{ "uniprot_canonical_ac": "O14662-1", "uniprot_ac": "O14662", "uniprot_id": "STX16_HUMAN", "mass": { "chemical_mass": 37031.0, "monoisotopic_mass": 37031.0 }, "refseq": { "ac": "NP_001001433", "name": "syntaxin-16 isoform a", "summary": "This gene encodes a protein that is a member of the syntaxin or t-SNARE (target-SNAP receptor) family. These proteins are found on cell membranes and serve as the targets for V-SNARES (vesicle-SNAP receptors) permitting specific synaptic vesicle docking and fusion. A microdeletion in the region of chromosome 20 where this gene is located has been associated with pseudohypoparathyroidism type Ib. Multiple transcript variants have been found for this gene. Read-through transcription also exists between this gene and the neighboring downstream aminopeptidase-like 1 (NPEPL1) gene. [provided by RefSeq, Mar 2011].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001001433" }, "gene_names": [ { "name": "STX16", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O14662", "id": "O14662" }, { "name": "STX16", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001001433", "id": "NP_001001433" }, { "name": "SYN-16; SYN16", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001001433", "id": "NP_001001433" } ], "protein_names": [ { "name": "Syntaxin-16", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O14662" }, { "name": "Syn16", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O14662" }, { "name": "syntaxin-16 isoform a", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001001433", "id": "NP_001001433" } ], "function": [ { "annotation": "Analysis of defects in GNAS and STX16 genes in a Chinese family with pseudohypoparathyroidism.", "evidence": [ { "database": "RefSeq", "id": "NP_001001433", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001001433" }, { "database": "PubMed", "id": "33269569", "url": "https://glygen.org/publication/PubMed/33269569" } ] }, { "annotation": "Intrafamilial phenotypic heterogeneity in siblings with pseudohypoparathyroidism 1B due to maternal STX16 deletion. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001001433", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001001433" }, { "database": "PubMed", "id": "38095637", "url": "https://glygen.org/publication/PubMed/38095637" } ] }, { "annotation": "Progression of PTH Resistance in Autosomal Dominant Pseudohypoparathyroidism Type Ib Due to Maternal STX16 Deletions.", "evidence": [ { "database": "RefSeq", "id": "NP_001001433", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001001433" }, { "database": "PubMed", "id": "34477200", "url": "https://glygen.org/publication/PubMed/34477200" } ] }, { "annotation": "SNARE involved in vesicular transport from the late endosomes to the trans-Golgi network.", "evidence": [ { "database": "UniProtKB", "id": "O14662", "url": "https://www.uniprot.org/uniprot/O14662#function" }, { "database": "PubMed", "id": "18195106", "url": "https://glygen.org/publication/PubMed/18195106" } ] }, { "annotation": "Syntaxin 16 may thus play a role in neurite outgrowth and perhaps other specific dendritic anterograde/retrograde traffic.", "evidence": [ { "database": "RefSeq", "id": "NP_001001433", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001001433" }, { "database": "PubMed", "id": "17852734", "url": "https://glygen.org/publication/PubMed/17852734" } ] }, { "annotation": "This gene encodes a protein that is a member of the syntaxin or t-SNARE (target-SNAP receptor) family. These proteins are found on cell membranes and serve as the targets for V-SNARES (vesicle-SNAP receptors) permitting specific synaptic vesicle docking and fusion. A microdeletion in the region of chromosome 20 where this gene is located has been associated with pseudohypoparathyroidism type Ib. Multiple transcript variants have been found for this gene. Read-through transcription also exists between this gene and the neighboring downstream aminopeptidase-like 1 (NPEPL1) gene. [provided by RefSeq, Mar 2011].", "evidence": [ { "database": "RefSeq", "id": "NP_001001433", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001001433" } ] } ], "disease": [ { "disease_id": "DOID:0080222", "recommended_name": { "id": "DOID:0080222", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0080222", "name": "pseudohypoparathyroidism type IB", "description": "A pseudohypoparathyroidism characterized by isolated renal parathyroid hormone (PTH) resistance resulting in hypocalcemia, hyperphosphatemia and elevated PTH levels that has_material_basis_in mutations that alter the methylation pattern of GNAS on 20q13.32." }, "synonyms": [ { "id": "MONDO:0011301", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011301", "name": "pseudohypoparathyroidism type 1B", "description": "Pseudohypoparathyroidism type 1B (PHP-1b) is a type of pseudohypoparathyroidism (PHP) characterized by localized resistance to parathyroid hormone (PTH) mainly in the renal tissues which manifests with hypocalcemia, hyperphosphatemia and elevated PTH levels. About 60-70% of patients also present with elevated TSH levels due to TSH resistance." }, { "id": "MONDO:0011301", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011301", "name": "pseudohypoparathyroidism Ib", "description": "" }, { "id": "MONDO:0011301", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011301", "name": "PHP1B", "description": "" }, { "id": "MONDO:0011301", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011301", "name": "Php 1B", "description": "" }, { "id": "MONDO:0011301", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011301", "name": "pseudohypoparathyroidism type IB", "description": "" }, { "id": "MONDO:0011301", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011301", "name": "pseudohypoparathyroidism, type 1B", "description": "" }, { "id": "MONDO:0011301", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011301", "name": "pseudohypoparathyroidism, type IB", "description": "" }, { "id": "MIM:603233", "resource": "MIM", "url": "https://www.omim.org/entry/603233", "name": "Pseudohypoparathyroidism 1B", "description": "Pseudohypoparathyroidism 1B" } ], "evidence": [ { "id": "603233", "database": "MIM", "url": "https://www.omim.org/entry/603233" } ] } ], "snv": [], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "89.58", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000124222", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000124222" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "89.28", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000124222", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000124222" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "88.82", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000124222", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000124222" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "89.11", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000124222", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000124222" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "94.65", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000124222", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000124222" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "94.43", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000124222", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000124222" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "85.23", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000124222", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000124222" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "93.78", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000124222", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000124222" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "94.82", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000124222", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000124222" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "87.87", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000124222", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000124222" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "91.1", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000124222", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000124222" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "96.01", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000124222", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000124222" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "95.83", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000124222", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000124222" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O14662", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14662" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O14662", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14662" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O14662", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14662" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O14662", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14662" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O14662", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14662" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O14662", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14662" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O14662", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14662" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O14662", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14662" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O14662", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14662" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O14662", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14662" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O14662", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14662" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O14662", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14662" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O14662", "url": "https://www.uniprot.org/uniprot/O14662" } ], "common_name": "Human" } ], "gene": [ { "name": "STX16", "url": "https://www.uniprot.org/uniprot/O14662", "locus": { "chromosome": "20", "start_pos": 58679526, "end_pos": 58651272, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000124222", "url": "https://www.ensembl.org/id/ENSG00000124222" } ] } } ], "crossref": [ { "id": "ENSG00000124222", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000124222", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd15845", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd15845", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "STX16", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=STX16", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "8675", "url": "https://www.ncbi.nlm.nih.gov/gene/8675", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "11431", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=11431", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O14662", "url": "https://www.ebi.ac.uk/intact/interactors/id:O14662*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000727", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000727", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006011", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006011", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006012", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006012", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR010989", "url": "https://www.ebi.ac.uk/interpro/entry/IPR010989", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR045242", "url": "https://www.ebi.ac.uk/interpro/entry/IPR045242", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:8675", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:8675", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "603233", "url": "http://www.omim.org/entry/603233", "database": "MIM", "categories": [ "Other" ] }, { "id": "603666", "url": "http://www.omim.org/entry/603666", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O14662", "url": "https://www.nextprot.org/entry/NX_O14662", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "O14662", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14662", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "RKMCIIL", "url": "https://omabrowser.org/oma/group/RKMCIIL/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "2876074at2759", "url": "http://www.orthodb.org/?query=2876074at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR19957", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR19957", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR19957:SF83", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR19957:SF83", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00804", "url": "http://pfam.xfam.org/family/PF00804", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF05739", "url": "http://pfam.xfam.org/family/PF05739", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O14662", "url": "https://pharos.nih.gov/targets/O14662", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O14662", "url": "http://purl.obolibrary.org/obo/PR_O14662", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001001433", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001001433", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "B7ZBM4", "url": "https://www.uniprot.org/uniprot/B7ZBM4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B7ZBM4-1", "url": "https://www.uniprot.org/uniprot/B7ZBM4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B7ZBM5", "url": "https://www.uniprot.org/uniprot/B7ZBM5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B7ZBM5-1", "url": "https://www.uniprot.org/uniprot/B7ZBM5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B7ZBM8", "url": "https://www.uniprot.org/uniprot/B7ZBM8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "B7ZBM8-1", "url": "https://www.uniprot.org/uniprot/B7ZBM8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PLV7", "url": "https://www.uniprot.org/uniprot/E9PLV7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PLV7-1", "url": "https://www.uniprot.org/uniprot/E9PLV7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PND6", "url": "https://www.uniprot.org/uniprot/E9PND6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PND6-1", "url": "https://www.uniprot.org/uniprot/E9PND6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8W9Z6", "url": "https://www.uniprot.org/uniprot/F8W9Z6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "F8W9Z6-1", "url": "https://www.uniprot.org/uniprot/F8W9Z6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YEW0", "url": "https://www.uniprot.org/uniprot/H0YEW0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H0YEW0-1", "url": "https://www.uniprot.org/uniprot/H0YEW0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O14662", "url": "https://www.uniprot.org/uniprot/O14662", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O14662-1", "url": "https://www.uniprot.org/uniprot/O14662-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O14662-2", "url": "https://www.uniprot.org/uniprot/O14662-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O14662-3", "url": "https://www.uniprot.org/uniprot/O14662-3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O14662-4", "url": "https://www.uniprot.org/uniprot/O14662-4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O14662-5", "url": "https://www.uniprot.org/uniprot/O14662-5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O14662-6", "url": "https://www.uniprot.org/uniprot/O14662-6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q96NX8", "url": "https://www.uniprot.org/uniprot/Q96NX8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "Q96NX8-1", "url": "https://www.uniprot.org/uniprot/Q96NX8-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MATRRLTDAFLLLRNNSIQNRQLLAEQVSSHITSSPLHSRSIAAELDELADDRMALVSGISLDPEAAIGVTKRPPPKWVDGVDEIQYDVGRIKQKMKELASLHDKHLNRPTLDDSSEEEHAIEITTQEITQLFHRCQRAVQALPSRARACSEQEGRLLGNVVASLAQALQELSTSFRHAQSGYLKRMKNREERSQHFFDTSVPLMDDGDDNTLYHRGFTEDQLVLVEQNTLMVEEREREIRQIVQSISDLNEIFRDLGAMIVEQGTVLDRIDYNVEQSCIKTEDGLKQLHKAEQYQKKNRKMLVILILFVIIIVLIVVLVGVKSR", "length": 325, "header": "sp|O14662-1|STX16_HUMAN Isoform 1 of Syntaxin-16 OS=Homo sapiens OX=9606 GN=STX16 PE=1 SV=3 CANONICAL=O14662-1" }, "isoforms": [ { "isoform_ac": "B7ZBM4-1", "url": "", "sequence": { "sequence": "MALVSGISLDPEAAIGVTKRPPPKWVDGVDEIQYDVGRIKQKMKELASLHDKHLNRPTLDDSSEEEHAIEITTQEITQLFHRCQRAVQALPSRARACSEQEGRLLGNVVASLAQALQELS", "length": 120, "header": "tr|B7ZBM4-1|B7ZBM4_HUMAN Computationally mapped isoform of Syntaxin 16 OS=Homo sapiens OX=9606 GN=STX16 PE=1 SV=8 CANONICAL=O14662-1" }, "locus": { "chromosome": "20", "start_pos": 58669416, "end_pos": 58667505, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000412911.5", "url": "https://www.ensembl.org/id/ENST00000412911.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000416852.1", "url": "https://www.ensembl.org/id/ENSP00000416852.1" } ] } }, { "isoform_ac": "B7ZBM5-1", "url": "", "sequence": { "sequence": "MALVSGISLDPEAAIGVTKRPPPKWVDGVDEIQYDVGRIKQKMKELASLHDKHLNRPTLDDSSEEEHAIEITTQEITQLFHRCQRAVQALPSRARACSEQEGRLLGNVVASLAQALQELSTS", "length": 122, "header": "tr|B7ZBM5-1|STX16_HUMAN Computationally mapped isoform of Syntaxin-16 OS=Homo sapiens OX=9606 GN=STX16 PE=1 SV=1 CANONICAL=O14662-1" }, "locus": { "chromosome": "20", "start_pos": 58669422, "end_pos": 58667505, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000458280.5", "url": "https://www.ensembl.org/id/ENST00000458280.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000388348.1", "url": "https://www.ensembl.org/id/ENSP00000388348.1" } ] } }, { "isoform_ac": "B7ZBM8-1", "url": "", "sequence": { "sequence": "GISLDPEAAIGVTKRPPPKWVDGVDEIQYDVGRIKQKMKELASLHDKHLNRPTLDDSSEEEHAIEITTQEITQLFHRCQRAVQALPSRARACSEQEGRLLGNVVASLAQALQELSTSFRHAQSGYLKRMKNREERSQHFFDTSVPLMDDGDDNTLYHRGTVLDRIDYNVEQSCIKTEDGLKQLHKAEQYQKKNRKMLVILILFVIIIVLIVVLVGVKSR", "length": 219, "header": "tr|B7ZBM8-1|B7ZBM8_HUMAN Computationally mapped isoform of Syntaxin 16 OS=Homo sapiens OX=9606 GN=STX16 PE=1 SV=1 CANONICAL=O14662-1" }, "locus": { "chromosome": "20", "start_pos": 58676288, "end_pos": 58667520, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000438253.1", "url": "https://www.ensembl.org/id/ENST00000438253.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000401801.1", "url": "https://www.ensembl.org/id/ENSP00000401801.1" } ] } }, { "isoform_ac": "E9PLV7-1", "url": "", "sequence": { "sequence": "MALVSGISLDPEAAIGVTKRPPPKWVDGVDEVSSIFSMMLAGLSRR", "length": 46, "header": "tr|E9PLV7-1|STX16_HUMAN Computationally mapped isoform of Syntaxin-16 OS=Homo sapiens OX=9606 GN=STX16 PE=1 SV=1 CANONICAL=O14662-1" }, "locus": { "chromosome": "20", "start_pos": 58668020, "end_pos": 58667505, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000460655.5", "url": "https://www.ensembl.org/id/ENST00000460655.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000435118.1", "url": "https://www.ensembl.org/id/ENSP00000435118.1" } ] } }, { "isoform_ac": "E9PND6-1", "url": "", "sequence": { "sequence": "MALVSGISLDPEAAIGVTKRPPPKWVDGVDEIQYDVGRIKQKMKELASLHDKHLNRPTLDDSSEEEHAIEITTQEITQA", "length": 79, "header": "tr|E9PND6-1|STX16_HUMAN Computationally mapped isoform of Syntaxin-16 OS=Homo sapiens OX=9606 GN=STX16 PE=1 SV=1 CANONICAL=O14662-1" }, "locus": { "chromosome": "20", "start_pos": 58670514, "end_pos": 58667505, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000476384.5", "url": "https://www.ensembl.org/id/ENST00000476384.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000437209.1", "url": "https://www.ensembl.org/id/ENSP00000437209.1" } ] } }, { "isoform_ac": "F8W9Z6-1", "url": "", "sequence": { "sequence": "MALVSGISLDPEAAIGVTKRPPPKWVDGVDEIQYDVGRIKQKMKELASLHDKHLNRPTLDDSSEEEHAIEITTQEITQLFHRCQRAVQALPSRARACSEQEGRLLGNVVASLAQALQELSTSFRHAQSGYLKRMKNREERSQHFFDTSVPLMDDGDDNTLYHRGFTEDQLVLVEQNTLMVEEREREIRQIVQSISDLNEIFRDL", "length": 204, "header": "tr|F8W9Z6-1|F8W9Z6_HUMAN Computationally mapped isoform of Syntaxin 16 OS=Homo sapiens OX=9606 GN=STX16 PE=1 SV=1 CANONICAL=O14662-1" }, "locus": { "chromosome": "20", "start_pos": 58671276, "end_pos": 58667505, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000312283.12", "url": "https://www.ensembl.org/id/ENST00000312283.12" }, { "database": "Ensembl Peptide", "id": "ENSP00000312086.8", "url": "https://www.ensembl.org/id/ENSP00000312086.8" } ] } }, { "isoform_ac": "H0YEW0-1", "url": "", "sequence": { "sequence": "XDAFLLLRNNSIQNRQLLAEQVSSHITSSPLHSRSIAAELDELADDRMALVSGISLDPEAAIGVTKRPPPKWVDGVDEIQYDVGRIKQKMKELASLHDKHLNRPTLDDSSEEEHAIEITTQEITQA", "length": 126, "header": "tr|H0YEW0-1|STX16_HUMAN Computationally mapped isoform of Syntaxin-16 OS=Homo sapiens OX=9606 GN=STX16 PE=1 SV=1 CANONICAL=O14662-1" }, "locus": { "chromosome": "20", "start_pos": 58670515, "end_pos": 58652026, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000493301.5", "url": "https://www.ensembl.org/id/ENST00000493301.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000436667.1", "url": "https://www.ensembl.org/id/ENSP00000436667.1" } ] } }, { "isoform_ac": "O14662-1", "url": "", "sequence": { "sequence": "MATRRLTDAFLLLRNNSIQNRQLLAEQVSSHITSSPLHSRSIAAELDELADDRMALVSGISLDPEAAIGVTKRPPPKWVDGVDEIQYDVGRIKQKMKELASLHDKHLNRPTLDDSSEEEHAIEITTQEITQLFHRCQRAVQALPSRARACSEQEGRLLGNVVASLAQALQELSTSFRHAQSGYLKRMKNREERSQHFFDTSVPLMDDGDDNTLYHRGFTEDQLVLVEQNTLMVEEREREIRQIVQSISDLNEIFRDLGAMIVEQGTVLDRIDYNVEQSCIKTEDGLKQLHKAEQYQKKNRKMLVILILFVIIIVLIVVLVGVKSR", "length": 325, "header": "sp|O14662-1|STX16_HUMAN Isoform 1 of Syntaxin-16 OS=Homo sapiens OX=9606 GN=STX16 PE=1 SV=3 CANONICAL=O14662-1" }, "locus": { "chromosome": "20", "start_pos": 58676288, "end_pos": 58652007, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000371141.8", "url": "https://www.ensembl.org/id/ENST00000371141.8" }, { "database": "Ensembl Peptide", "id": "ENSP00000360183.4", "url": "https://www.ensembl.org/id/ENSP00000360183.4" } ] } }, { "isoform_ac": "O14662-2", "url": "", "sequence": { "sequence": "MATRRLTDAFLLLRNNSIQNRQLLAEQLADDRMALVSGISLDPEAAIGVTKRPPPKWVDGVDEIQYDVGRIKQKMKELASLHDKHLNRPTLDDSSEEEHAIEITTQEITQLFHRCQRAVQALPSRARACSEQEGRLLGNVVASLAQALQELSTSFRHAQSGYLKRMKNREERSQHFFDTSVPLMDDGDDNTLYHRGFTEDQLVLVEQNTLMVEEREREIRQIVQSISDLNEIFRDLGAMIVEQGTVLDRIDYNVEQSCIKTEDGLKQLHKAEQYQKKNRKMLVILILFVIIIVLIVVLVGVKSR", "length": 304, "header": "sp|O14662-2|STX16_HUMAN Isoform 2 of Syntaxin-16 OS=Homo sapiens OX=9606 GN=STX16 PE=1 SV=3 CANONICAL=O14662-1" }, "locus": { "chromosome": "20", "start_pos": 58676288, "end_pos": 58652007, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000371132.8", "url": "https://www.ensembl.org/id/ENST00000371132.8" }, { "database": "Ensembl Peptide", "id": "ENSP00000360173.4", "url": "https://www.ensembl.org/id/ENSP00000360173.4" } ] } }, { "isoform_ac": "O14662-3", "url": "", "sequence": { "sequence": "MATRRLTDAFLLLRNNSIQNRQLLAEQELDELADDRMALVSGISLDPEAAIGVTKRPPPKWVDGVDEIQYDVGRIKQKMKELASLHDKHLNRPTLDDSSEEEHAIEITTQEITQA", "length": 115, "header": "sp|O14662-3|STX16_HUMAN Isoform 3 of Syntaxin-16 OS=Homo sapiens OX=9606 GN=STX16 PE=1 SV=3 CANONICAL=O14662-1" }, "locus": { "chromosome": "20", "start_pos": 58670514, "end_pos": 58652007, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000467096.5", "url": "https://www.ensembl.org/id/ENST00000467096.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000434369.1", "url": "https://www.ensembl.org/id/ENSP00000434369.1" } ] } }, { "isoform_ac": "O14662-4", "url": "", "sequence": { "sequence": "MATRRLTDAFLLLRNNSIQNRQLLAEQELDELADDRMALVSGISLDPEAAIGVTKRPPPKWVDGVDEIQYDVGRIKQKMKELASLHDKHLNRPTLDDSSEEEHAIEITTQEITQLFHRCQRAVQALPSRARACSEQEGRLLGNVVASLAQALQELSTSFRHAQSGYLKRMKNREERSQHFFDTSVPLMDDGDDNTLYHRGFTEDQLVLVEQNTLMVEEREREIRQIVQSISDLNEIFRDLGAMIVEQGTVLDRIDYNVEQSCIKTEDGLKQLHKAEQYQKKNRKMLVILILFVIIIVLIVVLVGVKSR", "length": 308, "header": "sp|O14662-4|STX16_HUMAN Isoform 4 of Syntaxin-16 OS=Homo sapiens OX=9606 GN=STX16 PE=1 SV=3 CANONICAL=O14662-1" }, "locus": { "chromosome": "20", "start_pos": 58676288, "end_pos": 58652007, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000355957.9", "url": "https://www.ensembl.org/id/ENST00000355957.9" }, { "database": "Ensembl Peptide", "id": "ENSP00000348229.5", "url": "https://www.ensembl.org/id/ENSP00000348229.5" } ] } }, { "isoform_ac": "O14662-5", "url": "", "sequence": { "sequence": "MATRRLTDAFLLLRNNSIQNRQLLAEQVSSHITSSPLHSRSIAALADDRMALVSGISLDPEAAIGVTKRPPPKWVDGVDEIQYDVGRIKQKMKELASLHDKHLNRPTLDDSSEEEHAIEITTQEITQLFHRCQRAVQALPSRARACSEQEGRLLGNVVASLAQALQELSTSFRHAQSGYLKRMKNREERSQHFFDTSVPLMDDGDDNTLYHRGFTEDQLVLVEQNTLMVEEREREIRQIVQSISDLNEIFRDLGAMIVEQGTVLDRIDYNVEQSCIKTEDGLKQLHKAEQYQKKNRKMLVILILFVIIIVLIVVLVGVKSR", "length": 321, "header": "sp|O14662-5|STX16_HUMAN Isoform 5 of Syntaxin-16 OS=Homo sapiens OX=9606 GN=STX16 PE=1 SV=3 CANONICAL=O14662-1" }, "locus": { "chromosome": "20", "start_pos": 58676288, "end_pos": 58652007, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000358029.8", "url": "https://www.ensembl.org/id/ENST00000358029.8" }, { "database": "Ensembl Peptide", "id": "ENSP00000350723.4", "url": "https://www.ensembl.org/id/ENSP00000350723.4" } ] } }, { "isoform_ac": "O14662-6", "url": "", "sequence": { "sequence": "MALVSGISLDPEAAIGVTKRPPPKWVDGVDEIQYDVGRIKQKMKELASLHDKHLNRPTLDDSSEEEHAIEITTQEITQLFHRCQRAVQALPSRARACSEQEGRLLGNVVASLAQALQELSTSFRHAQSGYLKRMKNREERSQHFFDTSVPLMDDGDDNTLYHRGFTEDQLVLVEQNTLMVEEREREIRQIVQSISDLNEIFRDLGAMIVEQGTVLDRIDYNVEQSCIKTEDGLKQLHKAEQYQKKNRKMLVILILFVIIIVLIVVLVGVKSR", "length": 272, "header": "sp|O14662-6|STX16_HUMAN Isoform 6 of Syntaxin-16 OS=Homo sapiens OX=9606 GN=STX16 PE=1 SV=3 CANONICAL=O14662-1" }, "locus": { "chromosome": "20", "start_pos": 58676288, "end_pos": 58667505, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000359617.8", "url": "https://www.ensembl.org/id/ENST00000359617.8" }, { "database": "Ensembl Peptide", "id": "ENSP00000352634.4", "url": "https://www.ensembl.org/id/ENSP00000352634.4" } ] } }, { "isoform_ac": "Q96NX8-1", "url": "", "sequence": { "sequence": "MATRRLTDAFLLLRNNSIQNRQLLAEQELDELADDRMALVSGISLDPEAAIGVTKRPPPKWVDGVDEIQYDVGRIKQKMKELASLHDKHLNRPTLDDSSEEEHAIEITTQEITQLFHRCQRAVQALPSRARACSEQEGRLLGNVVASLAQALQELSTSFRHAQSGYLKRMKNREERSQHFFDTSVPLMDDGDDNTLYHRRTS", "length": 202, "header": "tr|Q96NX8-1|STX16_HUMAN Computationally mapped isoform of Syntaxin-16 OS=Homo sapiens OX=9606 GN=STX16 PE=1 SV=1 CANONICAL=O14662-1" }, "locus": { "chromosome": "20", "start_pos": 58671172, "end_pos": 58652007, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000464640.5", "url": "https://www.ensembl.org/id/ENST00000464640.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000432414.1", "url": "https://www.ensembl.org/id/ENSP00000432414.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "O14662", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14662" }, { "id": "35132862", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/35132862" } ] } ], "phosphorylation": [ { "start_pos": 34, "end_pos": 34, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O14662", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14662" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser34" }, { "start_pos": 35, "end_pos": 35, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O14662", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14662" }, { "database": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ], "site_lbl": "Ser35" }, { "start_pos": 41, "end_pos": 41, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O14662", "url": "https://www.uniprot.org/uniprot/O14662" }, { "database": "iPTMnet", "id": "O14662", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14662" }, { "database": "PubMed", "id": "18578522", "url": "https://glygen.org/publication/PubMed/18578522" }, { "database": "PubMed", "id": "20166139", "url": "https://glygen.org/publication/PubMed/20166139" } ], "site_lbl": "Ser41" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "GMAP-210, A cis-Golgi network-associated protein, is a minus end microtubule-binding protein.", "journal": "The Journal of cell biology", "date": "1999", "authors": "Infante C, Ramos-Morales F, Fedriani C, Bornens M, Rios RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "10189370", "url": "https://glygen.org/publication/PubMed/10189370" } ] }, { "title": "A novel Rab6-interacting domain defines a family of Golgi-targeted coiled-coil proteins.", "journal": "Current biology : CB", "date": "1999", "authors": "Barr FA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "10209123", "url": "https://glygen.org/publication/PubMed/10209123" } ] }, { "title": "NSF N-terminal domain crystal structure: models of NSF function.", "journal": "Molecular cell", "date": "1999", "authors": "Yu RC, Jahn R, Brunger AT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "10445031", "url": "https://glygen.org/publication/PubMed/10445031" } ] }, { "title": "An NSF function distinct from ATPase-dependent SNARE disassembly is essential for Golgi membrane fusion.", "journal": "Nature cell biology", "date": "1999", "authors": "Muller JM, Rabouille C, Newman R, Shorter J, Freemont P, Schiavo G, Warren G, Shima DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "10559959", "url": "https://glygen.org/publication/PubMed/10559959" } ] }, { "title": "Vps52p, Vps53p, and Vps54p form a novel multisubunit complex required for protein sorting at the yeast late Golgi.", "journal": "Molecular biology of the cell", "date": "2000", "authors": "Conibear E, Stevens TH", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "10637310", "url": "https://glygen.org/publication/PubMed/10637310" } ] }, { "title": "Similarities in function and gene structure of cytohesin-4 and cytohesin-1, guanine nucleotide-exchange proteins for ADP-ribosylation factors.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Ogasawara M, Kim SC, Adamik R, Togawa A, Ferrans VJ, Takeda K, Kirby M, Moss J, Vaughan M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "10652308", "url": "https://glygen.org/publication/PubMed/10652308" } ] }, { "title": "Turning on ARF: the Sec7 family of guanine-nucleotide-exchange factors.", "journal": "Trends in cell biology", "date": "2000", "authors": "Jackson CL, Casanova JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "10652516", "url": "https://glygen.org/publication/PubMed/10652516" } ] }, { "title": "Multiple aspects of Rab protein action in the secretory pathway: focus on Rab3 and Rab6.", "journal": "Biochimie", "date": "2000", "authors": "Darchen F, Goud B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "10865125", "url": "https://glygen.org/publication/PubMed/10865125" } ] }, { "title": "Ric1p and Rgp1p form a complex that catalyses nucleotide exchange on Ypt6p.", "journal": "The EMBO journal", "date": "2000", "authors": "Siniossoglou S, Peak-Chew SY, Pelham HR", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "10990452", "url": "https://glygen.org/publication/PubMed/10990452" } ] }, { "title": "ADP-ribosylation factors (ARFs) and ARF-like 1 (ARL1) have both specific and shared effectors: characterizing ARL1-binding proteins.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Van Valkenburgh H, Shern JF, Sharer JD, Zhu X, Kahn RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "11303027", "url": "https://glygen.org/publication/PubMed/11303027" } ] }, { "title": "The structural basis of Arfaptin-mediated cross-talk between Rac and Arf signalling pathways.", "journal": "Nature", "date": "2001", "authors": "Tarricone C, Xiao B, Justin N, Walker PA, Rittinger K, Gamblin SJ, Smerdon SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "11346801", "url": "https://glygen.org/publication/PubMed/11346801" } ] }, { "title": "Role of Rab9 GTPase in facilitating receptor recruitment by TIP47.", "journal": "Science (New York, N.Y.)", "date": "2001", "authors": "Carroll KS, Hanna J, Simon I, Krise J, Barbero P, Pfeffer SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "11359012", "url": "https://glygen.org/publication/PubMed/11359012" } ] }, { "title": "An effector of Ypt6p binds the SNARE Tlg1p and mediates selective fusion of vesicles with late Golgi membranes.", "journal": "The EMBO journal", "date": "2001", "authors": "Siniossoglou S, Pelham HR", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "11689439", "url": "https://glygen.org/publication/PubMed/11689439" } ] }, { "title": "Identification of rabaptin-5, rabex-5, and GM130 as putative effectors of rab33b, a regulator of retrograde traffic between the Golgi apparatus and ER.", "journal": "FEBS letters", "date": "2001", "authors": "Valsdottir R, Hashimoto H, Ashman K, Koda T, Storrie B, Nilsson T", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "11718716", "url": "https://glygen.org/publication/PubMed/11718716" } ] }, { "title": "Sorting of Golgi resident proteins into different subpopulations of COPI vesicles: a role for ArfGAP1.", "journal": "The Journal of cell biology", "date": "2001", "authors": "Lanoix J, Ouwendijk J, Stark A, Szafer E, Cassel D, Dejgaard K, Weiss M, Nilsson T", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "11748249", "url": "https://glygen.org/publication/PubMed/11748249" } ] }, { "title": "Visualization of Rab9-mediated vesicle transport from endosomes to the trans-Golgi in living cells.", "journal": "The Journal of cell biology", "date": "2002", "authors": "Barbero P, Bittova L, Pfeffer SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "11827983", "url": "https://glygen.org/publication/PubMed/11827983" } ] }, { "title": "Early/recycling endosomes-to-TGN transport involves two SNARE complexes and a Rab6 isoform.", "journal": "The Journal of cell biology", "date": "2002", "authors": "Mallard F, Tang BL, Galli T, Tenza D, Saint-Pol A, Yue X, Antony C, Hong W, Goud B, Johannes L", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "11839770", "url": "https://glygen.org/publication/PubMed/11839770" } ] }, { "title": "The Sec34/Sec35p complex, a Ypt1p effector required for retrograde intra-Golgi trafficking, interacts with Golgi SNAREs and COPI vesicle coat proteins.", "journal": "The Journal of cell biology", "date": "2002", "authors": "Suvorova ES, Duden R, Lupashin VV", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "12011112", "url": "https://glygen.org/publication/PubMed/12011112" } ] }, { "title": "Sequential SNARE disassembly and GATE-16-GOS-28 complex assembly mediated by distinct NSF activities drives Golgi membrane fusion.", "journal": "The Journal of cell biology", "date": "2002", "authors": "Muller JM, Shorter J, Newman R, Deinhardt K, Sagiv Y, Elazar Z, Warren G, Shima DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "12070132", "url": "https://glygen.org/publication/PubMed/12070132" } ] }, { "title": "Vps51p links the VFT complex to the SNARE Tlg1p.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Siniossoglou S, Pelham HR", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "12377769", "url": "https://glygen.org/publication/PubMed/12377769" } ] }, { "title": "The overexpression of GMAP-210 blocks anterograde and retrograde transport between the ER and the Golgi apparatus.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2002", "authors": "Pernet-Gallay K, Antony C, Johannes L, Bornens M, Goud B, Rios RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "12383348", "url": "https://glygen.org/publication/PubMed/12383348" } ] }, { "title": "CASP, the alternatively spliced product of the gene encoding the CCAAT-displacement protein transcription factor, is a Golgi membrane protein related to giantin.", "journal": "Molecular biology of the cell", "date": "2002", "authors": "Gillingham AK, Pfeifer AC, Munro S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "12429822", "url": "https://glygen.org/publication/PubMed/12429822" } ] }, { "title": "Golgi recruitment of GRIP domain proteins by Arf-like GTPase 1 is regulated by Arf-like GTPase 3.", "journal": "Current biology : CB", "date": "2003", "authors": "Setty SR, Shin ME, Yoshino A, Marks MS, Burd CG", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "12620188", "url": "https://glygen.org/publication/PubMed/12620188" } ] }, { "title": "The ARF-like GTPases Arl1p and Arl3p act in a pathway that interacts with vesicle-tethering factors at the Golgi apparatus.", "journal": "Current biology : CB", "date": "2003", "authors": "Panic B, Whyte JR, Munro S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "12620189", "url": "https://glygen.org/publication/PubMed/12620189" } ] }, { "title": "Autosomal dominant pseudohypoparathyroidism type Ib is associated with a heterozygous microdeletion that likely disrupts a putative imprinting control element of GNAS.", "journal": "J. Clin. Invest.", "date": "2003", "authors": "Bastepe Murat, Fr\u00f6hlich Leopold F, Hendy Geoffrey N, Indridason Olafur S, Josse Robert G, Koshiyama Hiroyuki, K\u00f6rkk\u00f6 Jarmo, Nakamoto Jon M, Rosenbloom Arlan L, Slyper Arnold H, Sugimoto Toshitsugu, Tsatsoulis Agathocles, Crawford John D, J\u00fcppner Harald", "evidence": [ { "database": "UniProtKB", "id": "O14662", "url": "https://www.uniprot.org/uniprot/O14662" } ], "reference": [ { "type": "PubMed", "id": "14561710", "url": "https://glygen.org/publication/PubMed/14561710" } ] }, { "title": "Structural basis for Arl1-dependent targeting of homodimeric GRIP domains to the Golgi apparatus.", "journal": "Molecular cell", "date": "2003", "authors": "Panic B, Perisic O, Veprintsev DB, Williams RL, Munro S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "14580338", "url": "https://glygen.org/publication/PubMed/14580338" } ] }, { "title": "Structural basis for recruitment of GRIP domain golgin-245 by small GTPase Arl1.", "journal": "Nature structural & molecular biology", "date": "2004", "authors": "Wu M, Lu L, Hong W, Song H", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "14718928", "url": "https://glygen.org/publication/PubMed/14718928" } ] }, { "title": "Implication of ZW10 in membrane trafficking between the endoplasmic reticulum and Golgi.", "journal": "The EMBO journal", "date": "2004", "authors": "Hirose H, Arasaki K, Dohmae N, Takio K, Hatsuzawa K, Nagahama M, Tani K, Yamamoto A, Tohyama M, Tagaya M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "15029241", "url": "https://glygen.org/publication/PubMed/15029241" } ] }, { "title": "Multiple binding proteins suggest diverse functions for the N-ethylmaleimide sensitive factor.", "journal": "Journal of structural biology", "date": "2004", "authors": "Whiteheart SW, Matveeva EA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "15037235", "url": "https://glygen.org/publication/PubMed/15037235" } ] }, { "title": "Targeting of the Arf-like GTPase Arl3p to the Golgi requires N-terminal acetylation and the membrane protein Sys1p.", "journal": "Nature cell biology", "date": "2004", "authors": "Behnia R, Panic B, Whyte JR, Munro S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "15077113", "url": "https://glygen.org/publication/PubMed/15077113" } ] }, { "title": "Golgi targeting of ARF-like GTPase Arl3p requires its Nalpha-acetylation and the integral membrane protein Sys1p.", "journal": "Nature cell biology", "date": "2004", "authors": "Setty SR, Strochlic TI, Tong AH, Boone C, Burd CG", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "15077114", "url": "https://glygen.org/publication/PubMed/15077114" } ] }, { "title": "TMF is a golgin that binds Rab6 and influences Golgi morphology.", "journal": "BMC cell biology", "date": "2004", "authors": "Fridmann-Sirkis Y, Siniossoglou S, Pelham HR", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "15128430", "url": "https://glygen.org/publication/PubMed/15128430" } ] }, { "title": "Autoantigen Golgin-97, an effector of Arl1 GTPase, participates in traffic from the endosome to the trans-golgi network.", "journal": "Molecular biology of the cell", "date": "2004", "authors": "Lu L, Tai G, Hong W", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "15269279", "url": "https://glygen.org/publication/PubMed/15269279" } ] }, { "title": "Regulation of microtubule-dependent recycling at the trans-Golgi network by Rab6A and Rab6A'.", "journal": "Molecular biology of the cell", "date": "2005", "authors": "Young J, Stauber T, del Nery E, Vernos I, Pepperkok R, Nilsson T", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "15483056", "url": "https://glygen.org/publication/PubMed/15483056" } ] }, { "title": "The GTPase Arf1p and the ER to Golgi cargo receptor Erv14p cooperate to recruit the golgin Rud3p to the cis-Golgi.", "journal": "The Journal of cell biology", "date": "2004", "authors": "Gillingham AK, Tong AH, Boone C, Munro S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "15504911", "url": "https://glygen.org/publication/PubMed/15504911" } ] }, { "title": "The trans-Golgi network GRIP-domain proteins form alpha-helical homodimers.", "journal": "The Biochemical journal", "date": "2005", "authors": "Luke MR, Houghton F, Perugini MA, Gleeson PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "15654769", "url": "https://glygen.org/publication/PubMed/15654769" } ] }, { "title": "Golgin tethers define subpopulations of COPI vesicles.", "journal": "Science (New York, N.Y.)", "date": "2005", "authors": "Malsam J, Satoh A, Pelletier L, Warren G", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "15718469", "url": "https://glygen.org/publication/PubMed/15718469" } ] }, { "title": "Cog3p depletion blocks vesicle-mediated Golgi retrograde trafficking in HeLa cells.", "journal": "The Journal of cell biology", "date": "2005", "authors": "Zolov SN, Lupashin VV", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "15728195", "url": "https://glygen.org/publication/PubMed/15728195" } ] }, { "title": "Cisternal rab proteins regulate Golgi apparatus redistribution in response to hypotonic stress.", "journal": "Molecular biology of the cell", "date": "2005", "authors": "Jiang S, Storrie B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "15758030", "url": "https://glygen.org/publication/PubMed/15758030" } ] }, { "title": "A novel STX16 deletion in autosomal dominant pseudohypoparathyroidism type Ib redefines the boundaries of a cis-acting imprinting control element of GNAS.", "journal": "Am. J. Hum. Genet.", "date": "2005", "authors": "Linglart Agn\u00e8s, Gensure Robert C, Olney Robert C, J\u00fcppner Harald, Bastepe Murat", "evidence": [ { "database": "UniProtKB", "id": "O14662", "url": "https://www.uniprot.org/uniprot/O14662" } ], "reference": [ { "type": "PubMed", "id": "15800843", "url": "https://glygen.org/publication/PubMed/15800843" } ] }, { "title": "tGolgin-1 (p230, golgin-245) modulates Shiga-toxin transport to the Golgi and Golgi motility towards the microtubule-organizing centre.", "journal": "Journal of cell science", "date": "2005", "authors": "Yoshino A, Setty SR, Poynton C, Whiteman EL, Saint-Pol A, Burd CG, Johannes L, Holzbaur EL, Koval M, McCaffery JM, Marks MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "15870108", "url": "https://glygen.org/publication/PubMed/15870108" } ] }, { "title": "Characterization of the human GARP (Golgi associated retrograde protein) complex.", "journal": "Experimental cell research", "date": "2005", "authors": "Liewen H, Meinhold-Heerlein I, Oliveira V, Schwarzenbacher R, Luo G, Wadle A, Jung M, Pfreundschuh M, Stenner-Liewen F", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "15878329", "url": "https://glygen.org/publication/PubMed/15878329" } ] }, { "title": "The Arf-like GTPase Arl1 and its role in membrane traffic.", "journal": "Biochemical Society transactions", "date": "2005", "authors": "Munro S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "16042553", "url": "https://glygen.org/publication/PubMed/16042553" } ] }, { "title": "Roles of ARFRP1 (ADP-ribosylation factor-related protein 1) in post-Golgi membrane trafficking.", "journal": "Journal of cell science", "date": "2005", "authors": "Shin HW, Kobayashi H, Kitamura M, Waguri S, Suganuma T, Uchiyama Y, Nakayama K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "16129887", "url": "https://glygen.org/publication/PubMed/16129887" } ] }, { "title": "RINT-1 regulates the localization and entry of ZW10 to the syntaxin 18 complex.", "journal": "Molecular biology of the cell", "date": "2006", "authors": "Arasaki K, Taniguchi M, Tani K, Tagaya M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "16571679", "url": "https://glygen.org/publication/PubMed/16571679" } ] }, { "title": "A functional role for the GCC185 golgin in mannose 6-phosphate receptor recycling.", "journal": "Molecular biology of the cell", "date": "2006", "authors": "Reddy JV, Burguete AS, Sridevi K, Ganley IG, Nottingham RM, Pfeffer SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "16885419", "url": "https://glygen.org/publication/PubMed/16885419" } ] }, { "title": "SNAREs--engines for membrane fusion.", "journal": "Nature reviews. Molecular cell biology", "date": "2006", "authors": "Jahn R, Scheller RH", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "16912714", "url": "https://glygen.org/publication/PubMed/16912714" } ] }, { "title": "Retrograde transport from endosomes to the trans-Golgi network.", "journal": "Nature reviews. Molecular cell biology", "date": "2006", "authors": "Bonifacino JS, Rojas R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "16936697", "url": "https://glygen.org/publication/PubMed/16936697" } ] }, { "title": "The interaction of two tethering factors, p115 and COG complex, is required for Golgi integrity.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2007", "authors": "Sohda M, Misumi Y, Yoshimura S, Nakamura N, Fusano T, Ogata S, Sakisaka S, Ikehara Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "17274799", "url": "https://glygen.org/publication/PubMed/17274799" } ] }, { "title": "Multiple and stepwise interactions between coatomer and ADP-ribosylation factor-1 (Arf1)-GTP.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2007", "authors": "Sun Z, Anderl F, Frohlich K, Zhao L, Hanke S, Brugger B, Wieland F, Bethune J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "17451557", "url": "https://glygen.org/publication/PubMed/17451557" } ] }, { "title": "The trans-Golgi network golgin, GCC185, is required for endosome-to-Golgi transport and maintenance of Golgi structure.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2007", "authors": "Derby MC, Lieu ZZ, Brown D, Stow JL, Goud B, Gleeson PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "17488291", "url": "https://glygen.org/publication/PubMed/17488291" } ] }, { "title": "Specific Rab GTPase-activating proteins define the Shiga toxin and epidermal growth factor uptake pathways.", "journal": "The Journal of cell biology", "date": "2007", "authors": "Fuchs E, Haas AK, Spooner RA, Yoshimura S, Lord JM, Barr FA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "17562788", "url": "https://glygen.org/publication/PubMed/17562788" } ] }, { "title": "Analysis of GTPase-activating proteins: Rab1 and Rab43 are key Rabs required to maintain a functional Golgi complex in human cells.", "journal": "Journal of cell science", "date": "2007", "authors": "Haas AK, Yoshimura S, Stephens DJ, Preisinger C, Fuchs E, Barr FA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "17684057", "url": "https://glygen.org/publication/PubMed/17684057" } ] }, { "title": "Functional involvement of TMF/ARA160 in Rab6-dependent retrograde membrane traffic.", "journal": "Experimental cell research", "date": "2007", "authors": "Yamane J, Kubo A, Nakayama K, Yuba-Kubo A, Katsuno T, Tsukita S, Tsukita S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "17698061", "url": "https://glygen.org/publication/PubMed/17698061" } ] }, { "title": "Syntaxin 16 is enriched in neuronal dendrites and may have a role in neurite outgrowth.", "journal": "Molecular membrane biology", "date": "2008", "authors": "Chua CE, Tang BL", "evidence": [ { "database": "RefSeq", "id": "NP_001001433", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001001433" } ], "reference": [ { "type": "PubMed", "id": "17852734", "url": "https://glygen.org/publication/PubMed/17852734" } ] }, { "title": "Interaction of the conserved oligomeric Golgi complex with t-SNARE Syntaxin5a/Sed5 enhances intra-Golgi SNARE complex stability.", "journal": "The Journal of cell biology", "date": "2007", "authors": "Shestakova A, Suvorova E, Pavliv O, Khaidakova G, Lupashin V", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "18086915", "url": "https://glygen.org/publication/PubMed/18086915" } ] }, { "title": "A syntaxin 10-SNARE complex distinguishes two distinct transport routes from endosomes to the trans-Golgi in human cells.", "journal": "The Journal of cell biology", "date": "2008", "authors": "Ganley IG, Espinosa E, Pfeffer SR", "evidence": [ { "database": "UniProtKB", "id": "O14662", "url": "https://www.uniprot.org/uniprot/O14662" }, { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "18195106", "url": "https://glygen.org/publication/PubMed/18195106" } ] }, { "title": "Rab and Arl GTPase family members cooperate in the localization of the golgin GCC185.", "journal": "Cell", "date": "2008", "authors": "Burguete AS, Fenn TD, Brunger AT, Pfeffer SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "18243103", "url": "https://glygen.org/publication/PubMed/18243103" } ] }, { "title": "Large scale screening for novel rab effectors reveals unexpected broad Rab binding specificity.", "journal": "Molecular & cellular proteomics : MCP", "date": "2008", "authors": "Fukuda M, Kanno E, Ishibashi K, Itoh T", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "18256213", "url": "https://glygen.org/publication/PubMed/18256213" } ] }, { "title": "Requirement of the human GARP complex for mannose 6-phosphate-receptor-dependent sorting of cathepsin D to lysosomes.", "journal": "Molecular biology of the cell", "date": "2008", "authors": "Perez-Victoria FJ, Mardones GA, Bonifacino JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "18367545", "url": "https://glygen.org/publication/PubMed/18367545" } ] }, { "title": "Asymmetric tethering of flat and curved lipid membranes by a golgin.", "journal": "Science (New York, N.Y.)", "date": "2008", "authors": "Drin G, Morello V, Casella JF, Gounon P, Antonny B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "18451304", "url": "https://glygen.org/publication/PubMed/18451304" } ] }, { "title": "TiO(2)-based phosphoproteomic analysis of the plasma membrane and the effects of phosphatase inhibitor treatment.", "journal": "Journal of proteome research", "date": "2008", "authors": "Thingholm TE, Larsen MR, Ingrell CR, Kassem M, Jensen ON", "evidence": [ { "database": "iPTMnet", "id": "O14662-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14662-1" } ], "reference": [ { "type": "PubMed", "id": "18578522", "url": "https://glygen.org/publication/PubMed/18578522" } ] }, { "title": "Rab18 and Rab43 have key roles in ER-Golgi trafficking.", "journal": "Journal of cell science", "date": "2008", "authors": "Dejgaard SY, Murshid A, Erman A, Kizilay O, Verbich D, Lodge R, Dejgaard K, Ly-Hartig TB, Pepperkok R, Simpson JC, Presley JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "18664496", "url": "https://glygen.org/publication/PubMed/18664496" } ] }, { "title": "Multiple Rab GTPase binding sites in GCC185 suggest a model for vesicle tethering at the trans-Golgi.", "journal": "Molecular biology of the cell", "date": "2009", "authors": "Hayes GL, Brown FC, Haas AK, Nottingham RM, Barr FA, Pfeffer SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "18946081", "url": "https://glygen.org/publication/PubMed/18946081" } ] }, { "title": "Membrane fusion: grappling with SNARE and SM proteins.", "journal": "Science (New York, N.Y.)", "date": "2009", "authors": "Sudhof TC, Rothman JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "19164740", "url": "https://glygen.org/publication/PubMed/19164740" } ] }, { "title": "RhoBTB3: a Rho GTPase-family ATPase required for endosome to Golgi transport.", "journal": "Cell", "date": "2009", "authors": "Espinosa EJ, Calero M, Sridevi K, Pfeffer SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "19490898", "url": "https://glygen.org/publication/PubMed/19490898" } ] }, { "title": "Direct interaction between the COG complex and the SM protein, Sly1, is required for Golgi SNARE pairing.", "journal": "The EMBO journal", "date": "2009", "authors": "Laufman O, Kedan A, Hong W, Lev S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "19536132", "url": "https://glygen.org/publication/PubMed/19536132" } ] }, { "title": "Dual roles of the mammalian GARP complex in tethering and SNARE complex assembly at the trans-golgi network.", "journal": "Molecular and cellular biology", "date": "2009", "authors": "Perez-Victoria FJ, Bonifacino JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "19620288", "url": "https://glygen.org/publication/PubMed/19620288" } ] }, { "title": "Golgi localisation of GMAP210 requires two distinct cis-membrane binding mechanisms.", "journal": "BMC biology", "date": "2009", "authors": "Cardenas J, Rivero S, Goud B, Bornens M, Rios RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "19715559", "url": "https://glygen.org/publication/PubMed/19715559" } ] }, { "title": "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.", "journal": "Science signaling", "date": "2010", "authors": "Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M", "evidence": [ { "database": "iPTMnet", "id": "O14662-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14662-1" } ], "reference": [ { "type": "PubMed", "id": "20068231", "url": "https://glygen.org/publication/PubMed/20068231" } ] }, { "title": "Rab33b and Rab6 are functionally overlapping regulators of Golgi homeostasis and trafficking.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2010", "authors": "Starr T, Sun Y, Wilkins N, Storrie B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "20163571", "url": "https://glygen.org/publication/PubMed/20163571" } ] }, { "title": "Phosphoproteome analysis of human liver tissue by long-gradient nanoflow LC coupled with multiple stage MS analysis.", "journal": "Electrophoresis", "date": "2010", "authors": "Han G, Ye M, Liu H, Song C, Sun D, Wu Y, Jiang X, Chen R, Wang C, Wang L, Zou H", "evidence": [ { "database": "iPTMnet", "id": "O14662-1", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14662-1" } ], "reference": [ { "type": "PubMed", "id": "20166139", "url": "https://glygen.org/publication/PubMed/20166139" } ] }, { "title": "Ang2/fat-free is a conserved subunit of the Golgi-associated retrograde protein complex.", "journal": "Molecular biology of the cell", "date": "2010", "authors": "Perez-Victoria FJ, Schindler C, Magadan JG, Mardones GA, Delevoye C, Romao M, Raposo G, Bonifacino JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "20685960", "url": "https://glygen.org/publication/PubMed/20685960" } ] }, { "title": "Interaction of Golgin-84 with the COG complex mediates the intra-Golgi retrograde transport.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2010", "authors": "Sohda M, Misumi Y, Yamamoto A, Nakamura N, Ogata S, Sakisaka S, Hirose S, Ikehara Y, Oda K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "20874812", "url": "https://glygen.org/publication/PubMed/20874812" } ] }, { "title": "Transport according to GARP: receiving retrograde cargo at the trans-Golgi network.", "journal": "Trends in cell biology", "date": "2011", "authors": "Bonifacino JS, Hierro A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "21183348", "url": "https://glygen.org/publication/PubMed/21183348" } ] }, { "title": "Entry at the trans-face of the Golgi.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2011", "authors": "Pfeffer SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "21421921", "url": "https://glygen.org/publication/PubMed/21421921" } ] }, { "title": "The golgin coiled-coil proteins of the Golgi apparatus.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2011", "authors": "Munro S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "21436057", "url": "https://glygen.org/publication/PubMed/21436057" } ] }, { "title": "Requirements for the catalytic cycle of the N-ethylmaleimide-Sensitive Factor (NSF).", "journal": "Biochimica et biophysica acta", "date": "2012", "authors": "Zhao C, Smith EC, Whiteheart SW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "21689688", "url": "https://glygen.org/publication/PubMed/21689688" } ] }, { "title": "The COG complex interacts directly with Syntaxin 6 and positively regulates endosome-to-TGN retrograde transport.", "journal": "The Journal of cell biology", "date": "2011", "authors": "Laufman O, Hong W, Lev S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "21807881", "url": "https://glygen.org/publication/PubMed/21807881" } ] }, { "title": "COPII and COPI traffic at the ER-Golgi interface.", "journal": "Physiology (Bethesda, Md.)", "date": "2011", "authors": "Szul T, Sztul E", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "22013193", "url": "https://glygen.org/publication/PubMed/22013193" } ] }, { "title": "Rab30 is required for the morphological integrity of the Golgi apparatus.", "journal": "Biology of the cell", "date": "2012", "authors": "Kelly EE, Giordano F, Horgan CP, Jollivet F, Raposo G, McCaffrey MW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "22188167", "url": "https://glygen.org/publication/PubMed/22188167" } ] }, { "title": "Electron tomography reveals Rab6 is essential to the trafficking of trans-Golgi clathrin and COPI-coated vesicles and the maintenance of Golgi cisternal number.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2012", "authors": "Storrie B, Micaroni M, Morgan GP, Jones N, Kamykowski JA, Wilkins N, Pan TH, Marsh BJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "22335553", "url": "https://glygen.org/publication/PubMed/22335553" } ] }, { "title": "Genome-wide siRNA screen reveals amino acid starvation-induced autophagy requires SCOC and WAC.", "journal": "The EMBO journal", "date": "2012", "authors": "McKnight NC, Jefferies HB, Alemu EA, Saunders RE, Howell M, Johansen T, Tooze SA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "22354037", "url": "https://glygen.org/publication/PubMed/22354037" } ] }, { "title": "Are Rab proteins the link between Golgi organization and membrane trafficking?", "journal": "Cellular and molecular life sciences : CMLS", "date": "2012", "authors": "Liu S, Storrie B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "22581368", "url": "https://glygen.org/publication/PubMed/22581368" } ] }, { "title": "Coiling up with SCOC and WAC: two new regulators of starvation-induced autophagy.", "journal": "Autophagy", "date": "2012", "authors": "Joachim J, Wirth M, McKnight NC, Tooze SA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "22717455", "url": "https://glygen.org/publication/PubMed/22717455" } ] }, { "title": "Ric1-Rgp1 complex is a guanine nucleotide exchange factor for the late Golgi Rab6A GTPase and an effector of the medial Golgi Rab33B GTPase.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Pusapati GV, Luchetti G, Pfeffer SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "23091056", "url": "https://glygen.org/publication/PubMed/23091056" } ] }, { "title": "Molecular insights into vesicle tethering at the Golgi by the conserved oligomeric Golgi (COG) complex and the golgin TATA element modulatory factor (TMF).", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Miller VJ, Sharma P, Kudlyk TA, Frost L, Rofe AP, Watson IJ, Duden R, Lowe M, Lupashin VV, Ungar D", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "23239882", "url": "https://glygen.org/publication/PubMed/23239882" } ] }, { "title": "The COG complex interacts with multiple Golgi SNAREs and enhances fusogenic assembly of SNARE complexes.", "journal": "Journal of cell science", "date": "2013", "authors": "Laufman O, Hong W, Lev S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "23378023", "url": "https://glygen.org/publication/PubMed/23378023" } ] }, { "title": "Rab6a/a' are important Golgi regulators of pro-inflammatory TNF secretion in macrophages.", "journal": "PloS one", "date": "2013", "authors": "Micaroni M, Stanley AC, Khromykh T, Venturato J, Wong CX, Lim JP, Marsh BJ, Storrie B, Gleeson PA, Stow JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "23437303", "url": "https://glygen.org/publication/PubMed/23437303" } ] }, { "title": "COG complexes form spatial landmarks for distinct SNARE complexes.", "journal": "Nature communications", "date": "2013", "authors": "Willett R, Kudlyk T, Pokrovskaya I, Schonherr R, Ungar D, Duden R, Lupashin V", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "23462996", "url": "https://glygen.org/publication/PubMed/23462996" } ] }, { "title": "The Golgi puppet master: COG complex at center stage of membrane trafficking interactions.", "journal": "Histochemistry and cell biology", "date": "2013", "authors": "Willett R, Ungar D, Lupashin V", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "23839779", "url": "https://glygen.org/publication/PubMed/23839779" } ] }, { "title": "Rab41 is a novel regulator of Golgi apparatus organization that is needed for ER-to-Golgi trafficking and cell growth.", "journal": "PloS one", "date": "2013", "authors": "Liu S, Hunt L, Storrie B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "23936529", "url": "https://glygen.org/publication/PubMed/23936529" } ] }, { "title": "Structural basis for membrane recruitment and allosteric activation of cytohesin family Arf GTPase exchange factors.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2013", "authors": "Malaby AW, van den Berg B, Lambright DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "23940353", "url": "https://glygen.org/publication/PubMed/23940353" } ] }, { "title": "Tethering the assembly of SNARE complexes.", "journal": "Trends in cell biology", "date": "2014", "authors": "Hong W, Lev S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "24119662", "url": "https://glygen.org/publication/PubMed/24119662" } ] }, { "title": "A two-tier Golgi-based control of organelle size underpins the functional plasticity of endothelial cells.", "journal": "Developmental cell", "date": "2014", "authors": "Ferraro F, Kriston-Vizi J, Metcalf DJ, Martin-Martin B, Freeman J, Burden JJ, Westmoreland D, Dyer CE, Knight AE, Ketteler R, Cutler DF", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "24794632", "url": "https://glygen.org/publication/PubMed/24794632" } ] }, { "title": "Membrane tethering.", "journal": "F1000prime reports", "date": "2014", "authors": "Chia PZ, Gleeson PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "25343031", "url": "https://glygen.org/publication/PubMed/25343031" } ] }, { "title": "How Rab proteins determine Golgi structure.", "journal": "International review of cell and molecular biology", "date": "2015", "authors": "Liu S, Storrie B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "25708460", "url": "https://glygen.org/publication/PubMed/25708460" } ] }, { "title": "BAIAP3, a C2 domain-containing Munc13 protein, controls the fate of dense-core vesicles in neuroendocrine cells.", "journal": "J. Cell Biol.", "date": "2017", "authors": "Zhang X, Jiang S, Mitok KA, Li L, Attie AD, Martin TFJ", "evidence": [ { "database": "UniProtKB", "id": "O14662", "url": "https://www.uniprot.org/uniprot/O14662" } ], "reference": [ { "type": "PubMed", "id": "28626000", "url": "https://glygen.org/publication/PubMed/28626000" } ] }, { "title": "Analysis of defects in GNAS and STX16 genes in a Chinese family with pseudohypoparathyroidism.", "journal": "Minerva endocrinology", "date": "2022", "authors": "Zhao P, Liu J, Cheng J, Li Q, Fu S, Wang Y, Yang X, Ma X", "evidence": [ { "database": "RefSeq", "id": "NP_001001433", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001001433" } ], "reference": [ { "type": "PubMed", "id": "33269569", "url": "https://glygen.org/publication/PubMed/33269569" } ] }, { "title": "Progression of PTH Resistance in Autosomal Dominant Pseudohypoparathyroidism Type Ib Due to Maternal STX16 Deletions.", "journal": "The Journal of clinical endocrinology and metabolism", "date": "2022", "authors": "Kiuchi Z, Reyes M, Hanna P, Sharma A, DeClue T, Olney RC, Tebben P, Juppner H", "evidence": [ { "database": "RefSeq", "id": "NP_001001433", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001001433" } ], "reference": [ { "type": "PubMed", "id": "34477200", "url": "https://glygen.org/publication/PubMed/34477200" } ] }, { "title": "Simultaneously Identifying and Distinguishing Glycoproteins with O-GlcNAc and O-GalNAc (the Tn Antigen) in Human Cancer Cells.", "journal": "Analytical chemistry", "date": "2022", "authors": "Xu S, Zheng J, Xiao H, Wu R", "evidence": [ { "database": "O-GlcNAc Database", "id": "O14662", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14662" } ], "reference": [ { "type": "PubMed", "id": "35132862", "url": "https://glygen.org/publication/PubMed/35132862" } ] }, { "title": "Intrafamilial phenotypic heterogeneity in siblings with pseudohypoparathyroidism 1B due to maternal STX16 deletion.", "journal": "Journal of pediatric endocrinology & metabolism : JPEM", "date": "2024-01-29", "authors": "Odom John, Bacino Carlos A, Karaviti Lefkothea P, Bi Weimin, Hoyos-Martinez Alfonso", "evidence": [ { "database": "RefSeq", "id": "NP_001001433", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001001433" } ], "reference": [ { "type": "PubMed", "id": "38095637", "url": "https://glygen.org/publication/PubMed/38095637" } ] }, { "title": "Lysosome biogenesis requires Rab9 function and receptor recycling from endosomes to the trans-Golgi network.", "journal": "The Journal of cell biology", "date": "1994", "authors": "Riederer MA, Soldati T, Shapiro AD, Lin J, Pfeffer SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "7909812", "url": "https://glygen.org/publication/PubMed/7909812" } ] }, { "title": "A protein assembly-disassembly pathway in vitro that may correspond to sequential steps of synaptic vesicle docking, activation, and fusion.", "journal": "Cell", "date": "1993", "authors": "Sollner T, Bennett MK, Whiteheart SW, Scheller RH, Rothman JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "8221884", "url": "https://glygen.org/publication/PubMed/8221884" } ] }, { "title": "Rab9 functions in transport between late endosomes and the trans Golgi network.", "journal": "The EMBO journal", "date": "1993", "authors": "Lombardi D, Soldati T, Riederer MA, Goda Y, Zerial M, Pfeffer SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "8440258", "url": "https://glygen.org/publication/PubMed/8440258" } ] }, { "title": "Sec18p (NSF)-driven release of Sec17p (alpha-SNAP) can precede docking and fusion of yeast vacuoles.", "journal": "Cell", "date": "1996", "authors": "Mayer A, Wickner W, Haas A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "8620540", "url": "https://glygen.org/publication/PubMed/8620540" } ] }, { "title": "A v-SNARE implicated in intra-Golgi transport.", "journal": "The Journal of cell biology", "date": "1996", "authors": "Nagahama M, Orci L, Ravazzola M, Amherdt M, Lacomis L, Tempst P, Rothman JE, Sollner TH", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "8636227", "url": "https://glygen.org/publication/PubMed/8636227" } ] }, { "title": "Identification of a novel Rac1-interacting protein involved in membrane ruffling.", "journal": "The EMBO journal", "date": "1996", "authors": "Van Aelst L, Joneson T, Bar-Sagi D", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "8670882", "url": "https://glygen.org/publication/PubMed/8670882" } ] }, { "title": "A human exchange factor for ARF contains Sec7- and pleckstrin-homology domains.", "journal": "Nature", "date": "1996", "authors": "Chardin P, Paris S, Antonny B, Robineau S, Beraud-Dufour S, Jackson CL, Chabre M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "8945478", "url": "https://glygen.org/publication/PubMed/8945478" } ] }, { "title": "GTP-bound forms of rab6 induce the redistribution of Golgi proteins into the endoplasmic reticulum.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Martinez O, Antony C, Pehau-Arnaudet G, Berger EG, Salamero J, Goud B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "9050864", "url": "https://glygen.org/publication/PubMed/9050864" } ] }, { "title": "Assembly and disassembly of a ternary complex of synaptobrevin, syntaxin, and SNAP-25 in the membrane of synaptic vesicles.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Otto H, Hanson PI, Jahn R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "9177194", "url": "https://glygen.org/publication/PubMed/9177194" } ] }, { "title": "A novel Rab9 effector required for endosome-to-TGN transport.", "journal": "The Journal of cell biology", "date": "1997", "authors": "Diaz E, Schimmoller F, Pfeffer SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "9230071", "url": "https://glygen.org/publication/PubMed/9230071" } ] }, { "title": "Bidirectional transport by distinct populations of COPI-coated vesicles.", "journal": "Cell", "date": "1997", "authors": "Orci L, Stamnes M, Ravazzola M, Amherdt M, Perrelet A, Sollner TH, Rothman JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "9244307", "url": "https://glygen.org/publication/PubMed/9244307" } ] }, { "title": "Molecular cloning and localization of human syntaxin 16, a member of the syntaxin family of SNARE proteins.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1998", "authors": "Tang BL, Low DY, Lee SS, Tan AE, Hong W", "evidence": [ { "database": "UniProtKB", "id": "O14662", "url": "https://www.uniprot.org/uniprot/O14662" } ], "reference": [ { "type": "PubMed", "id": "9464276", "url": "https://glygen.org/publication/PubMed/9464276" } ] }, { "title": "Structure of the guanine nucleotide exchange factor Sec7 domain of human arno and analysis of the interaction with ARF GTPase.", "journal": "Cell", "date": "1998", "authors": "Mossessova E, Gulbis JM, Goldberg J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "9476900", "url": "https://glygen.org/publication/PubMed/9476900" } ] }, { "title": "Structure of the Sec7 domain of the Arf exchange factor ARNO.", "journal": "Nature", "date": "1998", "authors": "Cherfils J, Menetrey J, Mathieu M, Le Bras G, Robineau S, Beraud-Dufour S, Antonny B, Chardin P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "9510256", "url": "https://glygen.org/publication/PubMed/9510256" } ] }, { "title": "Syntaxin-16, a putative Golgi t-SNARE.", "journal": "Eur. J. Cell Biol.", "date": "1998", "authors": "Simonsen A, Bremnes B, R\u00f8nning E, Aasland R, Stenmark H", "evidence": [ { "database": "UniProtKB", "id": "O14662", "url": "https://www.uniprot.org/uniprot/O14662" } ], "reference": [ { "type": "PubMed", "id": "9587053", "url": "https://glygen.org/publication/PubMed/9587053" } ] }, { "title": "TIP47: a cargo selection device for mannose 6-phosphate receptor trafficking.", "journal": "Cell", "date": "1998", "authors": "Diaz E, Pfeffer SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811440", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440" } ], "reference": [ { "type": "PubMed", "id": "9590177", "url": "https://glygen.org/publication/PubMed/9590177" } ] }, { "title": "Solution structure of the cytohesin-1 (B2-1) Sec7 domain and its interaction with the GTPase ADP ribosylation factor 1.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Betz SF, Schnuchel A, Wang H, Olejniczak ET, Meadows RP, Lipsky BP, Harris EA, Staunton DE, Fesik SW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "9653114", "url": "https://glygen.org/publication/PubMed/9653114" } ] }, { "title": "ARNO3, a Sec7-domain guanine nucleotide exchange factor for ADP ribosylation factor 1, is involved in the control of Golgi structure and function.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Franco M, Boretto J, Robineau S, Monier S, Goud B, Chardin P, Chavrier P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "9707577", "url": "https://glygen.org/publication/PubMed/9707577" } ] }, { "title": "Identification and characterization of golgin-84, a novel Golgi integral membrane protein with a cytoplasmic coiled-coil domain.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Bascom RA, Srinivasan S, Nussbaum RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "9915833", "url": "https://glygen.org/publication/PubMed/9915833" } ] } ], "pathway": [ { "id": "hsa:8675", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:8675", "resource": "KEGG Pathway" }, { "id": "R-HSA-6811438", "name": "Intra-Golgi traffic", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438", "resource": "Reactome", "description": "Intra-Golgi traffic" }, { "id": "R-HSA-6811440", "name": "Retrograde transport at the Trans-Golgi-Network", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811440", "resource": "Reactome", "description": "Retrograde transport at the Trans-Golgi-Network" } ], "orthologs": [ { "uniprot_canonical_ac": "A0A0G2K528-1", "protein_name": "Syntaxin 16", "gene_name": "Stx16", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MATRRLTDAFLLLRNNSIQNRQLLAEQVSSHTTSSPLHSRSIAAELDELADDRMALVSGISLDPEAAIGVTKRSPPKWVDGVDEIQYDVGRIKQKMRELASLHDKHLNRPTLDDSSEEEHAIEITTQEVTQLFHRCQRAVQALPSRARRTCSEQEERLLRNVVASLAQALQELSTSFRHAQSDYLKRMKNREERSQHFFDTPVPLMDDGDDATLYGQGFTDDQLVLVEQNTLVVEEREREIRQIVQSISDLNEIFRDLGAMIVEQGTVLDRIDYNVEQSCVKTEDGLKQLHKAEQYQKKNRKMLVILILVAVIVVLIVVLIAVKSR", "length": 326 }, "evidence": [ { "id": "45930257", "url": "http://www.informatics.jax.org/homology/45930257", "database": "MGI" }, { "id": "O14662", "url": "https://omabrowser.org/oma/group/O14662/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q08144-1", "protein_name": "t-SNARE affecting a late Golgi compartment protein 2", "gene_name": "TLG2", "tax_id": 559292, "organism": "Saccharomyces cerevisiae S288C", "sequence": { "sequence": "MFRDRTNLFLSYRRTFPHNITFSSGKAPLGDDQDIEMGTYPMMNMSHDISARLTDERKNKHENHSDALPPIFIDIAQDVDDYLLEVRRLSEQLAKVYRKNSLPGFEDKSHDEALIEDLSFKVIQMLQKCYAVMKRLKTIYNSQFVDGKQLSREELIILDNLQKIYAEKIQTESNKFRVLQNNYLKFLNKDDLKPIRNKASAENTLLLDDEEEEAAREKREGLDIEDYSKRTLQRQQQLHDTSAEAYLRERDEEITQLARGVLEVSTIFREMQDLVVDQGTIVDRIDYNLENTVVELKSADKELNKATHYQKRTQKCKVILLLTLCVIALFFFVMLKPHGGGSGGRNNGSNKYNNDDNKTVNNSHDDGSNTHINDEESNLPSIVEVTESENDALDDLL", "length": 397 }, "evidence": [ { "id": "O14662", "url": "https://omabrowser.org/oma/group/O14662/", "database": "OMA" } ], "common_name": "Yeast" }, { "uniprot_canonical_ac": "Q8BVI5-1", "protein_name": "Syntaxin-16", "gene_name": "Stx16", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MATRRLTDAFLLLRNNSIQTRQLLAEQVSSHTTSSPLHSRSIAAELDELADDRMALVSGISLDPEAAIGVTKRSPPKWVDGVDEIQYDVGRIKQKMKELASLHDKHLNRPTLDDSSEEEHAIEITTQEVTQLFHRCQRAVQALPSRARRACSEQEERLLRNVVASLAQALQELSTSFRHAQSDYLKRMKNREERSQHFFDTPVPLMDDGDDATLYGQGFTDDQLVLVEQNTLMVEEREREIRQIVQSISDLNEIFRDLGAMIVEQGTVLDRIDYNVEQSCVKTEDGLKQLHKAEQYQKKNRKMLVIVILVAVIIVLLVALVAVKSR", "length": 326 }, "evidence": [ { "id": "45930257", "url": "http://www.informatics.jax.org/homology/45930257", "database": "MGI" }, { "id": "O14662", "url": "https://omabrowser.org/oma/group/O14662/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9VR90-1", "protein_name": "Syntaxin 16", "gene_name": "Syx16", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MTSRNLTEVFVIMRNNASKNRNHYDDRRGSDAERLLKHSVREAEEGLELQDDYGTPPAWLDKFEEAQYTMSKIKPKLDELGSLHARHLLRPAFDDQRDDECDIEVLSQIVSKLITSTHRHIQCVRSSIGVGSKMEQCLTVNAVHCALLQLQELTVKFRASQNAYLLQLNSREERSQKYFDDGGGAGAGDVFTNVELGEQSAENFVDSFDNFLQPPAEGKSGNGYLFEDDEQAIDDHFQRPPASRMTQQQLLLFEEENTRVAQHREQEVTKIVKSIYDLNDIFKDLGHMVQEQGTVLDRIDYNVEQTQTRVSEGLRQLHKAEMYQRKNRKMCVILVLAAVTFFMLLLLILTKL", "length": 352 }, "evidence": [ { "id": "O14662", "url": "https://omabrowser.org/oma/group/O14662/", "database": "OMA" } ], "common_name": "Fruit fly" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 14, "go_terms": [ { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "O14662", "url": "https://www.uniprot.org/uniprot/O14662" } ], "pmid": "" }, { "name": "Golgi membrane", "id": "GO:0000139", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000139", "evidence": [ { "database": "UniProtKB", "id": "O14662", "url": "https://www.uniprot.org/uniprot/O14662" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "O14662", "url": "https://www.uniprot.org/uniprot/O14662" } ], "pmid": "" }, { "name": "Golgi apparatus", "id": "GO:0005794", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005794", "evidence": [ { "database": "UniProtKB", "id": "O14662", "url": "https://www.uniprot.org/uniprot/O14662" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "O14662", "url": "https://www.uniprot.org/uniprot/O14662" } ], "pmid": "" }, { "name": "focal adhesion", "id": "GO:0005925", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005925", "evidence": [ { "database": "UniProtKB", "id": "O14662", "url": "https://www.uniprot.org/uniprot/O14662" } ], "pmid": "" }, { "name": "trans-Golgi network membrane", "id": "GO:0032588", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032588", "evidence": [ { "database": "UniProtKB", "id": "O14662", "url": "https://www.uniprot.org/uniprot/O14662" } ], "pmid": "" }, { "name": "intracellular membrane-bounded organelle", "id": "GO:0043231", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0043231", "evidence": [ { "database": "UniProtKB", "id": "O14662", "url": "https://www.uniprot.org/uniprot/O14662" } ], "pmid": "" }, { "name": "perinuclear region of cytoplasm", "id": "GO:0048471", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048471", "evidence": [ { "database": "UniProtKB", "id": "O14662", "url": "https://www.uniprot.org/uniprot/O14662" } ], "pmid": "" }, { "name": "endomembrane system", "id": "GO:0012505", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0012505", "evidence": [ { "database": "UniProtKB", "id": "O14662", "url": "https://www.uniprot.org/uniprot/O14662" } ], "pmid": "" }, { "name": "synaptic vesicle membrane", "id": "GO:0030672", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030672", "evidence": [ { "database": "UniProtKB", "id": "O14662", "url": "https://www.uniprot.org/uniprot/O14662" } ], "pmid": "" }, { "name": "trans-Golgi network", "id": "GO:0005802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005802", "evidence": [ { "database": "UniProtKB", "id": "O14662", "url": "https://www.uniprot.org/uniprot/O14662" } ], "pmid": "" }, { "name": "SNARE complex", "id": "GO:0031201", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031201", "evidence": [ { "database": "UniProtKB", "id": "O14662", "url": "https://www.uniprot.org/uniprot/O14662" } ], "pmid": "" }, { "name": "Golgi cisterna", "id": "GO:0031985", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031985", "evidence": [ { "database": "UniProtKB", "id": "O14662", "url": "https://www.uniprot.org/uniprot/O14662" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 6, "go_terms": [ { "name": "vesicle-mediated transport", "id": "GO:0016192", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016192", "evidence": [ { "database": "UniProtKB", "id": "O14662", "url": "https://www.uniprot.org/uniprot/O14662" } ], "pmid": "" }, { "name": "intracellular protein transport", "id": "GO:0006886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006886", "evidence": [ { "database": "UniProtKB", "id": "O14662", "url": "https://www.uniprot.org/uniprot/O14662" } ], "pmid": "" }, { "name": "retrograde transport, endosome to Golgi", "id": "GO:0042147", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042147", "evidence": [ { "database": "UniProtKB", "id": "O14662", "url": "https://www.uniprot.org/uniprot/O14662" } ], "pmid": "" }, { "name": "endocytic recycling", "id": "GO:0032456", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032456", "evidence": [ { "database": "UniProtKB", "id": "O14662", "url": "https://www.uniprot.org/uniprot/O14662" } ], "pmid": "" }, { "name": "vesicle fusion", "id": "GO:0006906", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006906", "evidence": [ { "database": "UniProtKB", "id": "O14662", "url": "https://www.uniprot.org/uniprot/O14662" } ], "pmid": "" }, { "name": "vesicle docking", "id": "GO:0048278", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0048278", "evidence": [ { "database": "UniProtKB", "id": "O14662", "url": "https://www.uniprot.org/uniprot/O14662" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 3, "go_terms": [ { "name": "syntaxin binding", "id": "GO:0019905", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019905", "evidence": [ { "database": "UniProtKB", "id": "O14662", "url": "https://www.uniprot.org/uniprot/O14662" } ], "pmid": "" }, { "name": "SNARE binding", "id": "GO:0000149", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000149", "evidence": [ { "database": "UniProtKB", "id": "O14662", "url": "https://www.uniprot.org/uniprot/O14662" } ], "pmid": "" }, { "name": "SNAP receptor activity", "id": "GO:0005484", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005484", "evidence": [ { "database": "UniProtKB", "id": "O14662", "url": "https://www.uniprot.org/uniprot/O14662" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 15, "end_pos": 17, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [ 34, 35, 41 ], "sequon_annotation_sites": [ { "start_pos": 15, "end_pos": 17 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 121 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }