{ "uniprot_canonical_ac": "O14777-1", "uniprot_ac": "O14777", "uniprot_id": "NDC80_HUMAN", "mass": { "chemical_mass": 73913.0, "monoisotopic_mass": 73913.0 }, "refseq": { "ac": "NP_006092", "name": "kinetochore protein NDC80 homolog", "summary": "This gene encodes a component of the NDC80 kinetochore complex. The encoded protein consists of an N-terminal microtubule binding domain and a C-terminal coiled-coiled domain that interacts with other components of the complex. This protein functions to organize and stabilize microtubule-kinetochore interactions and is required for proper chromosome segregation. [provided by RefSeq, Oct 2011].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006092" }, "gene_names": [ { "name": "NDC80", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O14777", "id": "O14777" }, { "name": "HEC1", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O14777", "id": "O14777" }, { "name": "HEC; HEC1; HsHec1; hsNDC80; KNTC2; TID3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006092", "id": "NP_006092" }, { "name": "HEC", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O14777", "id": "O14777" }, { "name": "KNTC2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O14777", "id": "O14777" }, { "name": "NDC80", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006092", "id": "NP_006092" } ], "protein_names": [ { "name": "Kinetochore protein NDC80 homolog", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O14777" }, { "name": "Highly expressed in cancer protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O14777" }, { "name": "HsHec1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O14777" }, { "name": "Kinetochore protein Hec1", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O14777" }, { "name": "Kinetochore-associated protein 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O14777" }, { "name": "Retinoblastoma-associated protein HEC", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O14777" }, { "name": "highly expressed in cancer, rich in leucine heptad repeats; kinetochore associated 2; NDC80 homolog, kinetochore complex component; NDC80 kinetochore complex component homolog; kinetochore protein Hec1; kinetochore-associated protein 2; highly expressed in cancer protein; retinoblastoma-associated protein HEC", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006092", "id": "NP_006092" }, { "name": "kinetochore protein NDC80 homolog", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006092", "id": "NP_006092" } ], "function": [ { "annotation": "Acts as a component of the essential kinetochore-associated NDC80 complex, which is required for chromosome segregation and spindle checkpoint activity.", "evidence": [ { "database": "UniProtKB", "id": "V9GYM9", "url": "https://www.uniprot.org/uniprot/V9GYM9#function" }, { "database": "UniProtKB", "id": "RU368072", "url": "https://www.uniprot.org/uniprot/RU368072#function" }, { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777#function" }, { "database": "PubMed", "id": "16732327", "url": "https://glygen.org/publication/PubMed/16732327" }, { "database": "PubMed", "id": "15239953", "url": "https://glygen.org/publication/PubMed/15239953" }, { "database": "PubMed", "id": "15235793", "url": "https://glygen.org/publication/PubMed/15235793" }, { "database": "PubMed", "id": "14654001", "url": "https://glygen.org/publication/PubMed/14654001" }, { "database": "PubMed", "id": "12351790", "url": "https://glygen.org/publication/PubMed/12351790" }, { "database": "PubMed", "id": "25743205", "url": "https://glygen.org/publication/PubMed/25743205" }, { "database": "PubMed", "id": "23891108", "url": "https://glygen.org/publication/PubMed/23891108" }, { "database": "PubMed", "id": "23085020", "url": "https://glygen.org/publication/PubMed/23085020" }, { "database": "PubMed", "id": "15062103", "url": "https://glygen.org/publication/PubMed/15062103" }, { "database": "PubMed", "id": "14699129", "url": "https://glygen.org/publication/PubMed/14699129" }, { "database": "PubMed", "id": "30409912", "url": "https://glygen.org/publication/PubMed/30409912" }, { "database": "PubMed", "id": "9315664", "url": "https://glygen.org/publication/PubMed/9315664" }, { "database": "PubMed", "id": "15548592", "url": "https://glygen.org/publication/PubMed/15548592" } ] }, { "annotation": "Bioinformatic analysis revealing mitotic spindle assembly regulated NDC80 and MAD2L1 as prognostic biomarkers in non-small cell lung cancer development. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_006092", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006092" }, { "database": "PubMed", "id": "32795325", "url": "https://glygen.org/publication/PubMed/32795325" } ] }, { "annotation": "Chromosome oscillation promotes Aurora A-dependent Hec1 phosphorylation and mitotic fidelity.", "evidence": [ { "database": "RefSeq", "id": "NP_006092", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006092" }, { "database": "PubMed", "id": "33988677", "url": "https://glygen.org/publication/PubMed/33988677" } ] }, { "annotation": "CircNDC80 promotes glioblastoma multiforme tumorigenesis via the miR-139-5p/ECE1 pathway. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_006092", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006092" }, { "database": "PubMed", "id": "36635757", "url": "https://glygen.org/publication/PubMed/36635757" } ] }, { "annotation": "Involvement of NEK2 and its interaction with NDC80 and CEP250 in hepatocellular carcinoma. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_006092", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006092" }, { "database": "PubMed", "id": "33109182", "url": "https://glygen.org/publication/PubMed/33109182" } ] }, { "annotation": "NDC80 Enhances Cisplatin-resistance in Triple-negative Breast Cancer. Erratum:[Arch Med Res. 2023 Jul;54(5):102833. PMID: 37193619]", "evidence": [ { "database": "RefSeq", "id": "NP_006092", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006092" }, { "database": "PubMed", "id": "35346500", "url": "https://glygen.org/publication/PubMed/35346500" } ] }, { "annotation": "This gene encodes a component of the NDC80 kinetochore complex. The encoded protein consists of an N-terminal microtubule binding domain and a C-terminal coiled-coiled domain that interacts with other components of the complex. This protein functions to organize and stabilize microtubule-kinetochore interactions and is required for proper chromosome segregation. [provided by RefSeq, Oct 2011].", "evidence": [ { "database": "RefSeq", "id": "NP_006092", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006092" } ] } ], "disease": [], "snv": [], "mutagenesis": [ { "start_pos": 234, "end_pos": 234, "sequence_org": "E", "sequence_mut": "K", "comment": "Abrogates binding to RB1.", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" }, { "database": "PubMed", "id": "10779342", "url": "https://glygen.org/publication/PubMed/10779342" } ] }, { "start_pos": 53, "end_pos": 53, "sequence_org": "K", "sequence_mut": "Q", "comment": "Mimics acetylation, leading to increased kinetochore-microtubule attachment; when associated with Q-59.", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" }, { "database": "PubMed", "id": "30409912", "url": "https://glygen.org/publication/PubMed/30409912" } ] }, { "start_pos": 53, "end_pos": 53, "sequence_org": "K", "sequence_mut": "R", "comment": "Impaired acetylation, leading to reduced kinetochore-microtubule attachment; when associated with R-59.", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" }, { "database": "PubMed", "id": "30409912", "url": "https://glygen.org/publication/PubMed/30409912" } ] }, { "start_pos": 59, "end_pos": 59, "sequence_org": "K", "sequence_mut": "Q", "comment": "Mimics acetylation, leading to increased kinetochore-microtubule attachment; when associated with Q-53.", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" }, { "database": "PubMed", "id": "30409912", "url": "https://glygen.org/publication/PubMed/30409912" } ] }, { "start_pos": 59, "end_pos": 59, "sequence_org": "K", "sequence_mut": "R", "comment": "Impaired acetylation, leading to reduced kinetochore-microtubule attachment; when associated with R-53.", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" }, { "database": "PubMed", "id": "30409912", "url": "https://glygen.org/publication/PubMed/30409912" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "55.41", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000080986", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000080986" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "77.36", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000080986", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000080986" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "62.17", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000080986", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000080986" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "49.96", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000080986", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000080986" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "63.6", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000080986", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000080986" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "84.07", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000080986", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000080986" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "52.83", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000080986", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000080986" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "64.08", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000080986", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000080986" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "58.36", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000080986", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000080986" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "47.6", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000080986", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000080986" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "55.08", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000080986", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000080986" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "71.9", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000080986", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000080986" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "62.69", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000080986", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000080986" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O14777", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14777" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O14777", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14777" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O14777", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14777" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O14777", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14777" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O14777", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14777" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O14777", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14777" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O14777", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14777" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O14777", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14777" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O14777", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14777" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O14777", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14777" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O14777", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14777" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O14777", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14777" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" } ], "common_name": "Human" } ], "gene": [ { "name": "NDC80", "url": "https://www.uniprot.org/uniprot/O14777", "locus": { "chromosome": "18", "start_pos": 2616635, "end_pos": 2571557, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000080986", "url": "https://www.ensembl.org/id/ENSG00000080986" } ] } } ], "crossref": [ { "id": "ENSG00000080986", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000080986", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "CHEMBL5660", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL5660", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "NDC80", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=NDC80", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "10403", "url": "https://www.ncbi.nlm.nih.gov/gene/10403", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "16909", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=16909", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O14777", "url": "https://www.ebi.ac.uk/intact/interactors/id:O14777*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR005550", "url": "https://www.ebi.ac.uk/interpro/entry/IPR005550", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR038273", "url": "https://www.ebi.ac.uk/interpro/entry/IPR038273", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR040967", "url": "https://www.ebi.ac.uk/interpro/entry/IPR040967", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:10403", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:10403", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "607272", "url": "http://www.omim.org/entry/607272", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O14777", "url": "https://www.nextprot.org/entry/NX_O14777", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "O14777", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14777", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "PSHKFQK", "url": "https://omabrowser.org/oma/group/PSHKFQK/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "25325at2759", "url": "http://www.orthodb.org/?query=25325at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10643", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10643", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10643:SF2", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10643:SF2", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12138", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12138", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12138:SF100", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12138:SF100", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "2IGP", "url": "https://www.rcsb.org/structure/2IGP", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2VE7", "url": "https://www.rcsb.org/structure/2VE7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "3IZ0", "url": "https://www.rcsb.org/structure/3IZ0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "8G0P", "url": "https://www.rcsb.org/structure/8G0P", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF03801", "url": "http://pfam.xfam.org/family/PF03801", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF18077", "url": "http://pfam.xfam.org/family/PF18077", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O14777", "url": "https://pharos.nih.gov/targets/O14777", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O14777", "url": "http://purl.obolibrary.org/obo/PR_O14777", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-141430", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-141430", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-141444", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-141444", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2467813", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2467813", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-2500257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2500257", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-68877", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68877", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9648025", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648025", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_006092", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006092", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "I3L0P0", "url": "https://www.uniprot.org/uniprot/I3L0P0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3L0P0-1", "url": "https://www.uniprot.org/uniprot/I3L0P0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3L4G3", "url": "https://www.uniprot.org/uniprot/I3L4G3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3L4G3-1", "url": "https://www.uniprot.org/uniprot/I3L4G3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O14777-1", "url": "https://www.uniprot.org/uniprot/O14777-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "V9GYM9", "url": "https://www.uniprot.org/uniprot/V9GYM9", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "V9GYM9-1", "url": "https://www.uniprot.org/uniprot/V9GYM9-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MKRSSVSSGGAGRLSMQELRSQDVNKQGLYTPQTKEKPTFGKLSINKPTSERKVSLFGKRTSGHGSRNSQLGIFSSSEKIKDPRPLNDKAFIQQCIRQLCEFLTENGYAHNVSMKSLQAPSVKDFLKIFTFLYGFLCPSYELPDTKFEEEVPRIFKDLGYPFALSKSSMYTVGAPHTWPHIVAALVWLIDCIKIHTAMKESSPLFDDGQPWGEETEDGIMHNKLFLDYTIKCYESFMSGADSFDEMNAELQSKLKDLFNVDAFKLESLEAKNRALNEQIARLEQEREKEPNRLESLRKLKASLQGDVQKYQAYMSNLESHSAILDQKLNGLNEEIARVELECETIKQENTRLQNIIDNQKYSVADIERINHERNELQQTINKLTKDLEAEQQKLWNEELKYARGKEAIETQLAEYHKLARKLKLIPKGAENSKGYDFEIKFNPEAGANCLVKYRAQVYVPLKELLNETEEEINKALNKKMGLEDTLEQLNAMITESKRSVRTLKEEVQKLDDLYQQKIKEAEEEDEKCASELESLEKHKHLLESTVNQGLSEAMNELDAVQREYQLVVQTTTEERRKVGNNLQRLLEMVATHVGSVEKHLEEQIAKVDREYEECMSEDLSENIKEIRDKYEKKATLIKSSEE", "length": 642, "header": "sp|O14777-1|NDC80_HUMAN Isoform 1 of Kinetochore protein NDC80 homolog OS=Homo sapiens OX=9606 GN=NDC80 PE=1 SV=1 CANONICAL=O14777-1" }, "isoforms": [ { "isoform_ac": "I3L0P0-1", "url": "", "sequence": { "sequence": "TTEERRKVGNNLQRLLEMVATHVGSVERRMLG", "length": 32, "header": "tr|I3L0P0-1|NDC80_HUMAN Computationally mapped isoform of Kinetochore protein NDC80 homolog OS=Homo sapiens OX=9606 GN=NDC80 PE=1 SV=1 CANONICAL=O14777-1" }, "locus": { "chromosome": "18", "start_pos": 2614968, "end_pos": 2610781, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000574096.1", "url": "https://www.ensembl.org/id/ENST00000574096.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000458236.1", "url": "https://www.ensembl.org/id/ENSP00000458236.1" } ] } }, { "isoform_ac": "I3L4G3-1", "url": "", "sequence": { "sequence": "MKRSSVSSGGAGRLSMQELRSQDVNKQGLYTPQTKEKPTFGKLSINKPTSERKVSLFGKRWSLALSPRLECSGAISAHCNLCLASSSNSPASASRVAGITELVDMDPGIVNLVYFPVLRKSRTRDHLMTKHSFSSVFDNSV", "length": 141, "header": "tr|I3L4G3-1|I3L4G3_HUMAN Computationally mapped isoform of NDC80 kinetochore complex component OS=Homo sapiens OX=9606 GN=NDC80 PE=1 SV=1 CANONICAL=O14777-1" }, "locus": { "chromosome": "18", "start_pos": 2577867, "end_pos": 2572986, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000575515.1", "url": "https://www.ensembl.org/id/ENST00000575515.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000461227.1", "url": "https://www.ensembl.org/id/ENSP00000461227.1" } ] } }, { "isoform_ac": "O14777-1", "url": "", "sequence": { "sequence": "MKRSSVSSGGAGRLSMQELRSQDVNKQGLYTPQTKEKPTFGKLSINKPTSERKVSLFGKRTSGHGSRNSQLGIFSSSEKIKDPRPLNDKAFIQQCIRQLCEFLTENGYAHNVSMKSLQAPSVKDFLKIFTFLYGFLCPSYELPDTKFEEEVPRIFKDLGYPFALSKSSMYTVGAPHTWPHIVAALVWLIDCIKIHTAMKESSPLFDDGQPWGEETEDGIMHNKLFLDYTIKCYESFMSGADSFDEMNAELQSKLKDLFNVDAFKLESLEAKNRALNEQIARLEQEREKEPNRLESLRKLKASLQGDVQKYQAYMSNLESHSAILDQKLNGLNEEIARVELECETIKQENTRLQNIIDNQKYSVADIERINHERNELQQTINKLTKDLEAEQQKLWNEELKYARGKEAIETQLAEYHKLARKLKLIPKGAENSKGYDFEIKFNPEAGANCLVKYRAQVYVPLKELLNETEEEINKALNKKMGLEDTLEQLNAMITESKRSVRTLKEEVQKLDDLYQQKIKEAEEEDEKCASELESLEKHKHLLESTVNQGLSEAMNELDAVQREYQLVVQTTTEERRKVGNNLQRLLEMVATHVGSVEKHLEEQIAKVDREYEECMSEDLSENIKEIRDKYEKKATLIKSSEE", "length": 642, "header": "sp|O14777-1|NDC80_HUMAN Isoform 1 of Kinetochore protein NDC80 homolog OS=Homo sapiens OX=9606 GN=NDC80 PE=1 SV=1 CANONICAL=O14777-1" }, "locus": { "chromosome": "18", "start_pos": 2616571, "end_pos": 2572986, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000261597.9", "url": "https://www.ensembl.org/id/ENST00000261597.9" }, { "database": "Ensembl Peptide", "id": "ENSP00000261597.4", "url": "https://www.ensembl.org/id/ENSP00000261597.4" } ] } }, { "isoform_ac": "V9GYM9-1", "url": "", "sequence": { "sequence": "CIRQLCEFLTENGYAHNVSMKSLQAPSVKDFLKIFTFLYGFLCPSYELPDTKFEEEVPRIFKDLGYPFALSKSSMYTVGAPHTWPHIVAALVWLIDCIKSLALLPRLECSGMISAHYNLHLPGSSNSHASASQVARITGAHHHAQLIFVFSVETACHHVGQADLELLT", "length": 168, "header": "tr|V9GYM9-1|NDC80_HUMAN Computationally mapped isoform of Kinetochore protein NDC80 homolog OS=Homo sapiens OX=9606 GN=NDC80 PE=1 SV=1 CANONICAL=O14777-1" }, "locus": { "chromosome": "18", "start_pos": 2582308, "end_pos": 2577849, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000576274.2", "url": "https://www.ensembl.org/id/ENST00000576274.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000476919.1", "url": "https://www.ensembl.org/id/ENSP00000476919.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "O14777", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14777" }, { "id": "28411811", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28411811" } ] } ], "phosphorylation": [ { "start_pos": 15, "end_pos": 15, "kinase_uniprot_canonical_ac": "Q96GD4-1", "kinase_gene_name": "AURKB", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O14777", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14777" }, { "database": "PubMed", "id": "20471944", "url": "https://glygen.org/publication/PubMed/20471944" } ], "site_lbl": "Ser15" }, { "start_pos": 165, "end_pos": 165, "kinase_uniprot_canonical_ac": "P51955-1", "kinase_gene_name": "NEK2", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O14777", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14777" }, { "database": "PubMed", "id": "12386167", "url": "https://glygen.org/publication/PubMed/12386167" }, { "database": "phospho.ELM", "id": "O14777", "url": "http://phospho.elm.eu.org/byAccession/O14777.html" } ], "site_lbl": "Ser165" }, { "start_pos": 165, "end_pos": 165, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine; by NEK2", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" }, { "database": "iPTMnet", "id": "O14777", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14777" }, { "database": "PubMed", "id": "18297113", "url": "https://glygen.org/publication/PubMed/18297113" }, { "database": "PubMed", "id": "21832156", "url": "https://glygen.org/publication/PubMed/21832156" }, { "database": "PubMed", "id": "24662830", "url": "https://glygen.org/publication/PubMed/24662830" }, { "database": "PubMed", "id": "26595804", "url": "https://glygen.org/publication/PubMed/26595804" }, { "database": "PubMed", "id": "27764815", "url": "https://glygen.org/publication/PubMed/27764815" }, { "database": "PubMed", "id": "12386167", "url": "https://glygen.org/publication/PubMed/12386167" } ], "site_lbl": "Ser165" }, { "start_pos": 242, "end_pos": 242, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" } ], "site_lbl": "Ser242" }, { "start_pos": 31, "end_pos": 31, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O14777", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14777" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" } ], "site_lbl": "Thr31" }, { "start_pos": 34, "end_pos": 34, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O14777", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14777" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" } ], "site_lbl": "Thr34" }, { "start_pos": 44, "end_pos": 44, "kinase_uniprot_canonical_ac": "Q96GD4-1", "kinase_gene_name": "AURKB", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O14777", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14777" }, { "database": "PubMed", "id": "20471944", "url": "https://glygen.org/publication/PubMed/20471944" } ], "site_lbl": "Ser44" }, { "start_pos": 44, "end_pos": 44, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O14777", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14777" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" }, { "database": "PubMed", "id": "29187526", "url": "https://glygen.org/publication/PubMed/29187526" }, { "database": "PubMed", "id": "32027339", "url": "https://glygen.org/publication/PubMed/32027339" } ], "site_lbl": "Ser44" }, { "start_pos": 50, "end_pos": 50, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O14777", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14777" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" } ], "site_lbl": "Ser50" }, { "start_pos": 55, "end_pos": 55, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" }, { "database": "PubMed", "id": "30409912", "url": "https://glygen.org/publication/PubMed/30409912" }, { "database": "iPTMnet", "id": "O14777", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14777" }, { "database": "PubMed", "id": "16565220", "url": "https://glygen.org/publication/PubMed/16565220" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" }, { "database": "phospho.ELM", "id": "O14777", "url": "http://phospho.elm.eu.org/byAccession/O14777.html" }, { "database": "PubMed", "id": "29142109", "url": "https://glygen.org/publication/PubMed/29142109" }, { "database": "PubMed", "id": "29187526", "url": "https://glygen.org/publication/PubMed/29187526" }, { "database": "PubMed", "id": "33377866", "url": "https://glygen.org/publication/PubMed/33377866" }, { "database": "PubMed", "id": "33988677", "url": "https://glygen.org/publication/PubMed/33988677" }, { "database": "PubMed", "id": "35638575", "url": "https://glygen.org/publication/PubMed/35638575" } ], "site_lbl": "Ser55" }, { "start_pos": 572, "end_pos": 572, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O14777", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14777" }, { "database": "PubMed", "id": "35494241", "url": "" } ], "site_lbl": "Thr572" }, { "start_pos": 5, "end_pos": 5, "kinase_uniprot_canonical_ac": "Q96GD4-1", "kinase_gene_name": "AURKB", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O14777", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14777" }, { "database": "PubMed", "id": "20471944", "url": "https://glygen.org/publication/PubMed/20471944" } ], "site_lbl": "Ser5" }, { "start_pos": 62, "end_pos": 62, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" }, { "database": "PubMed", "id": "30409912", "url": "https://glygen.org/publication/PubMed/30409912" }, { "database": "iPTMnet", "id": "O14777", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14777" }, { "database": "PubMed", "id": "16565220", "url": "https://glygen.org/publication/PubMed/16565220" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "O14777", "url": "http://phospho.elm.eu.org/byAccession/O14777.html" } ], "site_lbl": "Ser62" }, { "start_pos": 635, "end_pos": 635, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Thr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O14777", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14777" }, { "database": "PubMed", "id": "35494241", "url": "" } ], "site_lbl": "Thr635" }, { "start_pos": 66, "end_pos": 66, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O14777", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14777" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser66" }, { "start_pos": 69, "end_pos": 69, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" }, { "database": "iPTMnet", "id": "O14777", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14777" }, { "database": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" }, { "database": "PubMed", "id": "19664994", "url": "https://glygen.org/publication/PubMed/19664994" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" }, { "database": "PubMed", "id": "29187526", "url": "https://glygen.org/publication/PubMed/29187526" }, { "database": "PubMed", "id": "32401635", "url": "https://glygen.org/publication/PubMed/32401635" }, { "database": "PubMed", "id": "33988677", "url": "https://glygen.org/publication/PubMed/33988677" } ], "site_lbl": "Ser69" }, { "start_pos": 76, "end_pos": 76, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O14777", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14777" }, { "database": "PubMed", "id": "16565220", "url": "https://glygen.org/publication/PubMed/16565220" }, { "database": "phospho.ELM", "id": "O14777", "url": "http://phospho.elm.eu.org/byAccession/O14777.html" } ], "site_lbl": "Ser76" }, { "start_pos": 77, "end_pos": 77, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O14777", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14777" }, { "database": "PubMed", "id": "16565220", "url": "https://glygen.org/publication/PubMed/16565220" }, { "database": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" }, { "database": "phospho.ELM", "id": "O14777", "url": "http://phospho.elm.eu.org/byAccession/O14777.html" } ], "site_lbl": "Ser77" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Hec1p, an evolutionarily conserved coiled-coil protein, modulates chromosome segregation through interaction with SMC proteins.", "journal": "Mol. Cell. Biol.", "date": "1999", "authors": "Zheng L, Chen Y, Lee W H", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" } ], "reference": [ { "type": "PubMed", "id": "10409732", "url": "https://glygen.org/publication/PubMed/10409732" } ] }, { "title": "Identification of a vertebrate sister-chromatid separation inhibitor involved in transformation and tumorigenesis.", "journal": "Science (New York, N.Y.)", "date": "1999", "authors": "Zou H, McGarry TJ, Bernal T, Kirschner MW", "evidence": [ { "database": "Reactome", "id": "R-HSA-2467813", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2467813" } ], "reference": [ { "type": "PubMed", "id": "10411507", "url": "https://glygen.org/publication/PubMed/10411507" } ] }, { "title": "X-ray structure determination of human profilin II: A comparative structural analysis of human profilins.", "journal": "Journal of molecular biology", "date": "1999", "authors": "Nodelman IM, Bowman GD, Lindberg U, Schutt CE", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "10600384", "url": "https://glygen.org/publication/PubMed/10600384" } ] }, { "title": "Diaphanous-related formins bridge Rho GTPase and Src tyrosine kinase signaling.", "journal": "Molecular cell", "date": "2000", "authors": "Tominaga T, Sahai E, Chardin P, McCormick F, Courtneidge SA, Alberts AS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "10678165", "url": "https://glygen.org/publication/PubMed/10678165" } ] }, { "title": "Retinoblastoma protein enhances the fidelity of chromosome segregation mediated by hsHec1p.", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Zheng L, Chen Y, Riley DJ, Chen PL, Lee WH", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" } ], "reference": [ { "type": "PubMed", "id": "10779342", "url": "https://glygen.org/publication/PubMed/10779342" } ] }, { "title": "FRL, a novel formin-related protein, binds to Rac and regulates cell motility and survival of macrophages.", "journal": "Molecular and cellular biology", "date": "2000", "authors": "Yayoshi-Yamamoto S, Taniuchi I, Watanabe T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "10958683", "url": "https://glygen.org/publication/PubMed/10958683" } ] }, { "title": "Two distinct pathways remove mammalian cohesin from chromosome arms in prophase and from centromeres in anaphase.", "journal": "Cell", "date": "2000", "authors": "Waizenegger IC, Hauf S, Meinke A, Peters JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2467813", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2467813" } ], "reference": [ { "type": "PubMed", "id": "11081627", "url": "https://glygen.org/publication/PubMed/11081627" } ] }, { "title": "Mitotic checkpoint proteins HsMAD1 and HsMAD2 are associated with nuclear pore complexes in interphase.", "journal": "Journal of cell science", "date": "2001", "authors": "Campbell MS, Chan GK, Yen TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-141444", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-141444" } ], "reference": [ { "type": "PubMed", "id": "11181178", "url": "https://glygen.org/publication/PubMed/11181178" } ] }, { "title": "Securin is required for chromosomal stability in human cells.", "journal": "Cell", "date": "2001", "authors": "Jallepalli PV, Waizenegger IC, Bunz F, Langer S, Speicher MR, Peters JM, Kinzler KW, Vogelstein B, Lengauer C", "evidence": [ { "database": "Reactome", "id": "R-HSA-2467813", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2467813" } ], "reference": [ { "type": "PubMed", "id": "11371342", "url": "https://glygen.org/publication/PubMed/11371342" } ] }, { "title": "Cohesin cleavage by separase required for anaphase and cytokinesis in human cells.", "journal": "Science (New York, N.Y.)", "date": "2001", "authors": "Hauf S, Waizenegger IC, Peters JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2500257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2500257" } ], "reference": [ { "type": "PubMed", "id": "11509732", "url": "https://glygen.org/publication/PubMed/11509732" } ] }, { "title": "Checkpoint inhibition of the APC/C in HeLa cells is mediated by a complex of BUBR1, BUB3, CDC20, and MAD2.", "journal": "The Journal of cell biology", "date": "2001", "authors": "Sudakin V, Chan GK, Yen TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-141430", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-141430" } ], "reference": [ { "type": "PubMed", "id": "11535616", "url": "https://glygen.org/publication/PubMed/11535616" } ] }, { "title": "The Mad2 spindle checkpoint protein undergoes similar major conformational changes upon binding to either Mad1 or Cdc20.", "journal": "Molecular cell", "date": "2002", "authors": "Luo X, Tang Z, Rizo J, Yu H", "evidence": [ { "database": "Reactome", "id": "R-HSA-141444", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-141444" } ], "reference": [ { "type": "PubMed", "id": "11804586", "url": "https://glygen.org/publication/PubMed/11804586" } ] }, { "title": "Crystal structure of the tetrameric Mad1-Mad2 core complex: implications of a 'safety belt' binding mechanism for the spindle checkpoint.", "journal": "The EMBO journal", "date": "2002", "authors": "Sironi L, Mapelli M, Knapp S, De Antoni A, Jeang KT, Musacchio A", "evidence": [ { "database": "Reactome", "id": "R-HSA-141430", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-141430" } ], "reference": [ { "type": "PubMed", "id": "12006501", "url": "https://glygen.org/publication/PubMed/12006501" } ] }, { "title": "Regulation of human separase by securin binding and autocleavage.", "journal": "Current biology : CB", "date": "2002", "authors": "Waizenegger I, Gimenez-Abian JF, Wernic D, Peters JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2467813", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2467813" } ], "reference": [ { "type": "PubMed", "id": "12194817", "url": "https://glygen.org/publication/PubMed/12194817" } ] }, { "title": "Role of Hec1 in spindle checkpoint signaling and kinetochore recruitment of Mad1/Mad2.", "journal": "Science (New York, N.Y.)", "date": "2002-09-27", "authors": "Martin-Lluesma Silvia, Stucke Volker M, Nigg Erich A", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" } ], "reference": [ { "type": "PubMed", "id": "12351790", "url": "https://glygen.org/publication/PubMed/12351790" } ] }, { "title": "Phosphorylation of the mitotic regulator protein Hec1 by Nek2 kinase is essential for faithful chromosome segregation.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Chen Y, Riley DJ, Zheng L, Chen PL, Lee WH", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" }, { "database": "iPTMnet", "id": "O14777", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14777" } ], "reference": [ { "type": "PubMed", "id": "12386167", "url": "https://glygen.org/publication/PubMed/12386167" } ] }, { "title": "The diaphanous-related formin mDia1 controls serum response factor activity through its effects on actin polymerization.", "journal": "Molecular biology of the cell", "date": "2002", "authors": "Copeland JW, Treisman R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "12429848", "url": "https://glygen.org/publication/PubMed/12429848" } ] }, { "title": "RhoD regulates endosome dynamics through Diaphanous-related Formin and Src tyrosine kinase.", "journal": "Nature cell biology", "date": "2003", "authors": "Gasman S, Kalaidzidis Y, Zerial M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "12577064", "url": "https://glygen.org/publication/PubMed/12577064" } ] }, { "title": "Role for NudC, a dynein-associated nuclear movement protein, in mitosis and cytokinesis.", "journal": "Journal of cell science", "date": "2003", "authors": "Aumais JP, Williams SN, Luo W, Nishino M, Caldwell KA, Caldwell GA, Lin SH, Yu-Lee LY", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648025", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648025" } ], "reference": [ { "type": "PubMed", "id": "12679384", "url": "https://glygen.org/publication/PubMed/12679384" } ] }, { "title": "Actin dynamics control SRF activity by regulation of its coactivator MAL.", "journal": "Cell", "date": "2003", "authors": "Miralles F, Posern G, Zaromytidou AI, Treisman R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "12732141", "url": "https://glygen.org/publication/PubMed/12732141" } ] }, { "title": "A role for VASP in RhoA-Diaphanous signalling to actin dynamics and SRF activity.", "journal": "The EMBO journal", "date": "2003", "authors": "Grosse R, Copeland JW, Newsome TP, Way M, Treisman R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "12805219", "url": "https://glygen.org/publication/PubMed/12805219" } ] }, { "title": "A role for Plk1 phosphorylation of NudC in cytokinesis.", "journal": "Developmental cell", "date": "2003", "authors": "Zhou T, Aumais JP, Liu X, Yu-Lee LY, Erikson RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648025", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648025" } ], "reference": [ { "type": "PubMed", "id": "12852857", "url": "https://glygen.org/publication/PubMed/12852857" } ] }, { "title": "Identification of the substrates and interaction proteins of aurora kinases from a protein-protein interaction model.", "journal": "Molecular & cellular proteomics : MCP", "date": "2004", "authors": "Tien AC, Lin MH, Su LJ, Hong YR, Cheng TS, Lee YC, Lin WJ, Still IH, Huang CY", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" } ], "reference": [ { "type": "PubMed", "id": "14602875", "url": "https://glygen.org/publication/PubMed/14602875" } ] }, { "title": "Nuf2 and Hec1 are required for retention of the checkpoint proteins Mad1 and Mad2 to kinetochores.", "journal": "Current biology : CB", "date": "2003-12-02", "authors": "DeLuca Jennifer G, Howell Bonnie J, Canman Julie C, Hickey Jennifer M, Fang Guowei, Salmon E D", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" } ], "reference": [ { "type": "PubMed", "id": "14654001", "url": "https://glygen.org/publication/PubMed/14654001" } ] }, { "title": "Identification of two novel components of the human NDC80 kinetochore complex.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Bharadwaj R, Qi W, Yu H", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" } ], "reference": [ { "type": "PubMed", "id": "14699129", "url": "https://glygen.org/publication/PubMed/14699129" } ] }, { "title": "The conserved kinetochore protein shugoshin protects centromeric cohesion during meiosis.", "journal": "Nature", "date": "2004", "authors": "Kitajima TS, Kawashima SA, Watanabe Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-2500257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2500257" } ], "reference": [ { "type": "PubMed", "id": "14730319", "url": "https://glygen.org/publication/PubMed/14730319" } ] }, { "title": "NEK2A interacts with MAD1 and possibly functions as a novel integrator of the spindle checkpoint signaling.", "journal": "J. Biol. Chem.", "date": "2004", "authors": "Lou Y, Yao J, Zereshki A, Dou Z, Ahmed K, Wang H, Hu J, Wang Y, Yao X", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" } ], "reference": [ { "type": "PubMed", "id": "14978040", "url": "https://glygen.org/publication/PubMed/14978040" } ] }, { "title": "Crystal structures of a Formin Homology-2 domain reveal a tethered dimer architecture.", "journal": "Cell", "date": "2004", "authors": "Xu Y, Moseley JB, Sagot I, Poy F, Pellman D, Goode BL, Eck MJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "15006353", "url": "https://glygen.org/publication/PubMed/15006353" } ] }, { "title": "The RanGAP1-RanBP2 complex is essential for microtubule-kinetochore interactions in vivo.", "journal": "Current biology : CB", "date": "2004-04-06", "authors": "Joseph Jomon, Liu Song-Tao, Jablonski Sandra A, Yen Tim J, Dasso Mary", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" } ], "reference": [ { "type": "PubMed", "id": "15062103", "url": "https://glygen.org/publication/PubMed/15062103" } ] }, { "title": "Cdc42 and mDia3 regulate microtubule attachment to kinetochores.", "journal": "Nature", "date": "2004", "authors": "Yasuda S, Oceguera-Yanez F, Kato T, Okamoto M, Yonemura S, Terada Y, Ishizaki T, Narumiya S", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "15085137", "url": "https://glygen.org/publication/PubMed/15085137" } ] }, { "title": "Sgt1 is required for human kinetochore assembly.", "journal": "EMBO Rep.", "date": "2004", "authors": "Steensgaard Peter, Garr\u00e8 Massimiliano, Muradore Ivan, Transidico Pietro, Nigg Erich A, Kitagawa Katsumi, Earnshaw William C, Faretta Mario, Musacchio Andrea", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" } ], "reference": [ { "type": "PubMed", "id": "15133482", "url": "https://glygen.org/publication/PubMed/15133482" } ] }, { "title": "Kinetochore localization and microtubule interaction of the human spindle checkpoint kinase Mps1.", "journal": "Chromosoma", "date": "2004-08", "authors": "Stucke Volker M, Baumann Christoph, Nigg Erich A", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" } ], "reference": [ { "type": "PubMed", "id": "15235793", "url": "https://glygen.org/publication/PubMed/15235793" } ] }, { "title": "Timing and checkpoints in the regulation of mitotic progression.", "journal": "Developmental cell", "date": "2004-07", "authors": "Meraldi Patrick, Draviam Viji M, Sorger Peter K", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" } ], "reference": [ { "type": "PubMed", "id": "15239953", "url": "https://glygen.org/publication/PubMed/15239953" } ] }, { "title": "Vertebrate shugoshin links sister centromere cohesion and kinetochore microtubule stability in mitosis.", "journal": "Cell", "date": "2004", "authors": "Salic A, Waters JC, Mitchison TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-2500257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2500257" } ], "reference": [ { "type": "PubMed", "id": "15339662", "url": "https://glygen.org/publication/PubMed/15339662" } ] }, { "title": "A conserved Mis12 centromere complex is linked to heterochromatic HP1 and outer kinetochore protein Zwint-1.", "journal": "Nat. Cell Biol.", "date": "2004", "authors": "Obuse C, Iwasaki O, Kiyomitsu T, Goshima G, Toyoda Y, Yanagida M", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" } ], "reference": [ { "type": "PubMed", "id": "15502821", "url": "https://glygen.org/publication/PubMed/15502821" } ] }, { "title": "Formin is a processive motor that requires profilin to accelerate actin assembly and associated ATP hydrolysis.", "journal": "Cell", "date": "2004", "authors": "Romero S, Le Clainche C, Didry D, Egile C, Pantaloni D, Carlier MF", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "15507212", "url": "https://glygen.org/publication/PubMed/15507212" } ] }, { "title": "Hec1 and nuf2 are core components of the kinetochore outer plate essential for organizing microtubule attachment sites.", "journal": "Molecular biology of the cell", "date": "2005-02", "authors": "DeLuca Jennifer G, Dong Yimin, Hergert Polla, Strauss Joshua, Hickey Jennifer M, Salmon E D, McEwen Bruce F", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" } ], "reference": [ { "type": "PubMed", "id": "15548592", "url": "https://glygen.org/publication/PubMed/15548592" } ] }, { "title": "The functional region of CENP-H interacts with the Nuf2 complex that localizes to centromere during mitosis.", "journal": "Mol. Cell. Biol.", "date": "2005", "authors": "Mikami Y, Hori T, Kimura H, Fukagawa T", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" } ], "reference": [ { "type": "PubMed", "id": "15713649", "url": "https://glygen.org/publication/PubMed/15713649" } ] }, { "title": "Human Bub1 defines the persistent cohesion site along the mitotic chromosome by affecting Shugoshin localization.", "journal": "Current biology : CB", "date": "2005", "authors": "Kitajima TS, Hauf S, Ohsugi M, Yamamoto T, Watanabe Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-2500257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2500257" } ], "reference": [ { "type": "PubMed", "id": "15723797", "url": "https://glygen.org/publication/PubMed/15723797" } ] }, { "title": "Dissociation of cohesin from chromosome arms and loss of arm cohesion during early mitosis depends on phosphorylation of SA2.", "journal": "PLoS biology", "date": "2005", "authors": "Hauf S, Roitinger E, Koch B, Dittrich CM, Mechtler K, Peters JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2500257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2500257" } ], "reference": [ { "type": "PubMed", "id": "15737063", "url": "https://glygen.org/publication/PubMed/15737063" } ] }, { "title": "ZW10 links mitotic checkpoint signaling to the structural kinetochore.", "journal": "J. Cell Biol.", "date": "2005", "authors": "Kops Geert J P L, Kim Yumi, Weaver Beth A A, Mao Yinghui, McLeod Ian, Yates John R, Tagaya Mitsuo, Cleveland Don W", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" } ], "reference": [ { "type": "PubMed", "id": "15824131", "url": "https://glygen.org/publication/PubMed/15824131" } ] }, { "title": "Structural and mechanistic insights into the interaction between Rho and mammalian Dia.", "journal": "Nature", "date": "2005", "authors": "Rose R, Weyand M, Lammers M, Ishizaki T, Ahmadian MR, Wittinghofer A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "15864301", "url": "https://glygen.org/publication/PubMed/15864301" } ] }, { "title": "Structural basis of Rho GTPase-mediated activation of the formin mDia1.", "journal": "Molecular cell", "date": "2005", "authors": "Otomo T, Otomo C, Tomchick DR, Machius M, Rosen MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "15866170", "url": "https://glygen.org/publication/PubMed/15866170" } ] }, { "title": "RhoB regulates endosome transport by promoting actin assembly on endosomal membranes through Dia1.", "journal": "Journal of cell science", "date": "2005", "authors": "Fernandez-Borja M, Janssen L, Verwoerd D, Hordijk P, Neefjes J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "15944396", "url": "https://glygen.org/publication/PubMed/15944396" } ] }, { "title": "Architecture of the human Ndc80-Hec1 complex, a critical constituent of the outer kinetochore.", "journal": "J. Biol. Chem.", "date": "2005", "authors": "Ciferri C, De Luca J, Monzani S, Ferrari KJ, Ristic D, Wyman C, Stark H, Kilmartin J, Salmon ED, Musacchio A", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" } ], "reference": [ { "type": "PubMed", "id": "15961401", "url": "https://glygen.org/publication/PubMed/15961401" } ] }, { "title": "Polo-like kinase 1 creates the tension-sensing 3F3/2 phosphoepitope and modulates the association of spindle-checkpoint proteins at kinetochores.", "journal": "Curr. Biol.", "date": "2005", "authors": "Ahonen LJ, Kallio MJ, Daum JR, Bolton M, Manke IA, Yaffe MB, Stukenberg PT, Gorbsky GJ", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" } ], "reference": [ { "type": "PubMed", "id": "15964272", "url": "https://glygen.org/publication/PubMed/15964272" } ] }, { "title": "The regulation of mDia1 by autoinhibition and its release by Rho*GTP.", "journal": "The EMBO journal", "date": "2005", "authors": "Lammers M, Rose R, Scrima A, Wittinghofer A", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "16292343", "url": "https://glygen.org/publication/PubMed/16292343" } ] }, { "title": "Control of the assembly of ATP- and ADP-actin by formins and profilin.", "journal": "Cell", "date": "2006", "authors": "Kovar DR, Harris ES, Mahaffy R, Higgs HN, Pollard TD", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "16439214", "url": "https://glygen.org/publication/PubMed/16439214" } ] }, { "title": "Shugoshin collaborates with protein phosphatase 2A to protect cohesin.", "journal": "Nature", "date": "2006", "authors": "Kitajima TS, Sakuno T, Ishiguro K, Iemura S, Natsume T, Kawashima SA, Watanabe Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-2500257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2500257" } ], "reference": [ { "type": "PubMed", "id": "16541025", "url": "https://glygen.org/publication/PubMed/16541025" } ] }, { "title": "Phosphoproteome analysis of the human mitotic spindle.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Nousiainen M, Sillje HH, Sauer G, Nigg EA, Korner R", "evidence": [ { "database": "iPTMnet", "id": "O14777", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14777" } ], "reference": [ { "type": "PubMed", "id": "16565220", "url": "https://glygen.org/publication/PubMed/16565220" } ] }, { "title": "The human CENP-A centromeric nucleosome-associated complex.", "journal": "Nature cell biology", "date": "2006", "authors": "Foltz DR, Jansen LE, Black BE, Bailey AO, Yates JR 3rd, Cleveland DW", "evidence": [ { "database": "Reactome", "id": "R-HSA-68877", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68877" } ], "reference": [ { "type": "PubMed", "id": "16622419", "url": "https://glygen.org/publication/PubMed/16622419" } ] }, { "title": "The CENP-H-I complex is required for the efficient incorporation of newly synthesized CENP-A into centromeres.", "journal": "Nature cell biology", "date": "2006", "authors": "Okada M, Cheeseman IM, Hori T, Okawa K, McLeod IX, Yates JR 3rd, Desai A, Fukagawa T", "evidence": [ { "database": "Reactome", "id": "R-HSA-68877", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68877" } ], "reference": [ { "type": "PubMed", "id": "16622420", "url": "https://glygen.org/publication/PubMed/16622420" } ] }, { "title": "Human Scc4 is required for cohesin binding to chromatin, sister-chromatid cohesion, and mitotic progression.", "journal": "Current biology : CB", "date": "2006", "authors": "Watrin E, Schleiffer A, Tanaka K, Eisenhaber F, Nasmyth K, Peters JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2500257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2500257" } ], "reference": [ { "type": "PubMed", "id": "16682347", "url": "https://glygen.org/publication/PubMed/16682347" } ] }, { "title": "Hec1 sequentially recruits Zwint-1 and ZW10 to kinetochores for faithful chromosome segregation and spindle checkpoint control.", "journal": "Oncogene", "date": "2006-11-02", "authors": "Lin Y-T, Chen Y, Wu G, Lee W-H", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" } ], "reference": [ { "type": "PubMed", "id": "16732327", "url": "https://glygen.org/publication/PubMed/16732327" } ] }, { "title": "Human EML4, a novel member of the EMAP family, is essential for microtubule formation.", "journal": "Experimental cell research", "date": "2006", "authors": "Pollmann M, Parwaresch R, Adam-Klages S, Kruse ML, Buck F, Heidebrecht HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648025", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648025" } ], "reference": [ { "type": "PubMed", "id": "16890222", "url": "https://glygen.org/publication/PubMed/16890222" } ] }, { "title": "Autoinhibition regulates cellular localization and actin assembly activity of the diaphanous-related formins FRLalpha and mDia1.", "journal": "The Journal of cell biology", "date": "2006", "authors": "Seth A, Otomo C, Rosen MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "16943183", "url": "https://glygen.org/publication/PubMed/16943183" } ] }, { "title": "Mapping the assembly pathways that specify formation of the trilaminar kinetochore plates in human cells.", "journal": "The Journal of cell biology", "date": "2006", "authors": "Liu ST, Rattner JB, Jablonski SA, Yen TJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-68877", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68877" } ], "reference": [ { "type": "PubMed", "id": "17030981", "url": "https://glygen.org/publication/PubMed/17030981" } ] }, { "title": "Human Wapl is a cohesin-binding protein that promotes sister-chromatid resolution in mitotic prophase.", "journal": "Current biology : CB", "date": "2006", "authors": "Gandhi R, Gillespie PJ, Hirano T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2500257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2500257" } ], "reference": [ { "type": "PubMed", "id": "17112726", "url": "https://glygen.org/publication/PubMed/17112726" } ] }, { "title": "Wapl controls the dynamic association of cohesin with chromatin.", "journal": "Cell", "date": "2006", "authors": "Kueng S, Hegemann B, Peters BH, Lipp JJ, Schleiffer A, Mechtler K, Peters JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2500257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2500257" } ], "reference": [ { "type": "PubMed", "id": "17113138", "url": "https://glygen.org/publication/PubMed/17113138" } ] }, { "title": "The conserved KMN network constitutes the core microtubule-binding site of the kinetochore.", "journal": "Cell", "date": "2006", "authors": "Cheeseman IM, Chappie JS, Wilson-Kubalek EM, Desai A", "evidence": [ { "database": "Reactome", "id": "R-HSA-68877", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68877" } ], "reference": [ { "type": "PubMed", "id": "17129783", "url": "https://glygen.org/publication/PubMed/17129783" } ] }, { "title": "Echinoderm microtubule-associated protein like protein 4, a member of the echinoderm microtubule-associated protein family, stabilizes microtubules.", "journal": "Neuroscience", "date": "2007", "authors": "Houtman SH, Rutteman M, De Zeeuw CI, French PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648025", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648025" } ], "reference": [ { "type": "PubMed", "id": "17196341", "url": "https://glygen.org/publication/PubMed/17196341" } ] }, { "title": "RhoB and the mammalian Diaphanous-related formin mDia2 in endosome trafficking.", "journal": "Experimental cell research", "date": "2007", "authors": "Wallar BJ, Deward AD, Resau JH, Alberts AS", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "17198702", "url": "https://glygen.org/publication/PubMed/17198702" } ] }, { "title": "Profilin-actin complexes directly elongate actin filaments at the barbed end.", "journal": "Biochemistry", "date": "1992", "authors": "Pring M, Weber A, Bubb MR", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "1737036", "url": "https://glygen.org/publication/PubMed/1737036" } ] }, { "title": "High-resolution structural analysis of mammalian profilin 2a complex formation with two physiological ligands: the formin homology 1 domain of mDia1 and the proline-rich domain of VASP.", "journal": "Journal of molecular biology", "date": "2008", "authors": "Kursula P, Kursula I, Massimi M, Song YH, Downer J, Stanley WA, Witke W, Wilmanns M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "18001770", "url": "https://glygen.org/publication/PubMed/18001770" } ] }, { "title": "Molecular architecture of the kinetochore-microtubule interface.", "journal": "Nature reviews. Molecular cell biology", "date": "2008", "authors": "Cheeseman IM, Desai A", "evidence": [ { "database": "Reactome", "id": "R-HSA-2500257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2500257" } ], "reference": [ { "type": "PubMed", "id": "18097444", "url": "https://glygen.org/publication/PubMed/18097444" } ] }, { "title": "The mitotic checkpoint kinase NEK2A regulates kinetochore microtubule attachment stability.", "journal": "Oncogene", "date": "2008", "authors": "Du J, Cai X, Yao J, Ding X, Wu Q, Pei S, Jiang K, Zhang Y, Wang W, Shi Y, Lai Y, Shen J, Teng M, Huang H, Fei Q, Reddy ES, Zhu J, Jin C, Yao X", "evidence": [ { "database": "iPTMnet", "id": "O14777", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14777" } ], "reference": [ { "type": "PubMed", "id": "18297113", "url": "https://glygen.org/publication/PubMed/18297113" } ] }, { "title": "Heterochromatin links to centromeric protection by recruiting shugoshin.", "journal": "Nature", "date": "2008", "authors": "Yamagishi Y, Sakuno T, Shimura M, Watanabe Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-2500257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2500257" } ], "reference": [ { "type": "PubMed", "id": "18716626", "url": "https://glygen.org/publication/PubMed/18716626" } ] }, { "title": "Clustering of VASP actively drives processive, WH2 domain-mediated actin filament elongation.", "journal": "The EMBO journal", "date": "2008", "authors": "Breitsprecher D, Kiesewetter AK, Linkner J, Urbanke C, Resch GP, Small JV, Faix J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "18923426", "url": "https://glygen.org/publication/PubMed/18923426" } ] }, { "title": "Evaluation of the low-specificity protease elastase for large-scale phosphoproteome analysis.", "journal": "Analytical chemistry", "date": "2008", "authors": "Wang B, Malik R, Nigg EA, Korner R", "evidence": [ { "database": "iPTMnet", "id": "O14777", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14777" } ], "reference": [ { "type": "PubMed", "id": "19007248", "url": "https://glygen.org/publication/PubMed/19007248" } ] }, { "title": "SCAI acts as a suppressor of cancer cell invasion through the transcriptional control of beta1-integrin.", "journal": "Nature cell biology", "date": "2009", "authors": "Brandt DT, Baarlink C, Kitzing TM, Kremmer E, Ivaska J, Nollau P, Grosse R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "19350017", "url": "https://glygen.org/publication/PubMed/19350017" } ] }, { "title": "Phosphoproteomic analysis of human embryonic stem cells.", "journal": "Cell stem cell", "date": "2009", "authors": "Brill LM, Xiong W, Lee KB, Ficarro SB, Crain A, Xu Y, Terskikh A, Snyder EY, Ding S", "evidence": [ { "database": "iPTMnet", "id": "O14777", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14777" } ], "reference": [ { "type": "PubMed", "id": "19664994", "url": "https://glygen.org/publication/PubMed/19664994" } ] }, { "title": "Quantitative analysis of the human spindle phosphoproteome at distinct mitotic stages.", "journal": "Journal of proteome research", "date": "2009", "authors": "Malik R, Lenobel R, Santamaria A, Ries A, Nigg EA, Korner R", "evidence": [ { "database": "iPTMnet", "id": "O14777", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14777" } ], "reference": [ { "type": "PubMed", "id": "19691289", "url": "https://glygen.org/publication/PubMed/19691289" } ] }, { "title": "Releasing cohesin from chromosome arms in early mitosis: opposing actions of Wapl-Pds5 and Sgo1.", "journal": "Genes & development", "date": "2009", "authors": "Shintomi K, Hirano T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2500257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2500257" } ], "reference": [ { "type": "PubMed", "id": "19696148", "url": "https://glygen.org/publication/PubMed/19696148" } ] }, { "title": "Formin-like 1 (FMNL1) is regulated by N-terminal myristoylation and induces polarized membrane blebbing.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Han Y, Eppinger E, Schuster IG, Weigand LU, Liang X, Kremmer E, Peschel C, Krackhardt AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "19815554", "url": "https://glygen.org/publication/PubMed/19815554" } ] }, { "title": "Phosphorylation of H2A by Bub1 prevents chromosomal instability through localizing shugoshin.", "journal": "Science (New York, N.Y.)", "date": "2010", "authors": "Kawashima SA, Yamagishi Y, Honda T, Ishiguro K, Watanabe Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-2500257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2500257" } ], "reference": [ { "type": "PubMed", "id": "19965387", "url": "https://glygen.org/publication/PubMed/19965387" } ] }, { "title": "[PI3-kinase mediates activity of RhoA and interaction of RhoA with mDia1 in thrombin-induced platelet aggregation].", "journal": "Zhongguo shi yan xue ye xue za zhi", "date": "2009", "authors": "Gao GX, Dong HJ, Gu HT, Gao Y, Pan YZ, Yang Y, Chen XQ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "20030946", "url": "https://glygen.org/publication/PubMed/20030946" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" }, { "database": "iPTMnet", "id": "O14777", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14777" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "Formin-like 2 drives amoeboid invasive cell motility downstream of RhoC.", "journal": "Oncogene", "date": "2010", "authors": "Kitzing TM, Wang Y, Pertz O, Copeland JW, Grosse R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "20101212", "url": "https://glygen.org/publication/PubMed/20101212" } ] }, { "title": "Aurora B phosphorylates spatially distinct targets to differentially regulate the kinetochore-microtubule interface.", "journal": "Molecular cell", "date": "2010", "authors": "Welburn JP, Vleugel M, Liu D, Yates JR 3rd, Lampson MA, Fukagawa T, Cheeseman IM", "evidence": [ { "database": "iPTMnet", "id": "O14777", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14777" } ], "reference": [ { "type": "PubMed", "id": "20471944", "url": "https://glygen.org/publication/PubMed/20471944" } ] }, { "title": "RhoA and DIAPH1 mediate adrenocorticotropin-stimulated cortisol biosynthesis by regulating mitochondrial trafficking.", "journal": "Endocrinology", "date": "2010", "authors": "Li D, Sewer MB", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "20591975", "url": "https://glygen.org/publication/PubMed/20591975" } ] }, { "title": "Sororin mediates sister chromatid cohesion by antagonizing Wapl.", "journal": "Cell", "date": "2010", "authors": "Nishiyama T, Ladurner R, Schmitz J, Kreidl E, Schleiffer A, Bhaskara V, Bando M, Shirahige K, Hyman AA, Mechtler K, Peters JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-2500257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2500257" } ], "reference": [ { "type": "PubMed", "id": "21111234", "url": "https://glygen.org/publication/PubMed/21111234" } ] }, { "title": "Bi-modal regulation of a formin by srGAP2.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Mason FM, Heimsath EG, Higgs HN, Soderling SH", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "21148482", "url": "https://glygen.org/publication/PubMed/21148482" } ] }, { "title": "Aurora B regulates formin mDia3 in achieving metaphase chromosome alignment.", "journal": "Developmental cell", "date": "2011", "authors": "Cheng L, Zhang J, Ahmad S, Rozier L, Yu H, Deng H, Mao Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "21397845", "url": "https://glygen.org/publication/PubMed/21397845" } ] }, { "title": "RhoA and RhoC have distinct roles in migration and invasion by acting through different targets.", "journal": "The Journal of cell biology", "date": "2011", "authors": "Vega FM, Fruhwirth G, Ng T, Ridley AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "21576392", "url": "https://glygen.org/publication/PubMed/21576392" } ] }, { "title": "Phosphorylation of the Ndc80 complex protein, HEC1, by Nek2 kinase modulates chromosome alignment and signaling of the spindle assembly checkpoint.", "journal": "Molecular biology of the cell", "date": "2011", "authors": "Wei R, Ngo B, Wu G, Lee WH", "evidence": [ { "database": "iPTMnet", "id": "O14777", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14777" } ], "reference": [ { "type": "PubMed", "id": "21832156", "url": "https://glygen.org/publication/PubMed/21832156" } ] }, { "title": "Dynamic remodeling of the actin cytoskeleton by FMNL1gamma is required for structural maintenance of the Golgi complex.", "journal": "Journal of cell science", "date": "2011", "authors": "Colon-Franco JM, Gomez TS, Billadeau DD", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "21868368", "url": "https://glygen.org/publication/PubMed/21868368" } ] }, { "title": "Regulation of sororin by Cdk1-mediated phosphorylation.", "journal": "Journal of cell science", "date": "2011", "authors": "Dreier MR, Bekier ME 2nd, Taylor WR", "evidence": [ { "database": "Reactome", "id": "R-HSA-2500257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2500257" } ], "reference": [ { "type": "PubMed", "id": "21878504", "url": "https://glygen.org/publication/PubMed/21878504" } ] }, { "title": "Interaction of Sororin protein with polo-like kinase 1 mediates resolution of chromosomal arm cohesion.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Zhang N, Panigrahi AK, Mao Q, Pati D", "evidence": [ { "database": "Reactome", "id": "R-HSA-2500257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2500257" } ], "reference": [ { "type": "PubMed", "id": "21987589", "url": "https://glygen.org/publication/PubMed/21987589" } ] }, { "title": "The C terminus of formin FMNL3 accelerates actin polymerization and contains a WH2 domain-like sequence that binds both monomers and filament barbed ends.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Heimsath EG Jr, Higgs HN", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "22094460", "url": "https://glygen.org/publication/PubMed/22094460" } ] }, { "title": "The formin FMNL3 is a cytoskeletal regulator of angiogenesis.", "journal": "Journal of cell science", "date": "2012", "authors": "Hetheridge C, Scott AN, Swain RK, Copeland JW, Higgs HN, Bicknell R, Mellor H", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "22275430", "url": "https://glygen.org/publication/PubMed/22275430" } ] }, { "title": "Recruitment of the human Cdt1 replication licensing protein by the loop domain of Hec1 is required for stable kinetochore-microtubule attachment.", "journal": "Nat. Cell Biol.", "date": "2012", "authors": "Varma D, Chandrasekaran S, Sundin LJ, Reidy KT, Wan X, Chasse DA, Nevis KR, DeLuca JG, Salmon ED, Cook JG", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" } ], "reference": [ { "type": "PubMed", "id": "22581055", "url": "https://glygen.org/publication/PubMed/22581055" } ] }, { "title": "FMNL2 drives actin-based protrusion and migration downstream of Cdc42.", "journal": "Current biology : CB", "date": "2012", "authors": "Block J, Breitsprecher D, Kuhn S, Winterhoff M, Kage F, Geffers R, Duwe P, Rohn JL, Baum B, Brakebusch C, Geyer M, Stradal TE, Faix J, Rottner K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "22608513", "url": "https://glygen.org/publication/PubMed/22608513" } ] }, { "title": "Protein N-myristoylation is required for cellular morphological changes induced by two formin family proteins, FMNL2 and FMNL3.", "journal": "Bioscience, biotechnology, and biochemistry", "date": "2012", "authors": "Moriya K, Yamamoto T, Takamitsu E, Matsunaga Y, Kimoto M, Fukushige D, Kimoto C, Suzuki T, Utsumi T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "22790947", "url": "https://glygen.org/publication/PubMed/22790947" } ] }, { "title": "HDAC8 mutations in Cornelia de Lange syndrome affect the cohesin acetylation cycle.", "journal": "Nature", "date": "2012", "authors": "Deardorff MA, Bando M, Nakato R, Watrin E, Itoh T, Minamino M, Saitoh K, Komata M, Katou Y, Clark D, Cole KE, De Baere E, Decroos C, Di Donato N, Ernst S, Francey LJ, Gyftodimou Y, Hirashima K, Hullings M, Ishikawa Y, Jaulin C, Kaur M, Kiyono T, Lombardi PM, Magnaghi-Jaulin L, Mortier GR, Nozaki N, Petersen MB, Seimiya H, Siu VM, Suzuki Y, Takagaki K, Wilde JJ, Willems PJ, Prigent C, Gillessen-Kaesbach G, Christianson DW, Kaiser FJ, Jackson LG, Hirota T, Krantz ID, Shirahige K", "evidence": [ { "database": "Reactome", "id": "R-HSA-2500257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2500257" } ], "reference": [ { "type": "PubMed", "id": "22885700", "url": "https://glygen.org/publication/PubMed/22885700" } ] }, { "title": "The kinetochore-bound Ska1 complex tracks depolymerizing microtubules and binds to curved protofilaments.", "journal": "Developmental cell", "date": "2012", "authors": "Schmidt JC, Arthanari H, Boeszoermenyi A, Dashkevich NM, Wilson-Kubalek EM, Monnier N, Markus M, Oberer M, Milligan RA, Bathe M, Wagner G, Grishchuk EL, Cheeseman IM", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" } ], "reference": [ { "type": "PubMed", "id": "23085020", "url": "https://glygen.org/publication/PubMed/23085020" } ] }, { "title": "Toward a comprehensive characterization of a human cancer cell phosphoproteome.", "journal": "Journal of proteome research", "date": "2013", "authors": "Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" }, { "database": "iPTMnet", "id": "O14777", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14777" } ], "reference": [ { "type": "PubMed", "id": "23186163", "url": "https://glygen.org/publication/PubMed/23186163" } ] }, { "title": "FMNL3 FH2-actin structure gives insight into formin-mediated actin nucleation and elongation.", "journal": "Nature structural & molecular biology", "date": "2013", "authors": "Thompson ME, Heimsath EG, Gauvin TJ, Higgs HN, Kull FJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "23222643", "url": "https://glygen.org/publication/PubMed/23222643" } ] }, { "title": "FMNL1 promotes proliferation and migration of leukemia cells.", "journal": "Journal of leukocyte biology", "date": "2013", "authors": "Favaro P, Traina F, Machado-Neto JA, Lazarini M, Lopes MR, Pereira JK, Costa FF, Infante E, Ridley AJ, Saad ST", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "23801653", "url": "https://glygen.org/publication/PubMed/23801653" } ] }, { "title": "Lateral to end-on conversion of chromosome-microtubule attachment requires kinesins CENP-E and MCAK.", "journal": "Current biology : CB", "date": "2013", "authors": "Shrestha RL, Draviam VM", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" } ], "reference": [ { "type": "PubMed", "id": "23891108", "url": "https://glygen.org/publication/PubMed/23891108" } ] }, { "title": "Novel small molecules disrupting Hec1/Nek2 interaction ablate tumor progression by triggering Nek2 degradation through a death-trap mechanism.", "journal": "Oncogene", "date": "2015", "authors": "Hu CM, Zhu J, Guo XE, Chen W, Qiu XL, Ngo B, Chien R, Wang YV, Tsai CY, Wu G, Kim Y, Lopez R, Chamberlin AR, Lee EY, Lee WH", "evidence": [ { "database": "iPTMnet", "id": "O14777", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14777" } ], "reference": [ { "type": "PubMed", "id": "24662830", "url": "https://glygen.org/publication/PubMed/24662830" } ] }, { "title": "Formins as effector proteins of Rho GTPases.", "journal": "Small GTPases", "date": "2014", "authors": "Kuhn S, Geyer M", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "24914801", "url": "https://glygen.org/publication/PubMed/24914801" } ] }, { "title": "Microtubule association of EML proteins and the EML4-ALK variant 3 oncoprotein require an N-terminal trimerization domain.", "journal": "The Biochemical journal", "date": "2015", "authors": "Richards MW, O'Regan L, Roth D, Montgomery JM, Straube A, Fry AM, Bayliss R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648025", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648025" } ], "reference": [ { "type": "PubMed", "id": "25740311", "url": "https://glygen.org/publication/PubMed/25740311" } ] }, { "title": "Chromokinesin Kid and kinetochore kinesin CENP-E differentially support chromosome congression without end-on attachment to microtubules.", "journal": "Nature communications", "date": "2015", "authors": "Iemura K, Tanaka K", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" } ], "reference": [ { "type": "PubMed", "id": "25743205", "url": "https://glygen.org/publication/PubMed/25743205" } ] }, { "title": "EML4 promotes the loading of NUDC to the spindle for mitotic progression.", "journal": "Cell cycle (Georgetown, Tex.)", "date": "2015", "authors": "Chen D, Ito S, Yuan H, Hyodo T, Kadomatsu K, Hamaguchi M, Senga T", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648025", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648025" } ], "reference": [ { "type": "PubMed", "id": "25789526", "url": "https://glygen.org/publication/PubMed/25789526" } ] }, { "title": "ASPP1/2-PP1 complexes are required for chromosome segregation and kinetochore-microtubule attachments.", "journal": "Oncotarget", "date": "2015", "authors": "Zhang P, Zhang Y, Gao K, Wang Y, Jin X, Wei Y, Saiyin H, Wang D, Peng J, Ma J, Tang Y, Wumaier R, Yu H, Dong Y, Huang H, Yu L, Wang C", "evidence": [ { "database": "iPTMnet", "id": "O14777", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14777" } ], "reference": [ { "type": "PubMed", "id": "26595804", "url": "https://glygen.org/publication/PubMed/26595804" } ] }, { "title": "A TOG protein confers tension sensitivity to kinetochore-microtubule attachments.", "journal": "Cell", "date": "2016", "authors": "Miller Matthew P, Asbury Charles L, Biggins Sue", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" } ], "reference": [ { "type": "PubMed", "id": "27156448", "url": "https://glygen.org/publication/PubMed/27156448" } ] }, { "title": "Preclinical activity of MBM-5 in gastrointestinal cancer by inhibiting NEK2 kinase activity.", "journal": "Oncotarget", "date": "2016", "authors": "Fang Y, Kong Y, Xi J, Zhu M, Zhu T, Jiang T, Hu W, Ma M, Zhang X", "evidence": [ { "database": "iPTMnet", "id": "O14777", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14777" } ], "reference": [ { "type": "PubMed", "id": "27764815", "url": "https://glygen.org/publication/PubMed/27764815" } ] }, { "title": "A novel strategy for global mapping of O-GlcNAc proteins and peptides using selective enzymatic deglycosylation, HILIC enrichment and mass spectrometry identification.", "journal": "Talanta", "date": "2017", "authors": "Shen B, Zhang W, Shi Z, Tian F, Deng Y, Sun C, Wang G, Qin W, Qian X", "evidence": [ { "database": "O-GlcNAc Database", "id": "O14777", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14777" } ], "reference": [ { "type": "PubMed", "id": "28411811", "url": "https://glygen.org/publication/PubMed/28411811" } ] }, { "title": "The Ndc80 complex targets Bod1 to human mitotic kinetochores.", "journal": "Open biology", "date": "2017", "authors": "Schleicher K, Porter M, Ten Have S, Sundaramoorthy R, Porter IM, Swedlow JR", "evidence": [ { "database": "iPTMnet", "id": "O14777", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14777" } ], "reference": [ { "type": "PubMed", "id": "29142109", "url": "https://glygen.org/publication/PubMed/29142109" } ] }, { "title": "Aurora A kinase phosphorylates Hec1 to regulate metaphase kinetochore-microtubule dynamics.", "journal": "The Journal of cell biology", "date": "2018", "authors": "DeLuca KF, Meppelink A, Broad AJ, Mick JE, Peersen OB, Pektas S, Lens SMA, DeLuca JG", "evidence": [ { "database": "iPTMnet", "id": "O14777", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14777" } ], "reference": [ { "type": "PubMed", "id": "29187526", "url": "https://glygen.org/publication/PubMed/29187526" } ] }, { "title": "Dynamic acetylation of the kinetochore-associated protein HEC1 ensures accurate microtubule-kinetochore attachment.", "journal": "The Journal of biological chemistry", "date": "2019", "authors": "Zhao G, Cheng Y, Gui P, Cui M, Liu W, Wang W, Wang X, Ali M, Dou Z, Niu L, Liu H, Anderson L, Ruan K, Hong J, Yao X", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" }, { "database": "iPTMnet", "id": "O14777", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14777" } ], "reference": [ { "type": "PubMed", "id": "30409912", "url": "https://glygen.org/publication/PubMed/30409912" } ] }, { "title": "Mitotic phosphorylation by NEK6 and NEK7 reduces the microtubule affinity of EML4 to promote chromosome congression.", "journal": "Science signaling", "date": "2019", "authors": "Adib R, Montgomery JM, Atherton J, O'Regan L, Richards MW, Straatman KR, Roth D, Straube A, Bayliss R, Moores CA, Fry AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9648025", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648025" } ], "reference": [ { "type": "PubMed", "id": "31409757", "url": "https://glygen.org/publication/PubMed/31409757" } ] }, { "title": "Untangling the contribution of Haspin and Bub1 to Aurora B function during mitosis.", "journal": "The Journal of cell biology", "date": "2020", "authors": "Hadders MA, Hindriksen S, Truong MA, Mhaskar AN, Wopken JP, Vromans MJM, Lens SMA", "evidence": [ { "database": "iPTMnet", "id": "O14777", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14777" } ], "reference": [ { "type": "PubMed", "id": "32027339", "url": "https://glygen.org/publication/PubMed/32027339" } ] }, { "title": "The Hec1/Ndc80 tail domain is required for force generation at kinetochores, but is dispensable for kinetochore-microtubule attachment formation and Ska complex recruitment.", "journal": "Molecular biology of the cell", "date": "2020", "authors": "Wimbish RT, DeLuca KF, Mick JE, Himes J, Jimenez-Sanchez I, Jeyaprakash AA, DeLuca JG", "evidence": [ { "database": "iPTMnet", "id": "O14777", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14777" } ], "reference": [ { "type": "PubMed", "id": "32401635", "url": "https://glygen.org/publication/PubMed/32401635" } ] }, { "title": "Bioinformatic analysis revealing mitotic spindle assembly regulated NDC80 and MAD2L1 as prognostic biomarkers in non-small cell lung cancer development.", "journal": "BMC medical genomics", "date": "2020", "authors": "Wei R, Wang Z, Zhang Y, Wang B, Shen N, E L, Li X, Shang L, Shang Y, Yan W, Zhang X, Ma W, Wang C", "evidence": [ { "database": "RefSeq", "id": "NP_006092", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006092" } ], "reference": [ { "type": "PubMed", "id": "32795325", "url": "https://glygen.org/publication/PubMed/32795325" } ] }, { "title": "Involvement of NEK2 and its interaction with NDC80 and CEP250 in hepatocellular carcinoma.", "journal": "BMC medical genomics", "date": "2020", "authors": "Zeng L, Fan X, Wang X, Deng H, Zhang X, Zhang K, He S, Li N, Han Q, Liu Z", "evidence": [ { "database": "RefSeq", "id": "NP_006092", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006092" } ], "reference": [ { "type": "PubMed", "id": "33109182", "url": "https://glygen.org/publication/PubMed/33109182" } ] }, { "title": "chTOG is a conserved mitotic error correction factor.", "journal": "eLife", "date": "2020", "authors": "Herman JA, Miller MP, Biggins S", "evidence": [ { "database": "iPTMnet", "id": "O14777", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14777" } ], "reference": [ { "type": "PubMed", "id": "33377866", "url": "https://glygen.org/publication/PubMed/33377866" } ] }, { "title": "Chromosome oscillation promotes Aurora A-dependent Hec1 phosphorylation and mitotic fidelity.", "journal": "The Journal of cell biology", "date": "2021", "authors": "Iemura K, Natsume T, Maehara K, Kanemaki MT, Tanaka K", "evidence": [ { "database": "RefSeq", "id": "NP_006092", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006092" }, { "database": "iPTMnet", "id": "O14777", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14777" } ], "reference": [ { "type": "PubMed", "id": "33988677", "url": "https://glygen.org/publication/PubMed/33988677" } ] }, { "title": "NDC80 Enhances Cisplatin-resistance in Triple-negative Breast Cancer.", "journal": "Archives of medical research", "date": "2022", "authors": "Li J, Xu X, Peng X", "evidence": [ { "database": "RefSeq", "id": "NP_006092", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006092" } ], "reference": [ { "type": "PubMed", "id": "35346500", "url": "https://glygen.org/publication/PubMed/35346500" } ] }, { "title": "MKLP2 functions in early mitosis to ensure proper chromosome congression.", "journal": "Journal of cell science", "date": "2022", "authors": "Schrock MS, Scarberry L, Stromberg BR, Sears C, Torres AE, Tallman D, Krupinski L, Chakravarti A, Summers MK", "evidence": [ { "database": "iPTMnet", "id": "O14777", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14777" } ], "reference": [ { "type": "PubMed", "id": "35638575", "url": "https://glygen.org/publication/PubMed/35638575" } ] }, { "title": "CircNDC80 promotes glioblastoma multiforme tumorigenesis via the miR-139-5p/ECE1 pathway.", "journal": "Journal of translational medicine", "date": "2023-01-12", "authors": "Wang Yuhang, Wang Binbin, Zhou Fengqi, Lv Kun, Xu Xiupeng, Cao Wenping", "evidence": [ { "database": "RefSeq", "id": "NP_006092", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_006092" } ], "reference": [ { "type": "PubMed", "id": "36635757", "url": "https://glygen.org/publication/PubMed/36635757" } ] }, { "title": "HEC binds to the seventh regulatory subunit of the 26 S proteasome and modulates the proteolysis of mitotic cyclins.", "journal": "J. Biol. Chem.", "date": "1997", "authors": "Chen Y, Sharp ZD, Lee WH", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" } ], "reference": [ { "type": "PubMed", "id": "9295362", "url": "https://glygen.org/publication/PubMed/9295362" } ] }, { "title": "HEC, a novel nuclear protein rich in leucine heptad repeats specifically involved in mitosis.", "journal": "Molecular and cellular biology", "date": "1997", "authors": "Chen Y, Riley DJ, Chen PL, Lee WH", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" } ], "reference": [ { "type": "PubMed", "id": "9315664", "url": "https://glygen.org/publication/PubMed/9315664" } ] }, { "title": "The role of profilin in actin polymerization and nucleotide exchange.", "journal": "Biochemistry", "date": "1998", "authors": "Korenbaum E, Nordberg P, Bjorkegren-Sjogren C, Schutt CE, Lindberg U, Karlsson R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5663220", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220" } ], "reference": [ { "type": "PubMed", "id": "9649308", "url": "https://glygen.org/publication/PubMed/9649308" } ] }, { "title": "Identification of Xenopus SMC protein complexes required for sister chromatid cohesion.", "journal": "Genes & development", "date": "1998", "authors": "Losada A, Hirano M, Hirano T", "evidence": [ { "database": "Reactome", "id": "R-HSA-2500257", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2500257" } ], "reference": [ { "type": "PubMed", "id": "9649503", "url": "https://glygen.org/publication/PubMed/9649503" } ] }, { "title": "Structure, expression, and function of human pituitary tumor-transforming gene (PTTG).", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "1999", "authors": "Zhang X, Horwitz GA, Prezant TR, Valentini A, Nakashima M, Bronstein MD, Melmed S", "evidence": [ { "database": "Reactome", "id": "R-HSA-2467813", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2467813" } ], "reference": [ { "type": "PubMed", "id": "9892021", "url": "https://glygen.org/publication/PubMed/9892021" } ] } ], "pathway": [ { "id": "hsa:10403", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:10403", "resource": "KEGG Pathway" }, { "id": "R-HSA-141430", "name": "Inactivation of APC/C via direct inhibition of the APC/C complex", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-141430", "resource": "Reactome", "description": "Inactivation of APC/C via direct inhibition of the APC/C complex" }, { "id": "R-HSA-141444", "name": "Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-141444", "resource": "Reactome", "description": "Amplification of signal from unattached kinetochores via a MAD2 inhibitory signal" }, { "id": "R-HSA-2467813", "name": "Separation of Sister Chromatids", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2467813", "resource": "Reactome", "description": "Separation of Sister Chromatids" }, { "id": "R-HSA-2500257", "name": "Resolution of Sister Chromatid Cohesion", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-2500257", "resource": "Reactome", "description": "Resolution of Sister Chromatid Cohesion" }, { "id": "R-HSA-5663220", "name": "RHO GTPases Activate Formins", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5663220", "resource": "Reactome", "description": "RHO GTPases Activate Formins" }, { "id": "R-HSA-68877", "name": "Mitotic Prometaphase", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-68877", "resource": "Reactome", "description": "Mitotic Prometaphase" }, { "id": "R-HSA-9648025", "name": "EML4 and NUDC in mitotic spindle formation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9648025", "resource": "Reactome", "description": "EML4 and NUDC in mitotic spindle formation" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A0G2K254-1", "protein_name": "Kinetochore protein NDC80", "gene_name": "Ndc80", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MKRSSVSSCGAGRLSMQELRSLDLNKPGLHTPQTERSTFGKLSTHKPTSERKVSIFGKRTSEHGSRNSQLGIFSSSEKIKDPRPLNDKAFIQQCIRQLYEFLTENGYVYSVSMKSLQAPSTKDFLKIFAFLYGFLCPSYELPDTKCEEEVPRIFKELGYPFALSKSSMYTVGAPHTWPHIVAALVWLTDCIKIHDAMKQSSPLFDDGQAWGEETEDGIKHNKLFLDYTKKCYEKFMTGADTFEDVDAELQAKLKDLYKVDASKLESLVEENKALNEQIARLEQEREKEPNRLISLRKLKASLQADVQNYKAYMSNLESHSSILEQKLSSLDEEIGRLELECETVKQENTRLQSVVDNQKYSIADIERINHEKNELQQTINKLTKDLEAEQQQMWNEELKYARGKEAIEAQLAEYHKLARKLKLIPKGAENSKGYDFEIKFNPEAGANCLVKYRTQVYAPLKELLNEIEEEINKALNKKMGLEDTLEQLNTVKTESKRAVRMLKEEVQKLDDLYQQKVKEAEEEDKKCASELDSLEKHKHLLESAVNEGLSEAMGELDAVQREYQLAVQTTTEERRKVGNNLQRLLEMVATHVGSLEKHLEEQIVKADREYEECTSEDLLENIRRIAEKYKSNAAQLKAPDK", "length": 641 }, "evidence": [ { "id": "O14777", "url": "https://omabrowser.org/oma/group/O14777/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "P40460-1", "protein_name": "Kinetochore protein NDC80", "gene_name": "NDC80", "tax_id": 559292, "organism": "Saccharomyces cerevisiae S288C", "sequence": { "sequence": "MQSSTSTDQHVLHHMDPHRFTSQIPTATSSQLRRRNSTNQGLTDMINKSIARNTISGTGIPTGGINKNKRTRSTVAGGTNGTALALNDKSNSRNSVSRLSINQLGSLQQHLSNRDPRPLRDKNFQSAIQEEIYDYLKKNKFDIETNHPISIKFLKQPTQKGFIIIFKWLYLRLDPGYGFTKSIENEIYQILKNLRYPFLESINKSQISAVGGSNWHKFLGMLHWMVRTNIKLDMCLNKVDRSLINQNTQEITILSQPLKTLDEQDQRQERYELMVEKLLIDYFTESYKSFLKLEDNYEPSMQELKLGFEKFVHIINTDIANLQTQNDNLYEKYQEVMKISQKIKTTREKWKALKSDSNKYENYVNAMKQKSQEWPGKLEKMKSECELKEEEIKALQSNISELHKILRKKGISTEQFELQNQEREKLTRELDKINIQSDKLTSSIKSRKLEAEGIFKSLLDTLRQYDSSIQNLTRSRSQLGHNVNDSSLKINISENLLDRDFHEGISYEQLFPKGSGINESIKKSILKLNDEIQERIKTIEKDNITLEKDIKNLKHDINEKTQINEKLELELSEANSKFELSKQENERLLVAQRIEIEKMEKKINDSNLLMKTKISDAEELVTSTELKLEELKVDLNRKRYKLHQQVIHVIDITSKFKINIQSSLENSENELGNVIEELRNLEFETEHNVTN", "length": 691 }, "evidence": [ { "id": "O14777", "url": "https://omabrowser.org/oma/group/O14777/", "database": "OMA" } ], "common_name": "Yeast" }, { "uniprot_canonical_ac": "Q9D0F1-1", "protein_name": "Kinetochore protein NDC80 homolog", "gene_name": "Ndc80", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MKRSSVSTCGAGRLSMQELRTLDLNKPGLYTPQTKERSTFGKLSTHKPTSERKVSIFGKRTSGHGSRNSQLGIFSSSEKIKDPRPLNDKAFIQQCIRQLYEFLTENGYVYSVSMKSLQAPSTKEFLKIFAFLYGFLCPSYELPGTKCEEEVPRIFKALGYPFTLSKSSMYTVGAPHTWPHIVAALVWLIDCIKIDTAMKESSPLFDDGQLWGEETEDGIKHNKLFLEYTKKCYEKFMTGADSFEEEDAELQAKLKDLYKVDASKLESLEAENKALNEQIARLEEEREREPNRLMSLKKLKASLQADVQNYKAYMSNLESHLAVLKQKSNSLDEEIGRVEQECETVKQENTRLQSIVDNQKYSVADIERINHEKNELQQTINKLTKDLEAEQQQMWNEELKYARGKEAIEAQLAEYHKLARKLKLIPKGAENSKGYDFEIKFNPEAGANCLVKYRTQVYAPLKELLNESEEEINKALNKKRHLEDTLEQLNTMKTESKNTVRMLKEEIQKLDDLHQQAVKEAEEKDKKSASELESLEKHKHLLESGVNDGLSEAMDELDAVQREYQLTVKTTTEERRKVENNLQRLLEMVATHVGSLEKHLEEENAKADREYEEFMSEDLLENIREMAEKYKRNAAQLKAPDK", "length": 642 }, "evidence": [ { "id": "45918941", "url": "http://www.informatics.jax.org/homology/45918941", "database": "MGI" }, { "id": "O14777", "url": "https://omabrowser.org/oma/group/O14777/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 17, "go_terms": [ { "name": "attachment of mitotic spindle microtubules to kinetochore", "id": "GO:0051315", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051315", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" } ], "pmid": "" }, { "name": "cell division", "id": "GO:0051301", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051301", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" } ], "pmid": "" }, { "name": "metaphase chromosome alignment", "id": "GO:0051310", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051310", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" } ], "pmid": "" }, { "name": "kinetochore organization", "id": "GO:0051383", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051383", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" } ], "pmid": "" }, { "name": "mitotic cell cycle", "id": "GO:0000278", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000278", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" } ], "pmid": "" }, { "name": "chromosome segregation", "id": "GO:0007059", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007059", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" } ], "pmid": "" }, { "name": "attachment of spindle microtubules to kinetochore", "id": "GO:0008608", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008608", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" } ], "pmid": "" }, { "name": "regulation of protein stability", "id": "GO:0031647", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031647", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" } ], "pmid": "" }, { "name": "mitotic spindle assembly checkpoint signaling", "id": "GO:0007094", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007094", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" } ], "pmid": "" }, { "name": "establishment of mitotic spindle orientation", "id": "GO:0000132", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000132", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" } ], "pmid": "" }, { "name": "centrosome duplication", "id": "GO:0051298", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051298", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" } ], "pmid": "" }, { "name": "mitotic spindle organization", "id": "GO:0007052", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007052", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" } ], "pmid": "" }, { "name": "spindle assembly involved in female meiosis I", "id": "GO:0007057", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007057", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" } ], "pmid": "" }, { "name": "mitotic sister chromatid segregation", "id": "GO:0000070", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000070", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" } ], "pmid": "" }, { "name": "positive regulation of mitotic cell cycle spindle assembly checkpoint", "id": "GO:0090267", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0090267", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" } ], "pmid": "" }, { "name": "skeletal muscle satellite cell proliferation", "id": "GO:0014841", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0014841", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" } ], "pmid": "" }, { "name": "G2/MI transition of meiotic cell cycle", "id": "GO:0008315", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008315", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 9, "go_terms": [ { "name": "Ndc80 complex", "id": "GO:0031262", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031262", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" } ], "pmid": "" }, { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" } ], "pmid": "" }, { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" } ], "pmid": "" }, { "name": "centrosome", "id": "GO:0005813", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005813", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" } ], "pmid": "" }, { "name": "chromosome, centromeric region", "id": "GO:0000775", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000775", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" } ], "pmid": "" }, { "name": "kinetochore", "id": "GO:0000776", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000776", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" } ], "pmid": "" }, { "name": "outer kinetochore", "id": "GO:0000940", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000940", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "microtubule binding", "id": "GO:0008017", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008017", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" } ], "pmid": "" }, { "name": "identical protein binding", "id": "GO:0042802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042802", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" } ], "pmid": "" }, { "name": "cyclin binding", "id": "GO:0030332", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030332", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" } ], "pmid": "" }, { "name": "kinetochore adaptor activity", "id": "GO:0140483", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140483", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 111, "end_pos": 113, "annotation": "n_glycosylation_sequon" }, { "start_pos": 466, "end_pos": 468, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "Acetylated at Lys-53 and Lys-59 by KAT5 during mitosis, promoting robust kinetochore-microtubule attachment (PubMed:30409912). Deacetylated by SIRT1 (PubMed:30409912).", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" }, { "database": "PubMed", "id": "30409912", "url": "https://glygen.org/publication/PubMed/30409912" } ] }, { "annotation": "Phosphorylation begins in S phase of the cell cycle and peaks in mitosis. Phosphorylated by NEK2. Also phosphorylated by AURKA and AURKB.", "evidence": [ { "database": "UniProtKB", "id": "O14777", "url": "https://www.uniprot.org/uniprot/O14777" }, { "database": "PubMed", "id": "12386167", "url": "https://glygen.org/publication/PubMed/12386167" }, { "database": "PubMed", "id": "14602875", "url": "https://glygen.org/publication/PubMed/14602875" }, { "database": "PubMed", "id": "30409912", "url": "https://glygen.org/publication/PubMed/30409912" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [ 5, 15, 31, 34, 44, 50, 55, 62, 66, 69, 76, 77, 165, 242, 572, 635 ], "sequon_annotation_sites": [ { "start_pos": 111, "end_pos": 113 }, { "start_pos": 466, "end_pos": 468 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 18 }, { "field": "total_sites", "count": 16 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 126 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }