journal": "Biochemical and biophysical research communications", "date": "2004", "authors": "Zhang F, Ronca F, Linhardt RJ, Margolis RU", "evidence": [ { "database": "Reactome", "id": "R-HSA-376176", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-376176" } ], "reference": [ { "type": "PubMed", "id": "15063764", "url": "https://glygen.org/publication/PubMed/15063764" } ] }, { "title": "pH-dependent entry of severe acute respiratory syndrome coronavirus is mediated by the spike glycoprotein and enhanced by dendritic cell transfer through DC-SIGN.", "journal": "Journal of virology", "date": "2004", "authors": "Yang ZY, Huang Y, Ganesh L, Leung K, Kong WP, Schwartz O, Subbarao K, Nabel GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "15140961", "url": "https://glygen.org/publication/PubMed/15140961" } ] }, { "title": "S protein of severe acute respiratory syndrome-associated coronavirus mediates entry into hepatoma cell lines and is targeted by neutralizing antibodies in infected patients.", "journal": "Journal of virology", "date": "2004", "authors": "Hofmann H, Hattermann K, Marzi A, Gramberg T, Geier M, Krumbiegel M, Kuate S, Uberla K, Niedrig M, Pohlmann S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "15163706", "url": "https://glygen.org/publication/PubMed/15163706" } ] }, { "title": "Efficient assembly and release of SARS coronavirus-like particles by a heterologous expression system.", "journal": "FEBS letters", "date": "2004", "authors": "Mortola E, Roy P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "15474033", "url": "https://glygen.org/publication/PubMed/15474033" } ] }, { "title": "Adhesion molecule L1 stimulates neuronal migration through Vav2-Pak1 signaling.", "journal": "Neuroreport", "date": "2004", "authors": "Schmid RS, Midkiff BR, Kedar VP, Maness PF", "evidence": [ { "database": "Reactome", "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144" } ], "reference": [ { "type": "PubMed", "id": "15597056", "url": "https://glygen.org/publication/PubMed/15597056" } ] }, { "title": "GSK-3beta regulates phosphorylation of CRMP-2 and neuronal polarity.", "journal": "Cell", "date": "2005", "authors": "Yoshimura T, Kawano Y, Arimura N, Kawabata S, Kikuchi A, Kaibuchi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-399956", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-399956" } ], "reference": [ { "type": "PubMed", "id": "15652488", "url": "https://glygen.org/publication/PubMed/15652488" } ] }, { "title": "Semaphorin3A signalling is mediated via sequential Cdk5 and GSK3beta phosphorylation of CRMP2: implication of common phosphorylating mechanism underlying axon guidance and Alzheimer's disease.", "journal": "Genes to cells : devoted to molecular & cellular mechanisms", "date": "2005", "authors": "Uchida Y, Ohshima T, Sasaki Y, Suzuki H, Yanai S, Yamashita N, Nakamura F, Takei K, Ihara Y, Mikoshiba K, Kolattukudy P, Honnorat J, Goshima Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-399956", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-399956" } ], "reference": [ { "type": "PubMed", "id": "15676027", "url": "https://glygen.org/publication/PubMed/15676027" } ] }, { "title": "FARP2 triggers signals for Sema3A-mediated axonal repulsion.", "journal": "Nature neuroscience", "date": "2005", "authors": "Toyofuku T, Yoshida J, Sugimoto T, Zhang H, Kumanogoh A, Hori M, Kikutani H", "evidence": [ { "database": "Reactome", "id": "R-HSA-399955", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-399955" } ], "reference": [ { "type": "PubMed", "id": "16286926", "url": "https://glygen.org/publication/PubMed/16286926" } ] }, { "title": "Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.", "journal": "Journal of proteome research", "date": "2005", "authors": "Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786#ptm_processing" }, { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "reference": [ { "type": "PubMed", "id": "16335952", "url": "https://glygen.org/publication/PubMed/16335952" } ] }, { "title": "Glycosaminoglycan modification of neuropilin-1 modulates VEGFR2 signaling.", "journal": "The EMBO journal", "date": "2006", "authors": "Shintani Y, Takashima S, Asano Y, Kato H, Liao Y, Yamazaki S, Tsukamoto O, Seguchi O, Yamamoto H, Fukushima T, Sugahara K, Kitakaze M, Hori M", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786#ptm_processing" }, { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" }, { "database": "Reactome", "id": "R-HSA-194306", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-194306" } ], "reference": [ { "type": "PubMed", "id": "16763549", "url": "https://glygen.org/publication/PubMed/16763549" } ] }, { "title": "Repulsion or adhesion: receptors make the call.", "journal": "Current opinion in cell biology", "date": "2006", "authors": "Halloran MC, Wolman MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-399955", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-399955" } ], "reference": [ { "type": "PubMed", "id": "16930978", "url": "https://glygen.org/publication/PubMed/16930978" } ] }, { "title": "A highly potent inhibitor of cathepsin K (relacatib) reduces biomarkers of bone resorption both in vitro and in an acute model of elevated bone turnover in vivo in monkeys.", "journal": "Bone", "date": "2007", "authors": "Kumar S, Dare L, Vasko-Moser JA, James IE, Blake SM, Rickard DJ, Hwang SM, Tomaszek T, Yamashita DS, Marquis RW, Oh H, Jeong JU, Veber DF, Gowen M, Lark MW, Stroup G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "16962401", "url": "https://glygen.org/publication/PubMed/16962401" } ] }, { "title": "Serine phosphorylation by casein kinase II controls endocytic L1 trafficking and axon growth.", "journal": "Journal of neuroscience research", "date": "2007", "authors": "Nakata A, Kamiguchi H", "evidence": [ { "database": "Reactome", "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144" } ], "reference": [ { "type": "PubMed", "id": "17253643", "url": "https://glygen.org/publication/PubMed/17253643" } ] }, { "title": "Slit-2/Robo-1 modulates the CXCL12/CXCR4-induced chemotaxis of T cells.", "journal": "Journal of leukocyte biology", "date": "2007", "authors": "Prasad A, Qamri Z, Wu J, Ganju RK", "evidence": [ { "database": "Reactome", "id": "R-HSA-376176", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-376176" } ], "reference": [ { "type": "PubMed", "id": "17565045", "url": "https://glygen.org/publication/PubMed/17565045" } ] }, { "title": "The CRMP family of proteins and their role in Sema3A signaling.", "journal": "Advances in experimental medicine and biology", "date": "2007", "authors": "Schmidt EF, Strittmatter SM", "evidence": [ { "database": "Reactome", "id": "R-HSA-399956", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-399956" } ], "reference": [ { "type": "PubMed", "id": "17607942", "url": "https://glygen.org/publication/PubMed/17607942" } ] }, { "title": "Intracellular kinases in semaphorin signaling.", "journal": "Advances in experimental medicine and biology", "date": "2007", "authors": "Ahmed A, Eickholt BJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-399956", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-399956" } ], "reference": [ { "type": "PubMed", "id": "17607944", "url": "https://glygen.org/publication/PubMed/17607944" } ] }, { "title": "Structural studies of neuropilin/antibody complexes provide insights into semaphorin and VEGF binding.", "journal": "The EMBO journal", "date": "2007", "authors": "Appleton BA, Wu P, Maloney J, Yin J, Liang WC, Stawicki S, Mortara K, Bowman KK, Elliott JM, Desmarais W, Bazan JF, Bagri A, Tessier-Lavigne M, Koch AW, Wu Y, Watts RJ, Wiesmann C", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786#ptm_processing" }, { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "reference": [ { "type": "PubMed", "id": "17989695", "url": "https://glygen.org/publication/PubMed/17989695" } ] }, { "title": "Global survey of phosphotyrosine signaling identifies oncogenic kinases in lung cancer.", "journal": "Cell", "date": "2007", "authors": "Rikova K, Guo A, Zeng Q, Possemato A, Yu J, Haack H, Nardone J, Lee K, Reeves C, Li Y, Hu Y, Tan Z, Stokes M, Sullivan L, Mitchell J, Wetzel R, Macneill J, Ren JM, Yuan J, Bakalarski CE, Villen J, Kornhauser JM, Smith B, Li D, Zhou X, Gygi SP, Gu TL, Polakiewicz RD, Rush J, Comb MJ", "evidence": [ { "database": "iPTMnet", "id": "O14786", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14786" } ], "reference": [ { "type": "PubMed", "id": "18083107", "url": "https://glygen.org/publication/PubMed/18083107" } ] }, { "title": "Fibronectin type III (FN3) modules of the neuronal cell adhesion molecule L1 interact directly with the fibroblast growth factor (FGF) receptor.", "journal": "Molecular and cellular neurosciences", "date": "2008", "authors": "Kulahin N, Li S, Hinsby A, Kiselyov V, Berezin V, Bock E", "evidence": [ { "database": "Reactome", "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144" } ], "reference": [ { "type": "PubMed", "id": "18222703", "url": "https://glygen.org/publication/PubMed/18222703" } ] }, { "title": "The RGD integrin binding site in human L1-CAM is important for nuclear signaling.", "journal": "Experimental cell research", "date": "2008", "authors": "Gast D, Riedle S, Kiefel H, Muerkoster SS, Schafer H, Schafer MK, Altevogt P", "evidence": [ { "database": "Reactome", "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144" } ], "reference": [ { "type": "PubMed", "id": "18555990", "url": "https://glygen.org/publication/PubMed/18555990" } ] }, { "title": "TiO(2)-based phosphoproteomic analysis of the plasma membrane and the effects of phosphatase inhibitor treatment.", "journal": "Journal of proteome research", "date": "2008", "authors": "Thingholm TE, Larsen MR, Ingrell CR, Kassem M, Jensen ON", "evidence": [ { "database": "iPTMnet", "id": "O14786-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14786-1" } ], "reference": [ { "type": "PubMed", "id": "18578522", "url": "https://glygen.org/publication/PubMed/18578522" } ] }, { "title": "Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.", "journal": "Journal of proteome research", "date": "2009", "authors": "Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786#ptm_processing" }, { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "reference": [ { "type": "PubMed", "id": "19159218", "url": "https://glygen.org/publication/PubMed/19159218" } ] }, { "title": "C-end rule peptides mediate neuropilin-1-dependent cell, vascular, and tissue penetration.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009-09-22", "authors": "Teesalu Tambet, Sugahara Kazuki N, Kotamraju Venkata Ramana, Ruoslahti Erkki", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "reference": [ { "type": "PubMed", "id": "19805273", "url": "https://glygen.org/publication/PubMed/19805273" } ] }, { "title": "Proteomic analysis of potential keratan sulfate, chondroitin sulfate A, and hyaluronic acid molecular interactions.", "journal": "Investigative ophthalmology & visual science", "date": "2010", "authors": "Conrad AH, Zhang Y, Tasheva ES, Conrad GW", "evidence": [ { "database": "Reactome", "id": "R-HSA-376176", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-376176" } ], "reference": [ { "type": "PubMed", "id": "20375348", "url": "https://glygen.org/publication/PubMed/20375348" } ] }, { "title": "A transmembrane serine protease is linked to the severe acute respiratory syndrome coronavirus receptor and activates virus entry.", "journal": "Journal of virology", "date": "2011", "authors": "Shulla A, Heald-Sargent T, Subramanya G, Zhao J, Perlman S, Gallagher T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "21068237", "url": "https://glygen.org/publication/PubMed/21068237" } ] }, { "title": "Evidence that TMPRSS2 activates the severe acute respiratory syndrome coronavirus spike protein for membrane fusion and reduces viral control by the humoral immune response.", "journal": "Journal of virology", "date": "2011", "authors": "Glowacka I, Bertram S, Muller MA, Allen P, Soilleux E, Pfefferle S, Steffen I, Tsegaye TS, He Y, Gnirss K, Niemeyer D, Schneider H, Drosten C, Pohlmann S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "21325420", "url": "https://glygen.org/publication/PubMed/21325420" } ] }, { "title": "MEK1/2 dual-specificity protein kinases: structure and regulation.", "journal": "Biochemical and biophysical research communications", "date": "2012", "authors": "Roskoski R Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144" } ], "reference": [ { "type": "PubMed", "id": "22177953", "url": "https://glygen.org/publication/PubMed/22177953" } ] }, { "title": "Simultaneous treatment of human bronchial epithelial cells with serine and cysteine protease inhibitors prevents severe acute respiratory syndrome coronavirus entry.", "journal": "Journal of virology", "date": "2012", "authors": "Kawase M, Shirato K, van der Hoek L, Taguchi F, Matsuyama S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "22496216", "url": "https://glygen.org/publication/PubMed/22496216" } ] }, { "title": "Mechanisms of coronavirus cell entry mediated by the viral spike protein.", "journal": "Viruses", "date": "2012", "authors": "Belouzard S, Millet JK, Licitra BN, Whittaker GR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "22816037", "url": "https://glygen.org/publication/PubMed/22816037" } ] }, { "title": "The neural cell adhesion molecule N-CAM enhances L1-dependent cell-cell interactions.", "journal": "The Journal of cell biology", "date": "1990", "authors": "Kadmon G, Kowitz A, Altevogt P, Schachner M", "evidence": [ { "database": "Reactome", "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144" } ], "reference": [ { "type": "PubMed", "id": "2295682", "url": "https://glygen.org/publication/PubMed/2295682" } ] }, { "title": "Quantification of the N-glycosylated secretome by super-SILAC during breast cancer progression and in human blood samples.", "journal": "Molecular & cellular proteomics : MCP", "date": "2013", "authors": "Boersema PJ, Geiger T, Wisniewski JR, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "23090970", "url": "https://glygen.org/publication/PubMed/23090970" } ] }, { "title": "Effects of some antituberculous and anti-leprotic drugs on cathepsins B, H and L.", "journal": "Indian journal of clinical biochemistry : IJCB", "date": "2003", "authors": "Kamboj RC, Raghav N, Mittal A, Khurana S, Sadana R, Singh H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "23105391", "url": "https://glygen.org/publication/PubMed/23105391" } ] }, { "title": "Precision mapping of the human O-GalNAc glycoproteome through SimpleCell technology.", "journal": "The EMBO journal", "date": "2013", "authors": "Steentoft C, Vakhrushev SY, Joshi HJ, Kong Y, Vester-Christensen MB, Schjoldager KT, Lavrsen K, Dabelsteen S, Pedersen NB, Marcos-Silva L, Gupta R, Bennett EP, Mandel U, Brunak S, Wandall HH, Levery SB, Clausen H", "evidence": [ { "database": "UniCarbKB", "id": "O14786", "url": "" } ], "reference": [ { "type": "PubMed", "id": "23584533", "url": "https://glygen.org/publication/PubMed/23584533" } ] }, { "title": "Mitogen-activated protein kinases in innate immunity.", "journal": "Nature reviews. Immunology", "date": "2013", "authors": "Arthur JS, Ley SC", "evidence": [ { "database": "Reactome", "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144" } ], "reference": [ { "type": "PubMed", "id": "23954936", "url": "https://glygen.org/publication/PubMed/23954936" } ] }, { "title": "N-linked glycosylation enrichment for in-depth cell surface proteomics of diffuse large B-cell lymphoma subtypes.", "journal": "Molecular & cellular proteomics : MCP", "date": "2014", "authors": "Deeb SJ, Cox J, Schmidt-Supprian M, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "24190977", "url": "https://glygen.org/publication/PubMed/24190977" } ] }, { "title": "TMPRSS2 and ADAM17 cleave ACE2 differentially and only proteolysis by TMPRSS2 augments entry driven by the severe acute respiratory syndrome coronavirus spike protein.", "journal": "Journal of virology", "date": "2014", "authors": "Heurich A, Hofmann-Winkler H, Gierer S, Liepold T, Jahn O, Pohlmann S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "24227843", "url": "https://glygen.org/publication/PubMed/24227843" } ] }, { "title": "Genome-Wide Screen Reveals Valosin-Containing Protein Requirement for Coronavirus Exit from Endosomes.", "journal": "Journal of virology", "date": "2015", "authors": "Wong HH, Kumar P, Tay FP, Moreau D, Liu DX, Bard F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "26311884", "url": "https://glygen.org/publication/PubMed/26311884" } ] }, { "title": "CMT2D neuropathy is linked to the neomorphic binding activity of glycyl-tRNA synthetase.", "journal": "Nature", "date": "2015", "authors": "He W, Bai G, Zhou H, Wei N, White NM, Lauer J, Liu H, Shi Y, Dumitru CD, Lettieri K, Shubayev V, Jordanova A, Guergueltcheva V, Griffin PR, Burgess RW, Pfaff SL, Yang XL", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "reference": [ { "type": "PubMed", "id": "26503042", "url": "https://glygen.org/publication/PubMed/26503042" } ] }, { "title": "Corrigendum: CMT2D neuropathy is linked to the neomorphic binding activity of glycyl-tRNA synthetase.", "journal": "Nature", "date": "2016", "authors": "He Weiwei, Bai Ge, Zhou Huihao, Wei Na, White Nicholas M, Lauer Janelle, Liu Huaqing, Shi Yi, Dan Dumitru Calin, Lettieri Karen, Shubayev Veronica, Jordanova Albena, Guergueltcheva Velina, Griffin Patrick R, Burgess Robert W, Pfaff Samuel L, Yang Xiang-Lei", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "reference": [ { "type": "PubMed", "id": "26789244", "url": "https://glygen.org/publication/PubMed/26789244" } ] }, { "title": "Glycopeptide Antibiotics Potently Inhibit Cathepsin L in the Late Endosome/Lysosome and Block the Entry of Ebola Virus, Middle East Respiratory Syndrome Coronavirus (MERS-CoV), and Severe Acute Respiratory Syndrome Coronavirus (SARS-CoV).", "journal": "The Journal of biological chemistry", "date": "2016", "authors": "Zhou N, Pan T, Zhang J, Li Q, Zhang X, Bai C, Huang F, Peng T, Zhang J, Liu C, Tao L, Zhang H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "26953343", "url": "https://glygen.org/publication/PubMed/26953343" } ] }, { "title": "In vitro characterization of TMPRSS2 inhibition in IPEC-J2 cells.", "journal": "Journal of enzyme inhibition and medicinal chemistry", "date": "2016", "authors": "Paszti-Gere E, Czimmermann E, Ujhelyi G, Balla P, Maiwald A, Steinmetzer T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "27277342", "url": "https://glygen.org/publication/PubMed/27277342" } ] }, { "title": "Identification of Nafamostat as a Potent Inhibitor of Middle East Respiratory Syndrome Coronavirus S Protein-Mediated Membrane Fusion Using the Split-Protein-Based Cell-Cell Fusion Assay.", "journal": "Antimicrobial agents and chemotherapy", "date": "2016", "authors": "Yamamoto M, Matsuyama S, Li X, Takeda M, Kawaguchi Y, Inoue JI, Matsuda Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "27550352", "url": "https://glygen.org/publication/PubMed/27550352" } ] }, { "title": "A Novel Physiological Glycosaminoglycan-Deficient Splice Variant of Neuropilin-1 Is Anti-Tumorigenic In Vitro and In Vivo.", "journal": "PloS one", "date": "2016", "authors": "Hendricks C, Dubail J, Brohee L, Delforge Y, Colige A, Deroanne C", "evidence": [ { "database": "Automatic Literature Mining", "id": "27798666", "url": "https://research.bioinformatics.udel.edu/glyco/pmid/27798666" } ], "reference": [ { "type": "PubMed", "id": "27798666", "url": "https://glygen.org/publication/PubMed/27798666" } ] }, { "title": "Large-scale intact glycopeptide identification by Mascot database search.", "journal": "Scientific reports", "date": "2018", "authors": "Bollineni RC, Koehler CJ, Gislefoss RE, Anonsen JH, Thiede B", "evidence": [ { "database": "GlyConnect", "id": "1557", "url": "https://glyconnect.expasy.org/browser/proteins/1557" } ], "reference": [ { "type": "PubMed", "id": "29391424", "url": "https://glygen.org/publication/PubMed/29391424" } ] }, { "title": "Site-Specific Profiling of Serum Glycoproteins Using N-Linked Glycan and Glycosite Analysis Revealing Atypical N-Glycosylation Sites on Albumin and alpha-1B-Glycoprotein.", "journal": "Analytical chemistry", "date": "2018", "authors": "Sun S, Hu Y, Jia L, Eshghi ST, Liu Y, Shah P, Zhang H", "evidence": [ { "database": "UniCarbKB", "id": "O14786", "url": "" }, { "database": "GlyConnect", "id": "1557", "url": "https://glyconnect.expasy.org/browser/proteins/1557" } ], "reference": [ { "type": "PubMed", "id": "29671580", "url": "https://glygen.org/publication/PubMed/29671580" } ] }, { "title": "Reanalysis of Global Proteomic and Phosphoproteomic Data Identified a Large Number of Glycopeptides.", "journal": "Analytical chemistry", "date": "2018", "authors": "Hu Y, Shah P, Clark DJ, Ao M, Zhang H", "evidence": [ { "database": "GlyConnect", "id": "1557", "url": "https://glyconnect.expasy.org/browser/proteins/1557" } ], "reference": [ { "type": "PubMed", "id": "29741879", "url": "https://glygen.org/publication/PubMed/29741879" } ] }, { "title": "Mapping the O-glycoproteome using site-specific extraction of O-linked glycopeptides (EXoO).", "journal": "Molecular systems biology", "date": "2018", "authors": "Yang W, Ao M, Hu Y, Li QK, Zhang H", "evidence": [ { "database": "UniCarbKB", "id": "O14786", "url": "" } ], "reference": [ { "type": "PubMed", "id": "30459171", "url": "https://glygen.org/publication/PubMed/30459171" } ] }, { "title": "Neuropilin-1 Controls Endothelial Homeostasis by Regulating Mitochondrial Function and Iron-Dependent Oxidative Stress.", "journal": "iScience", "date": "2019-01-25", "authors": "Issitt Theo, Bosseboeuf Emy, De Winter Natasha, Dufton Neil, Gestri Gaia, Senatore Valentina, Chikh Anissa, Randi Anna M, Raimondi Claudio", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "reference": [ { "type": "PubMed", "id": "30623799", "url": "https://glygen.org/publication/PubMed/30623799" } ] }, { "title": "Angiotensin-converting enzyme 2 (ACE2) as a SARS-CoV-2 receptor: molecular mechanisms and potential therapeutic target.", "journal": "Intensive care medicine", "date": "2020", "authors": "Zhang H, Penninger JM, Li Y, Zhong N, Slutsky AS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "32125455", "url": "https://glygen.org/publication/PubMed/32125455" } ] }, { "title": "Quantitative Longitudinal Inventory of the N-Glycoproteome of Human Milk from a Single Donor Reveals the Highly Variable Repertoire and Dynamic Site-Specific Changes.", "journal": "Journal of proteome research", "date": "2020", "authors": "Zhu J, Lin YH, Dingess KA, Mank M, Stahl B, Heck AJR", "evidence": [ { "database": "GlyConnect", "id": "1557", "url": "https://glyconnect.expasy.org/browser/proteins/1557" } ], "reference": [ { "type": "PubMed", "id": "32125861", "url": "https://glygen.org/publication/PubMed/32125861" } ] }, { "title": "SARS-CoV-2 Cell Entry Depends on ACE2 and TMPRSS2 and Is Blocked by a Clinically Proven Protease Inhibitor.", "journal": "Cell", "date": "2020", "authors": "Hoffmann M, Kleine-Weber H, Schroeder S, Kruger N, Herrler T, Erichsen S, Schiergens TS, Herrler G, Wu NH, Nitsche A, Muller MA, Drosten C, Pohlmann S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "32142651", "url": "https://glygen.org/publication/PubMed/32142651" } ] }, { "title": "Teicoplanin: an alternative drug for the treatment of COVID-19?", "journal": "International journal of antimicrobial agents", "date": "2020", "authors": "Baron SA, Devaux C, Colson P, Raoult D, Rolain JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "32179150", "url": "https://glygen.org/publication/PubMed/32179150" } ] }, { "title": "A Multibasic Cleavage Site in the Spike Protein of SARS-CoV-2 Is Essential for Infection of Human Lung Cells.", "journal": "Molecular cell", "date": "2020", "authors": "Hoffmann M, Kleine-Weber H, Pohlmann S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "32362314", "url": "https://glygen.org/publication/PubMed/32362314" } ] }, { "title": "Proteolytic Cleavage of the SARS-CoV-2 Spike Protein and the Role of the Novel S1/S2 Site.", "journal": "iScience", "date": "2020", "authors": "Jaimes JA, Millet JK, Whittaker GR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "32512386", "url": "https://glygen.org/publication/PubMed/32512386" } ] }, { "title": "The role of furin cleavage site in SARS-CoV-2 spike protein-mediated membrane fusion in the presence or absence of trypsin.", "journal": "Signal transduction and targeted therapy", "date": "2020", "authors": "Xia S, Lan Q, Su S, Wang X, Xu W, Liu Z, Zhu Y, Wang Q, Lu L, Jiang S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "32532959", "url": "https://glygen.org/publication/PubMed/32532959" } ] }, { "title": "Characterization of heparin and severe acute respiratory syndrome-related coronavirus 2 (SARS-CoV-2) spike glycoprotein binding interactions.", "journal": "Antiviral research", "date": "2020", "authors": "Kim SY, Jin W, Sood A, Montgomery DW, Grant OC, Fuster MM, Fu L, Dordick JS, Woods RJ, Zhang F, Linhardt RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "32653452", "url": "https://glygen.org/publication/PubMed/32653452" } ] }, { "title": "TMPRSS2 and furin are both essential for proteolytic activation of SARS-CoV-2 in human airway cells.", "journal": "Life science alliance", "date": "2020", "authors": "Bestle D, Heindl MR, Limburg H, Van Lam van T, Pilgram O, Moulton H, Stein DA, Hardes K, Eickmann M, Dolnik O, Rohde C, Klenk HD, Garten W, Steinmetzer T, Bottcher-Friebertshauser E", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "32703818", "url": "https://glygen.org/publication/PubMed/32703818" } ] }, { "title": "SARS-CoV-2 Infection Depends on Cellular Heparan Sulfate and ACE2.", "journal": "Cell", "date": "2020", "authors": "Clausen TM, Sandoval DR, Spliid CB, Pihl J, Perrett HR, Painter CD, Narayanan A, Majowicz SA, Kwong EM, McVicar RN, Thacker BE, Glass CA, Yang Z, Torres JL, Golden GJ, Bartels PL, Porell RN, Garretson AF, Laubach L, Feldman J, Yin X, Pu Y, Hauser BM, Caradonna TM, Kellman BP, Martino C, Gordts PLSM, Chanda SK, Schmidt AG, Godula K, Leibel SL, Jose J, Corbett KD, Ward AB, Carlin AF, Esko JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "32970989", "url": "https://glygen.org/publication/PubMed/32970989" } ] }, { "title": "KIM-1/TIM-1 is a Receptor for SARS-CoV-2 in Lung and Kidney.", "journal": "medRxiv : the preprint server for health sciences", "date": "2022", "authors": "Mori Y, Fink C, Ichimura T, Sako K, Mori M, Lee NN, Aschauer P, Padmanabha Das KM, Hong S, Song M, Padera RF, Weins A, Lee LP, Nasr ML, Dekaban GA, Dikeakos JD, Bonventre JV", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "32995803", "url": "https://glygen.org/publication/PubMed/32995803" } ] }, { "title": "Neuropilin-1 as a new potential SARS-CoV-2 infection mediator implicated in the neurologic features and central nervous system involvement of COVID-19.", "journal": "Mol. Med. Report.", "date": "2020", "authors": "Davies Julie, Randeva Harpal S, Chatha Kamaljit, Hall Marcia, Spandidos Demetrios A, Karteris Emmanouil, Kyrou Ioannis", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "reference": [ { "type": "PubMed", "id": "33000221", "url": "https://glygen.org/publication/PubMed/33000221" } ] }, { "title": "Neuropilin-1 facilitates SARS-CoV-2 cell entry and infectivity.", "journal": "Science (New York, N.Y.)", "date": "2020", "authors": "Cantuti-Castelvetri L, Ojha R, Pedro LD, Djannatian M, Franz J, Kuivanen S, van der Meer F, Kallio K, Kaya T, Anastasina M, Smura T, Levanov L, Szirovicza L, Tobi A, Kallio-Kokko H, Osterlund P, Joensuu M, Meunier FA, Butcher SJ, Winkler MS, Mollenhauer B, Helenius A, Gokce O, Teesalu T, Hepojoki J, Vapalahti O, Stadelmann C, Balistreri G, Simons M", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" }, { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "33082293", "url": "https://glygen.org/publication/PubMed/33082293" } ] }, { "title": "Neuropilin-1 is a host factor for SARS-CoV-2 infection.", "journal": "Science (New York, N.Y.)", "date": "2020", "authors": "Daly JL, Simonetti B, Klein K, Chen KE, Williamson MK, Anton-Plagaro C, Shoemark DK, Simon-Gracia L, Bauer M, Hollandi R, Greber UF, Horvath P, Sessions RB, Helenius A, Hiscox JA, Teesalu T, Matthews DA, Davidson AD, Collins BM, Cullen PJ, Yamauchi Y", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" }, { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" }, { "database": "RefSeq", "id": "NP_001019799", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001019799" } ], "reference": [ { "type": "PubMed", "id": "33082294", "url": "https://glygen.org/publication/PubMed/33082294" } ] }, { "title": "Heparan sulfate assists SARS-CoV-2 in cell entry and can be targeted by approved drugs in vitro.", "journal": "Cell discovery", "date": "2020", "authors": "Zhang Q, Chen CZ, Swaroop M, Xu M, Wang L, Lee J, Wang AQ, Pradhan M, Hagen N, Chen L, Shen M, Luo Z, Xu X, Xu Y, Huang W, Zheng W, Ye Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "33298900", "url": "https://glygen.org/publication/PubMed/33298900" } ] }, { "title": "Furin cleavage of SARS-CoV-2 Spike promotes but is not essential for infection and cell-cell fusion.", "journal": "PLoS pathogens", "date": "2021", "authors": "Papa G, Mallery DL, Albecka A, Welch LG, Cattin-Ortola J, Luptak J, Paul D, McMahon HT, Goodfellow IG, Carter A, Munro S, James LC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "33493182", "url": "https://glygen.org/publication/PubMed/33493182" } ] }, { "title": "Kidney injury molecule-1 is a potential receptor for SARS-CoV-2.", "journal": "Journal of molecular cell biology", "date": "2021", "authors": "Yang C, Zhang Y, Zeng X, Chen H, Chen Y, Yang D, Shen Z, Wang X, Liu X, Xiong M, Chen H, Huang K", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "33493263", "url": "https://glygen.org/publication/PubMed/33493263" } ] }, { "title": "Loss of furin cleavage site attenuates SARS-CoV-2 pathogenesis.", "journal": "Nature", "date": "2021", "authors": "Johnson BA, Xie X, Bailey AL, Kalveram B, Lokugamage KG, Muruato A, Zou J, Zhang X, Juelich T, Smith JK, Zhang L, Bopp N, Schindewolf C, Vu M, Vanderheiden A, Winkler ES, Swetnam D, Plante JA, Aguilar P, Plante KS, Popov V, Lee B, Weaver SC, Suthar MS, Routh AL, Ren P, Ku Z, An Z, Debbink K, Diamond MS, Shi PY, Freiberg AN, Menachery VD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "33494095", "url": "https://glygen.org/publication/PubMed/33494095" } ] }, { "title": "SARS-CoV-2 S protein:ACE2 interaction reveals novel allosteric targets.", "journal": "eLife", "date": "2021", "authors": "Raghuvamsi PV, Tulsian NK, Samsudin F, Qian X, Purushotorman K, Yue G, Kozma MM, Hwa WY, Lescar J, Bond PJ, MacAry PA, Anand GS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "33554856", "url": "https://glygen.org/publication/PubMed/33554856" } ] }, { "title": "Cathepsin L plays a key role in SARS-CoV-2 infection in humans and humanized mice and is a promising target for new drug development.", "journal": "Signal transduction and targeted therapy", "date": "2021", "authors": "Zhao MM, Yang WL, Yang FY, Zhang L, Huang WJ, Hou W, Fan CF, Jin RH, Feng YM, Wang YC, Yang JK", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "33774649", "url": "https://glygen.org/publication/PubMed/33774649" } ] }, { "title": "Glycosylation is a key in SARS-CoV-2 infection.", "journal": "Journal of molecular medicine (Berlin, Germany)", "date": "2021", "authors": "Reis CA, Tauber R, Blanchard V", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "34023935", "url": "https://glygen.org/publication/PubMed/34023935" } ] }, { "title": "TMPRSS2 expression dictates the entry route used by SARS-CoV-2 to infect host cells.", "journal": "The EMBO journal", "date": "2021", "authors": "Koch J, Uckeley ZM, Doldan P, Stanifer M, Boulant S, Lozach PY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "34159616", "url": "https://glygen.org/publication/PubMed/34159616" } ] }, { "title": "Heparan Sulfate Facilitates Spike Protein-Mediated SARS-CoV-2 Host Cell Invasion and Contributes to Increased Infection of SARS-CoV-2 G614 Mutant and in Lung Cancer.", "journal": "Frontiers in molecular biosciences", "date": "2021", "authors": "Yue J, Jin W, Yang H, Faulkner J, Song X, Qiu H, Teng M, Azadi P, Zhang F, Linhardt RJ, Wang L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "34179075", "url": "https://glygen.org/publication/PubMed/34179075" } ] }, { "title": "Heparan Sulfate Proteoglycans as Attachment Factor for SARS-CoV-2.", "journal": "ACS central science", "date": "2021", "authors": "Liu L, Chopra P, Li X, Bouwman KM, Tompkins SM, Wolfert MA, de Vries RP, Boons GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "34235261", "url": "https://glygen.org/publication/PubMed/34235261" } ] }, { "title": "Glycosylation of SARS-CoV-2: structural and functional insights.", "journal": "Analytical and bioanalytical chemistry", "date": "2021", "authors": "Shajahan A, Pepi LE, Rouhani DS, Heiss C, Azadi P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "34235568", "url": "https://glygen.org/publication/PubMed/34235568" } ] }, { "title": "SARS-CoV-2 pseudovirus infectivity and expression of viral entry-related factors ACE2, TMPRSS2, Kim-1, and NRP-1 in human cells from the respiratory, urinary, digestive, reproductive, and immune systems.", "journal": "Journal of medical virology", "date": "2021", "authors": "Zhang F, Li W, Feng J, Ramos da Silva S, Ju E, Zhang H, Chang Y, Moore PS, Guo H, Gao SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "34324210", "url": "https://glygen.org/publication/PubMed/34324210" } ] }, { "title": "Genome-wide CRISPR activation screen identifies candidate receptors for SARS-CoV-2 entry.", "journal": "Science China. Life sciences", "date": "2022", "authors": "Zhu S, Liu Y, Zhou Z, Zhang Z, Xiao X, Liu Z, Chen A, Dong X, Tian F, Chen S, Xu Y, Wang C, Li Q, Niu X, Pan Q, Du S, Xiao J, Wang J, Wei W", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "34431042", "url": "https://glygen.org/publication/PubMed/34431042" } ] }, { "title": "Infection and transmission of SARS-CoV-2 depend on heparan sulfate proteoglycans.", "journal": "The EMBO journal", "date": "2021", "authors": "Bermejo-Jambrina M, Eder J, Kaptein TM, van Hamme JL, Helgers LC, Vlaming KE, Brouwer PJM, van Nuenen AC, Spaargaren M, de Bree GJ, Nijmeijer BM, Kootstra NA, van Gils MJ, Sanders RW, Geijtenbeek TBH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "34510494", "url": "https://glygen.org/publication/PubMed/34510494" } ] }, { "title": "SARS-CoV-2 S glycoprotein binding to multiple host receptors enables cell entry and infection.", "journal": "Glycoconjugate journal", "date": "2021", "authors": "Trbojevic-Akmacic I, Petrovic T, Lauc G", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "34542788", "url": "https://glygen.org/publication/PubMed/34542788" } ] }, { "title": "Proteolytic activation of SARS-CoV-2 spike protein.", "journal": "Microbiology and immunology", "date": "2022", "authors": "Takeda M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "34561887", "url": "https://glygen.org/publication/PubMed/34561887" } ] }, { "title": "Mechanisms of SARS-CoV-2 entry into cells.", "journal": "Nature reviews. Molecular cell biology", "date": "2022", "authors": "Jackson CB, Farzan M, Chen B, Choe H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "34611326", "url": "https://glygen.org/publication/PubMed/34611326" } ] }, { "title": "Furin cleavage of the SARS-CoV-2 spike is modulated by O-glycosylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2021", "authors": "Zhang L, Mann M, Syed ZA, Reynolds HM, Tian E, Samara NL, Zeldin DC, Tabak LA, Ten Hagen KG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "34732583", "url": "https://glygen.org/publication/PubMed/34732583" } ] }, { "title": "The glycosylation in SARS-CoV-2 and its receptor ACE2.", "journal": "Signal transduction and targeted therapy", "date": "2021", "authors": "Gong Y, Qin S, Dai L, Tian Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "34782609", "url": "https://glygen.org/publication/PubMed/34782609" } ] }, { "title": "The binding of heparin to spike glycoprotein inhibits SARS-CoV-2 infection by three mechanisms.", "journal": "The Journal of biological chemistry", "date": "2022", "authors": "Paiardi G, Richter S, Oreste P, Urbinati C, Rusnati M, Wade RC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "34929169", "url": "https://glygen.org/publication/PubMed/34929169" } ] }, { "title": "Distinctive Roles of Furin and TMPRSS2 in SARS-CoV-2 Infectivity.", "journal": "Journal of virology", "date": "2022", "authors": "Essalmani R, Jain J, Susan-Resiga D, Andreo U, Evagelidis A, Derbali RM, Huynh DN, Dallaire F, Laporte M, Delpal A, Sutto-Ortiz P, Coutard B, Mapa C, Wilcoxen K, Decroly E, Nq Pham T, Cohen EA, Seidah NG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9694614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614" } ], "reference": [ { "type": "PubMed", "id": "35343766", "url": "https://glygen.org/publication/PubMed/35343766" } ] }, { "title": "Mass spectrometric analysis of chondroitin sulfate-linked peptides.", "journal": "Journal of proteins and proteomics", "date": "2022", "authors": "Ramarajan Madan Gopal, Saraswat Mayank, Budhraja Rohit, Garapati Kishore, Raymond Kimiyo, Pandey Akhilesh", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786#ptm_processing" }, { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "reference": [ { "type": "PubMed", "id": "36213313", "url": "https://glygen.org/publication/PubMed/36213313" } ] }, { "title": "Biophysical Investigation of Interactions Between SARS-CoV-2 Spike Protein and Neuropilin-1.", "journal": "Protein science : a publication of the Protein Society", "date": "2023-09-01", "authors": "Hou Decheng, Cao Wenpeng, Kim Seonghan, Cui Xinyu, Ziarnik Matthew, Wonpil Im, Zhang X Frank", "evidence": [ { "database": "RefSeq", "id": "NP_001019799", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001019799" } ], "reference": [ { "type": "PubMed", "id": "37656811", "url": "https://glygen.org/publication/PubMed/37656811" } ] }, { "title": "NRP1 regulates autophagy and proliferation of gastric cancer through Wnt/\u03b2-catenin signaling pathway.", "journal": "Aging", "date": "2023-03-07", "authors": "Yu Qi-Ying, Han Yue, Lu Jia-Hui, Sun Yan-Jie, Liao Xing-Hua", "evidence": [ { "database": "RefSeq", "id": "NP_001019799", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001019799" } ], "reference": [ { "type": "PubMed", "id": "37702613", "url": "https://glygen.org/publication/PubMed/37702613" } ] }, { "title": "VEGF/Nrp1/HIF-1\u03b1 promotes proliferation of hepatocellular carcinoma through a positive feedback loop.", "journal": "Medical oncology (Northwood, London, England)", "date": "2023-10-25", "authors": "Wang Yun-Bing, Zheng Kai-Wen, Hu Yi-Yu, Salameen Haitham, Zhu Zhe-Yu, Wu Fei-Fan, Ding Xiong", "evidence": [ { "database": "RefSeq", "id": "NP_001019799", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001019799" } ], "reference": [ { "type": "PubMed", "id": "37875691", "url": "https://glygen.org/publication/PubMed/37875691" } ] }, { "title": "NRP1 Induces Enhanced Stemness and Chemoresistance in Glioma Cells via YAP.", "journal": "Biological & pharmaceutical bulletin", "date": "2024", "authors": "Jin Liang, Jin Ai, Wang Ling, Qi Xiaoru, Jin Yan, Zhang Chunhe, Niu Mengya", "evidence": [ { "database": "RefSeq", "id": "NP_001019799", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001019799" } ], "reference": [ { "type": "PubMed", "id": "38220212", "url": "https://glygen.org/publication/PubMed/38220212" } ] }, { "title": "Cloning and characterization of two distinct human extracellular signal-regulated kinase activator kinases, MEK1 and MEK2.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Zheng CF, Guan KL", "evidence": [ { "database": "Reactome", "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144" } ], "reference": [ { "type": "PubMed", "id": "8388392", "url": "https://glygen.org/publication/PubMed/8388392" } ] }, { "title": "The fourth immunoglobulin-like domain of NCAM contains a carbohydrate recognition domain for oligomannosidic glycans implicated in association with L1 and neurite outgrowth.", "journal": "The Journal of cell biology", "date": "1993", "authors": "Horstkorte R, Schachner M, Magyar JP, Vorherr T, Schmitz B", "evidence": [ { "database": "Reactome", "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144" } ], "reference": [ { "type": "PubMed", "id": "8509458", "url": "https://glygen.org/publication/PubMed/8509458" } ] }, { "title": "Casein kinase II phosphorylates the neural cell adhesion molecule L1.", "journal": "Journal of neurochemistry", "date": "1996", "authors": "Wong EV, Schaefer AW, Landreth G, Lemmon V", "evidence": [ { "database": "Reactome", "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144" } ], "reference": [ { "type": "PubMed", "id": "8592152", "url": "https://glygen.org/publication/PubMed/8592152" } ] }, { "title": "Neuropilin is a receptor for the axonal chemorepellent Semaphorin III.", "journal": "Cell", "date": "1997", "authors": "He Z, Tessier-Lavigne M", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "reference": [ { "type": "PubMed", "id": "9288753", "url": "https://glygen.org/publication/PubMed/9288753" } ] }, { "title": "A single immunoglobulin-like domain of the human neural cell adhesion molecule L1 supports adhesion by multiple vascular and platelet integrins.", "journal": "The Journal of cell biology", "date": "1997", "authors": "Felding-Habermann B, Silletti S, Mei F, Siu CH, Yip PM, Brooks PC, Cheresh DA, O'Toole TE, Ginsberg MH, Montgomery AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-445144", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144" } ], "reference": [ { "type": "PubMed", "id": "9396761", "url": "https://glygen.org/publication/PubMed/9396761" } ] }, { "title": "Neuropilin-1 is expressed by endothelial and tumor cells as an isoform-specific receptor for vascular endothelial growth factor.", "journal": "Cell", "date": "1998", "authors": "Soker S, Takashima S, Miao HQ, Neufeld G, Klagsbrun M", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "reference": [ { "type": "PubMed", "id": "9529250", "url": "https://glygen.org/publication/PubMed/9529250" } ] } ], "pathway": [ { "id": "hsa:8829", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:8829", "resource": "KEGG Pathway" }, { "id": "R-HSA-194306", "name": "Neurophilin interactions with VEGF and VEGFR", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-194306", "resource": "Reactome", "description": "Neurophilin interactions with VEGF and VEGFR" }, { "id": "R-HSA-376176", "name": "Signaling by ROBO receptors", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-376176", "resource": "Reactome", "description": "Signaling by ROBO receptors" }, { "id": "R-HSA-399954", "name": "Sema3A PAK dependent Axon repulsion", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-399954", "resource": "Reactome", "description": "Sema3A PAK dependent Axon repulsion" }, { "id": "R-HSA-399955", "name": "SEMA3A-Plexin repulsion signaling by inhibiting Integrin adhesion", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-399955", "resource": "Reactome", "description": "SEMA3A-Plexin repulsion signaling by inhibiting Integrin adhesion" }, { "id": "R-HSA-399956", "name": "CRMPs in Sema3A signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-399956", "resource": "Reactome", "description": "CRMPs in Sema3A signaling" }, { "id": "R-HSA-445144", "name": "Signal transduction by L1", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-445144", "resource": "Reactome", "description": "Signal transduction by L1" }, { "id": "R-HSA-447041", "name": "CHL1 interactions", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-447041", "resource": "Reactome", "description": "CHL1 interactions" }, { "id": "R-HSA-9694614", "name": "Attachment and Entry", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9694614", "resource": "Reactome", "description": "Attachment and Entry" } ], "orthologs": [ { "uniprot_canonical_ac": "P97333-1", "protein_name": "Neuropilin-1", "gene_name": "Nrp1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MERGLPLLCATLALALALAGAFRSDKCGGTIKIENPGYLTSPGYPHSYHPSEKCEWLIQAPEPYQRIMINFNPHFDLEDRDCKYDYVEVIDGENEGGRLWGKFCGKIAPSPVVSSGPFLFIKFVSDYETHGAGFSIRYEIFKRGPECSQNYTAPTGVIKSPGFPEKYPNSLECTYIIFAPKMSEIILEFESFDLEQDSNPPGGMFCRYDRLEIWDGFPEVGPHIGRYCGQKTPGRIRSSSGVLSMVFYTDSAIAKEGFSANYSVLQSSISEDFKCMEALGMESGEIHSDQITASSQYGTNWSVERSRLNYPENGWTPGEDSYKEWIQVDLGLLRFVTAVGTQGAISKETKKKYYVKTYRVDISSNGEDWISLKEGNKAIIFQGNTNPTDVVLGVFSKPLITRFVRIKPVSWETGISMRFEVYGCKITDYPCSGMLGMVSGLISDSQITASNQADRNWMPENIRLVTSRTGWALPPSPHPYTNEWLQVDLGDEKIVRGVIIQGGKHRENKVFMRKFKIAYSNNGSDWKTIMDDSKRKAKSFEGNNNYDTPELRTFSPLSTRFIRIYPERATHSGLGLRMELLGCEVEAPTAGPTTPNGNPVDECDDDQANCHSGTGDDFQLTGGTTVLATEKPTIIDSTIQSEFPTYGFNCEFGWGSHKTFCHWEHDSHAQLRWSVLTSKTGPIQDHTGDGNFIYSQADENQKGKVARLVSPVVYSQSSAHCMTFWYHMSGSHVGTLRVKLRYQKPEEYDQLVWMVVGHQGDHWKEGRVLLHKSLKLYQVIFEGEIGKGNLGGIAVDDISINNHISQEDCAKPTDLDKKNTEIKIDETGSTPGYEGEGEGDKNISRKPGNVLKTLDPILITIIAMSALGVLLGAVCGVVLYCACWHNGMSERNLSALENYNFELVDGVKLKKDKLNPQSNYSEA", "length": 923 }, "evidence": [ { "id": "45917746", "url": "http://www.informatics.jax.org/homology/45917746", "database": "MGI" }, { "id": "O14786", "url": "https://omabrowser.org/oma/group/O14786/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9QWJ9-1", "protein_name": "Neuropilin-1", "gene_name": "Nrp1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MERGLPLLCATLALALALAGAFRSDKCGGTIKIENPGYLTSPGYPHSYHPSEKCEWLIQAPEPYQRIMINFNPHFDLEDRDCKYDYVEVIDGENEGGRLWGKFCGKIAPSPVVSSGPFLFIKFVSDYETHGAGFSIRYEIFKRGPECSQNYTAPTGVIKSPGFPEKYPNSLECTYIIFAPKMSEIILEFESFDLEQDSNPPGGVFCRYDRLEIWDGFPEVGPHIGRYCGQKTPGRIRSSSGILSMVFYTDSAIAKEGFSANYSVLQSSISEDFKCMEALGMESGEIHSDQITASSQYGTNWSVERSRLNYPENGWTPGEDSYREWIQVDLGLLRFVTAVGTQGAISKETKKKYYVKTYRVDISSNGEDWITLKEGNKAIIFQGNTNPTDVVFGVFPKPLITRFVRIKPASWETGISMRFEVYGCKITDYPCSGMLGMVSGLISDSQITASNQGDRNWMPENIRLVTSRTGWALPPSPHPYINEWLQVDLGDEKIVRGVIIQGGKHRENKVFMRKFKIAYSNNGSDWKMIMDDSKRKAKSFEGNNNYDTPELRAFTPLSTRFIRIYPERATHSGLGLRMELLGCEVEVPTAGPTTPNGNPVDECDDDQANCHSGTGDDFQLTGGTTVLATEKPTIIDSTIQSEFPTYGFNCEFGWGSHKTFCHWEHDSHAQLRWRVLTSKTGPIQDHTGDGNFIYSQADENQKGKVARLVSPVVYSQSSAHCMTFWYHMSGSHVGTLRVKLHYQKPEEYDQLVWMVVGHQGDHWKEGRVLLHKSLKLYQVIFEGEIGKGNLGGIAVDDISINNHIPQEDCAKPTDLDKKNTEIKIDETGSTPGYEEGKGDKNISRKPGNVLKTLDPILITIIAMSALGVLLGAVCGVVLYCACWHNGMSERNLSALENYNFELVDGVKLKKDKLNPQSNYSEA", "length": 922 }, "evidence": [ { "id": "45917746", "url": "http://www.informatics.jax.org/homology/45917746", "database": "MGI" }, { "id": "O14786", "url": "https://omabrowser.org/oma/group/O14786/", "database": "OMA" } ], "common_name": "Rat" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 16, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "glutamatergic synapse", "id": "GO:0098978", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0098978", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "semaphorin receptor complex", "id": "GO:0002116", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002116", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "extracellular space", "id": "GO:0005615", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005615", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "early endosome", "id": "GO:0005769", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005769", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "focal adhesion", "id": "GO:0005925", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005925", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "axon", "id": "GO:0030424", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030424", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "mitochondrial membrane", "id": "GO:0031966", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031966", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "receptor complex", "id": "GO:0043235", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043235", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "postsynaptic membrane", "id": "GO:0045211", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045211", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "cytoplasmic vesicle", "id": "GO:0031410", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031410", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "neuron projection", "id": "GO:0043005", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043005", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "neurofilament", "id": "GO:0005883", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005883", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "sorting endosome", "id": "GO:0097443", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097443", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 78, "go_terms": [ { "name": "angiogenesis", "id": "GO:0001525", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001525", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "axon guidance", "id": "GO:0007411", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007411", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "endothelial tip cell fate specification", "id": "GO:0097102", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097102", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "sympathetic neuron projection extension", "id": "GO:0097490", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097490", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "sympathetic neuron projection guidance", "id": "GO:0097491", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097491", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "motor neuron migration", "id": "GO:0097475", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097475", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "vasculogenesis", "id": "GO:0001570", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001570", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "signal transduction", "id": "GO:0007165", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007165", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "integrin-mediated signaling pathway", "id": "GO:0007229", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007229", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "cell-cell signaling", "id": "GO:0007267", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007267", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "positive regulation of ERK1 and ERK2 cascade", "id": "GO:0070374", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070374", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "semaphorin-plexin signaling pathway", "id": "GO:0071526", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071526", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "neuron migration", "id": "GO:0001764", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001764", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "positive regulation of endothelial cell migration", "id": "GO:0010595", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010595", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "positive regulation of angiogenesis", "id": "GO:0045766", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045766", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "negative regulation of neuron apoptotic process", "id": "GO:0043524", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043524", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "response to wounding", "id": "GO:0009611", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009611", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "positive regulation of stress fiber assembly", "id": "GO:0051496", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051496", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "neural crest cell migration", "id": "GO:0001755", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001755", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "positive regulation of endothelial cell proliferation", "id": "GO:0001938", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001938", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "animal organ morphogenesis", "id": "GO:0009887", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009887", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "regulation of Cdc42 protein signal transduction", "id": "GO:0032489", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032489", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "neuropilin signaling pathway", "id": "GO:0038189", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0038189", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "positive regulation of peptidyl-tyrosine phosphorylation", "id": "GO:0050731", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050731", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "positive regulation of focal adhesion assembly", "id": "GO:0051894", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051894", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "positive regulation of cell migration involved in sprouting angiogenesis", "id": "GO:0090050", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090050", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "positive regulation of substrate adhesion-dependent cell spreading", "id": "GO:1900026", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1900026", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "regulation of vesicle-mediated transport", "id": "GO:0060627", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060627", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "viral entry into host cell", "id": "GO:0046718", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046718", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "vascular endothelial growth factor receptor signaling pathway", "id": "GO:0048010", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048010", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "branching involved in blood vessel morphogenesis", "id": "GO:0001569", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001569", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "sprouting angiogenesis", "id": "GO:0002040", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002040", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "negative regulation of extrinsic apoptotic signaling pathway", "id": "GO:2001237", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:2001237", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "axonal fasciculation", "id": "GO:0007413", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007413", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "cellular response to vascular endothelial growth factor stimulus", "id": "GO:0035924", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035924", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "positive regulation of filopodium assembly", "id": "GO:0051491", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051491", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "artery morphogenesis", "id": "GO:0048844", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048844", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "positive chemotaxis", "id": "GO:0050918", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050918", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "platelet-derived growth factor receptor signaling pathway", "id": "GO:0048008", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048008", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "coronary artery morphogenesis", "id": "GO:0060982", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060982", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "retina vasculature morphogenesis in camera-type eye", "id": "GO:0061299", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061299", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "sympathetic ganglion development", "id": "GO:0061549", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061549", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "substrate-dependent cell migration, cell extension", "id": "GO:0006930", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006930", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "endothelial cell chemotaxis", "id": "GO:0035767", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035767", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "axonogenesis involved in innervation", "id": "GO:0060385", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060385", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "regulation of vascular endothelial growth factor receptor signaling pathway", "id": "GO:0030947", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030947", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "sensory neuron axon guidance", "id": "GO:0097374", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0097374", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "cellular response to hepatocyte growth factor stimulus", "id": "GO:0035729", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0035729", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "hepatocyte growth factor receptor signaling pathway", "id": "GO:0048012", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048012", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "motor neuron axon guidance", "id": "GO:0008045", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008045", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "cell migration involved in sprouting angiogenesis", "id": "GO:0002042", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0002042", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "positive regulation of smooth muscle cell migration", "id": "GO:0014911", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0014911", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "retinal ganglion cell axon guidance", "id": "GO:0031290", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031290", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "outflow tract septum morphogenesis", "id": "GO:0003148", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003148", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "trigeminal nerve structural organization", "id": "GO:0021637", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0021637", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "vestibulocochlear nerve structural organization", "id": "GO:0021649", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0021649", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "branchiomotor neuron axon guidance", "id": "GO:0021785", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0021785", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "gonadotrophin-releasing hormone neuronal migration to the hypothalamus", "id": "GO:0021828", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0021828", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "ventral trunk neural crest cell migration", "id": "GO:0036486", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0036486", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "VEGF-activated neuropilin signaling pathway", "id": "GO:0038190", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0038190", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "negative regulation of axon extension involved in axon guidance", "id": "GO:0048843", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048843", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "positive regulation of cytokine activity", "id": "GO:0060301", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060301", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "dichotomous subdivision of terminal units involved in salivary gland branching", "id": "GO:0060666", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060666", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "angiogenesis involved in coronary vascular morphogenesis", "id": "GO:0060978", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060978", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "renal artery morphogenesis", "id": "GO:0061441", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061441", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "trigeminal ganglion development", "id": "GO:0061551", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0061551", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "neural crest cell migration involved in autonomic nervous system development", "id": "GO:1901166", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1901166", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "protein localization to early endosome", "id": "GO:1902946", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902946", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "facioacoustic ganglion development", "id": "GO:1903375", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1903375", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "dorsal root ganglion morphogenesis", "id": "GO:1904835", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1904835", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "otic placode development", "id": "GO:1905040", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1905040", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "positive regulation of axon extension involved in axon guidance", "id": "GO:0048842", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048842", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "commissural neuron axon guidance", "id": "GO:0071679", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0071679", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "axon extension involved in axon guidance", "id": "GO:0048846", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048846", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "facial nerve structural organization", "id": "GO:0021612", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0021612", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "postsynapse organization", "id": "GO:0099173", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0099173", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "basal dendrite arborization", "id": "GO:0150020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0150020", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "basal dendrite development", "id": "GO:0150018", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0150018", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 10, "go_terms": [ { "name": "heparin binding", "id": "GO:0008201", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008201", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "metal ion binding", "id": "GO:0046872", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046872", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "semaphorin receptor activity", "id": "GO:0017154", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0017154", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "vascular endothelial growth factor receptor activity", "id": "GO:0005021", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005021", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "GTPase activator activity", "id": "GO:0005096", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005096", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "coreceptor activity", "id": "GO:0015026", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015026", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "growth factor binding", "id": "GO:0019838", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019838", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "protein kinase binding", "id": "GO:0019901", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019901", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "cytokine binding", "id": "GO:0019955", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019955", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" }, { "name": "vascular endothelial growth factor binding", "id": "GO:0038085", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0038085", "evidence": [ { "database": "UniProtKB", "id": "O14786", "url": "https://www.uniprot.org/uniprot/O14786" } ], "pmid": "" } ] } ] }, "pro_annotation": [ { "name": "neuropilin-1 N-glycosylated 1 (human)", "definition": "A neuropilin-1 (human) that has been N-glycosylated at the residue equivalent to Asn-150 of the amino acid sequence represented by UniProtKB:O14786-1, in which the glycan composition is represented by GlyTouCan:G59626AS. Example: UniProtKB:O14786-1, Asn-150, MOD:00160~GNO:G59626AS. [PRO:DNx, PMID:29671580]", "evidence": [ { "id": "PR:000050705", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000050705" } ] }, { "name": "neuropilin-1 O-glycosylated 1 (human)", "definition": "A neuropilin-1 (human) that has been O-glycosylated at the residue equivalent to Ser-637 of the amino acid sequence represented by UniProtKB:O14786-1, in which the glycan composition is represented by GlyTouCan:G53434XO. Example: UniProtKB:O14786-1, Ser-637, MOD:00002~GNO:G53434XO. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000050706", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000050706" } ] }, { "name": "neuropilin-1 O-glycosylated 2 (human)", "definition": "A neuropilin-1 (human) that has been O-glycosylated at the residue equivalent to Thr-589 of the amino acid sequence represented by UniProtKB:O14786-1, in which the glycan composition is represented by GlyTouCan:G57317CE. Example: UniProtKB:O14786-1, Thr-589, MOD:00005~GNO:G57317CE. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000050707", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000050707" } ] }, { "name": "neuropilin-1 O-glycosylated 3 (human)", "definition": "A neuropilin-1 (human) that has been O-glycosylated at the residue equivalent to Thr-638 of the amino acid sequence represented by UniProtKB:O14786-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:O14786-1, Thr-638, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000050708", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000050708" } ] }, { "name": "neuropilin-1 O-glycosylated 4 (human)", "definition": "A neuropilin-1 (human) that has been O-glycosylated at the residue equivalent to Thr-830 of the amino acid sequence represented by UniProtKB:O14786-1, in which the glycan composition is represented by GlyTouCan:G43417UB. Example: UniProtKB:O14786-1, Thr-830, MOD:00005~GNO:G43417UB. [PRO:DNx, PMID:30459171]", "evidence": [ { "id": "PR:000050709", "database": "PRO", "url": "https://proconsortium.org/app/entry/PR:000050709" } ] } ], "site_annotation": [ { "start_pos": 150, "end_pos": 152, "annotation": "n_glycosylation_sequon" }, { "start_pos": 261, "end_pos": 263, "annotation": "n_glycosylation_sequon" }, { "start_pos": 300, "end_pos": 302, "annotation": "n_glycosylation_sequon" }, { "start_pos": 522, "end_pos": 524, "annotation": "n_glycosylation_sequon" }, { "start_pos": 842, "end_pos": 844, "annotation": "n_glycosylation_sequon" }, { "start_pos": 892, "end_pos": 894, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [ 150, 261, 300, 521, 522, 842, 892 ], "o_linked_sites": [ 589, 612, 628, 637, 638, 824, 827, 829, 830, 844 ], "snv_sites": [ 96, 181, 263, 311, 347, 361, 458, 522, 523, 524, 531, 612, 636, 637, 719, 803, 827, 830, 844 ], "glycation_sites": [], "phosphorylation_sites": [ 894, 899, 920 ], "sequon_annotation_sites": [ { "start_pos": 150, "end_pos": 152 }, { "start_pos": 261, "end_pos": 263 }, { "start_pos": 300, "end_pos": 302 }, { "start_pos": 522, "end_pos": 524 }, { "start_pos": 842, "end_pos": 844 }, { "start_pos": 892, "end_pos": 894 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 28 }, { "field": "total_sites", "count": 16 }, { "field": "n_linked_glycans", "count": 7 }, { "field": "n_linked_glycan_sites", "count": 10 }, { "field": "o_linked_glycans", "count": 4 }, { "field": "o_linked_glycan_sites", "count": 10 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 6 }, { "field": "total_sites", "count": 6 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 4 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 2 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 20 }, { "field": "total_sites", "count": 12 }, { "field": "n_linked_glycans", "count": 7 }, { "field": "n_linked_glycan_sites", "count": 4 }, { "field": "o_linked_glycans", "count": 4 }, { "field": "o_linked_glycan_sites", "count": 8 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 2 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 21 }, { "field": "total_sites", "count": 19 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 5 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 16 }, { "field": "total_sites", "count": 14 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl", "subjects_tested", "subjects_positive", "frequency" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 125 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }