{ "uniprot_canonical_ac": "O14653-1", "uniprot_ac": "O14653", "uniprot_id": "GOSR2_HUMAN", "mass": { "chemical_mass": 24775.0, "monoisotopic_mass": 24775.0 }, "refseq": { "ac": "NP_001012529", "name": "Golgi SNAP receptor complex member 2 isoform C", "summary": "This gene encodes a trafficking membrane protein which transports proteins among the medial- and trans-Golgi compartments. Due to its chromosomal location and trafficking function, this gene may be involved in familial essential hypertension. [provided by RefSeq, Mar 2016].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001012529" }, "gene_names": [ { "name": "GOSR2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O14653", "id": "O14653" }, { "name": "Bos1; EPM6; GS27; MYOS", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001012529", "id": "NP_001012529" }, { "name": "GOSR2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001012529", "id": "NP_001012529" }, { "name": "GS27", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O14653", "id": "O14653" }, { "name": "hCG_1993582", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O14653", "id": "O14653" } ], "protein_names": [ { "name": "Golgi SNAP receptor complex member 2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O14653" }, { "name": "27 kDa Golgi SNARE protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O14653" }, { "name": "Golgi SNAP receptor complex member 2 isoform C", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001012529", "id": "NP_001012529" }, { "name": "Membrin", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O14653" }, { "name": "membrin; 27 kDa Golgi SNARE protein", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001012529", "id": "NP_001012529" } ], "function": [ { "annotation": "Computational estimates of annular diameter reveal genetic determinants of mitral valve function and disease. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001012529", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001012529" }, { "database": "PubMed", "id": "35132965", "url": "https://glygen.org/publication/PubMed/35132965" } ] }, { "annotation": "Involved in transport of proteins from the cis/medial-Golgi to the trans-Golgi network.", "evidence": [ { "database": "UniProtKB", "id": "A0A1W2PQE0", "url": "https://www.uniprot.org/uniprot/A0A1W2PQE0#function" }, { "database": "UniProtKB", "id": "ARBA00037078", "url": "https://www.uniprot.org/uniprot/ARBA00037078#function" }, { "database": "UniProtKB", "id": "A0A1W2PQM3", "url": "https://www.uniprot.org/uniprot/A0A1W2PQM3#function" }, { "database": "UniProtKB", "id": "PIRNR028865", "url": "https://www.uniprot.org/uniprot/PIRNR028865#function" }, { "database": "UniProtKB", "id": "A0A1W2PRC2", "url": "https://www.uniprot.org/uniprot/A0A1W2PRC2#function" }, { "database": "UniProtKB", "id": "I3L1K7", "url": "https://www.uniprot.org/uniprot/I3L1K7#function" }, { "database": "UniProtKB", "id": "A0A1W2PS12", "url": "https://www.uniprot.org/uniprot/A0A1W2PS12#function" }, { "database": "UniProtKB", "id": "A0A1W2PPJ0", "url": "https://www.uniprot.org/uniprot/A0A1W2PPJ0#function" }, { "database": "UniProtKB", "id": "A0A1W2PQP2", "url": "https://www.uniprot.org/uniprot/A0A1W2PQP2#function" }, { "database": "UniProtKB", "id": "A0A1W2PNV3", "url": "https://www.uniprot.org/uniprot/A0A1W2PNV3#function" }, { "database": "UniProtKB", "id": "A0A1X7SBU8", "url": "https://www.uniprot.org/uniprot/A0A1X7SBU8#function" }, { "database": "UniProtKB", "id": "A0A1W2PPG5", "url": "https://www.uniprot.org/uniprot/A0A1W2PPG5#function" }, { "database": "UniProtKB", "id": "A0A1W2PPG1", "url": "https://www.uniprot.org/uniprot/A0A1W2PPG1#function" }, { "database": "UniProtKB", "id": "A0A1W2PR02", "url": "https://www.uniprot.org/uniprot/A0A1W2PR02#function" }, { "database": "UniProtKB", "id": "A0A1W2PPW8", "url": "https://www.uniprot.org/uniprot/A0A1W2PPW8#function" }, { "database": "UniProtKB", "id": "A0A1W2PPP5", "url": "https://www.uniprot.org/uniprot/A0A1W2PPP5#function" }, { "database": "UniProtKB", "id": "O14653", "url": "https://www.uniprot.org/uniprot/O14653#function" }, { "database": "PubMed", "id": "9349823", "url": "https://glygen.org/publication/PubMed/9349823" }, { "database": "UniProtKB", "id": "A0A1W2PR23", "url": "https://www.uniprot.org/uniprot/A0A1W2PR23#function" }, { "database": "UniProtKB", "id": "A0A1W2PS81", "url": "https://www.uniprot.org/uniprot/A0A1W2PS81#function" }, { "database": "UniProtKB", "id": "I3L4Z6", "url": "https://www.uniprot.org/uniprot/I3L4Z6#function" }, { "database": "UniProtKB", "id": "A0A1W2PQ06", "url": "https://www.uniprot.org/uniprot/A0A1W2PQ06#function" }, { "database": "UniProtKB", "id": "A0A1W2PRL0", "url": "https://www.uniprot.org/uniprot/A0A1W2PRL0#function" }, { "database": "UniProtKB", "id": "A0A1W2PQ77", "url": "https://www.uniprot.org/uniprot/A0A1W2PQ77#function" }, { "database": "UniProtKB", "id": "A0A1W2PRV0", "url": "https://www.uniprot.org/uniprot/A0A1W2PRV0#function" } ] }, { "annotation": "Novel Genetic and Phenotypic Expansion in GOSR2-Related Progressive Myoclonus Epilepsy. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001012529", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001012529" }, { "database": "PubMed", "id": "37895210", "url": "https://glygen.org/publication/PubMed/37895210" } ] }, { "annotation": "Recessive mutations in TRAPPC11 and GOSR2 are associated with congenital muscular dystrophy and hypoglycosylation of alpha-dystroglycan. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001012529", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001012529" }, { "database": "PubMed", "id": "29855340", "url": "https://glygen.org/publication/PubMed/29855340" } ] }, { "annotation": "This gene encodes a trafficking membrane protein which transports proteins among the medial- and trans-Golgi compartments. Due to its chromosomal location and trafficking function, this gene may be involved in familial essential hypertension. [provided by RefSeq, Mar 2016].", "evidence": [ { "database": "RefSeq", "id": "NP_001012529", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001012529" } ] } ], "disease": [ { "disease_id": "DOID:0111449", "recommended_name": { "id": "DOID:0111449", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111449", "name": "progressive myoclonus epilepsy 6", "description": "A progressive myoclonus epilepsy characterized by onset of ataxia in the first years of life, followed by action myoclonus and seizures later in childhood, and loss of independent ambulation in the second decade that has_material_basis_in homozygous or compound heterozygous mutation in the GOSR2 gene on chromosome 17q21.32." }, "synonyms": [ { "id": "DOID:0111449", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111449", "name": "EPM6", "description": "" }, { "id": "DOID:0111449", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111449", "name": "GOSR2-related progressive myoclonus ataxia", "description": "" }, { "id": "DOID:0111449", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111449", "name": "North Sea progressive myoclonus epilepsy", "description": "" }, { "id": "DOID:0111449", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111449", "name": "PME type 6", "description": "" }, { "id": "DOID:0111449", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:0111449", "name": "Progressive myoclonus epilepsy type 6", "description": "" }, { "id": "MONDO:0013526", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013526", "name": "progressive myoclonic epilepsy type 6", "description": "Any progressive myoclonic epilepsy in which the cause of the disease is a mutation in the GOSR2 gene." }, { "id": "MONDO:0013526", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013526", "name": "EPM6", "description": "" }, { "id": "MONDO:0013526", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013526", "name": "GOSR2 progressive myoclonic epilepsy", "description": "" }, { "id": "MONDO:0013526", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013526", "name": "GOSR2-related progressive myoclonus ataxia", "description": "" }, { "id": "MONDO:0013526", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013526", "name": "North Sea progressive myoclonus epilepsy", "description": "" }, { "id": "MONDO:0013526", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013526", "name": "PME type 6", "description": "" }, { "id": "MONDO:0013526", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013526", "name": "epilepsy, progressive myoclonic 6", "description": "" }, { "id": "MONDO:0013526", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013526", "name": "epilepsy, progressive myoclonic, type 6", "description": "" }, { "id": "MONDO:0013526", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013526", "name": "progressive myoclonic epilepsy caused by mutation in GOSR2", "description": "" }, { "id": "MONDO:0013526", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013526", "name": "progressive myoclonus epilepsy type 6", "description": "" }, { "id": "MONDO:0013526", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013526", "name": "epilepsy, progressive myoclonic, 6", "description": "" }, { "id": "MIM:614018", "resource": "MIM", "url": "https://www.omim.org/entry/614018", "name": "Epilepsy, progressive myoclonic 6", "description": "Epilepsy, progressive myoclonic 6" } ], "evidence": [ { "id": "614018", "database": "MIM", "url": "https://www.omim.org/entry/614018" } ] }, { "disease_id": "MONDO:0859336", "recommended_name": { "id": "MONDO:0859336", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0859336", "name": "muscular dystrophy, congenital, with or without seizures", "description": "" }, "synonyms": [ { "id": "MIM:620166", "resource": "MIM", "url": "https://www.omim.org/entry/620166", "name": "Muscular dystrophy, congenital, with or without seizures", "description": "Muscular dystrophy, congenital, with or without seizures" } ], "evidence": [ { "id": "620166", "database": "MIM", "url": "https://www.omim.org/entry/620166" } ] } ], "snv": [], "mutagenesis": [ { "start_pos": 118, "end_pos": 118, "sequence_org": "I", "sequence_mut": "A", "comment": "Loss of interaction with SEC24C.", "evidence": [ { "database": "UniProtKB", "id": "O14653", "url": "https://www.uniprot.org/uniprot/O14653" }, { "database": "PubMed", "id": "18843296", "url": "https://glygen.org/publication/PubMed/18843296" } ] }, { "start_pos": 120, "end_pos": 120, "sequence_org": "M", "sequence_mut": "A", "comment": "Loss of interaction with SEC24C.", "evidence": [ { "database": "UniProtKB", "id": "O14653", "url": "https://www.uniprot.org/uniprot/O14653" }, { "database": "PubMed", "id": "18843296", "url": "https://glygen.org/publication/PubMed/18843296" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "84.08", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000108433", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000108433" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "79.91", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000108433", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000108433" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "83.66", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000108433", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000108433" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "49.96", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000108433", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000108433" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "94.77", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000108433", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000108433" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "95.96", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000108433", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000108433" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "59.32", "present": "LOW", "evidence": [ { "database": "Bgee", "id": "ENSG00000108433", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000108433" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "84.32", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000108433", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000108433" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "91.62", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000108433", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000108433" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "66.41", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000108433", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000108433" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "89.36", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000108433", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000108433" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "93.08", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000108433", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000108433" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "90.7", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000108433", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000108433" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O14653", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14653" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O14653", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14653" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O14653", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14653" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O14653", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14653" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O14653", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14653" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O14653", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14653" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O14653", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14653" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O14653", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14653" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O14653", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14653" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O14653", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14653" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O14653", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14653" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O14653", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14653" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O14653", "url": "https://www.uniprot.org/uniprot/O14653" } ], "common_name": "Human" } ], "gene": [ { "name": "GOSR2", "url": "https://www.uniprot.org/uniprot/O14653", "locus": { "chromosome": "17", "start_pos": 46975524, "end_pos": 46923075, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000108433", "url": "https://www.ensembl.org/id/ENSG00000108433" } ] } } ], "crossref": [ { "id": "ENSG00000108433", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000108433", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd15863", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd15863", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "GOSR2", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=GOSR2", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "9570", "url": "https://www.ncbi.nlm.nih.gov/gene/9570", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "4431", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=4431", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O14653", "url": "https://www.ebi.ac.uk/intact/interactors/id:O14653*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR010989", "url": "https://www.ebi.ac.uk/interpro/entry/IPR010989", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR027027", "url": "https://www.ebi.ac.uk/interpro/entry/IPR027027", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR038407", "url": "https://www.ebi.ac.uk/interpro/entry/IPR038407", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:9570", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:9570", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "604027", "url": "http://www.omim.org/entry/604027", "database": "MIM", "categories": [ "Other" ] }, { "id": "614018", "url": "http://www.omim.org/entry/614018", "database": "MIM", "categories": [ "Other" ] }, { "id": "620166", "url": "http://www.omim.org/entry/620166", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O14653", "url": "https://www.nextprot.org/entry/NX_O14653", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "RMRVDQL", "url": "https://omabrowser.org/oma/group/RMRVDQL/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5477092at2759", "url": "http://www.orthodb.org/?query=5477092at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR12138", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12138", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR12138:SF100", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR12138:SF100", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR21230", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR21230", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR21230:SF1", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR21230:SF1", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "3EG9", "url": "https://www.rcsb.org/structure/3EG9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF12352", "url": "http://pfam.xfam.org/family/PF12352", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O14653", "url": "https://pharos.nih.gov/targets/O14653", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O14653", "url": "http://purl.obolibrary.org/obo/PR_O14653", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-381038", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381038", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001012529", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001012529", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "A0A1W2PNV3", "url": "https://www.uniprot.org/uniprot/A0A1W2PNV3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PNV3-1", "url": "https://www.uniprot.org/uniprot/A0A1W2PNV3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PP28", "url": "https://www.uniprot.org/uniprot/A0A1W2PP28", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PP28-1", "url": "https://www.uniprot.org/uniprot/A0A1W2PP28-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PPE0", "url": "https://www.uniprot.org/uniprot/A0A1W2PPE0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PPE0-1", "url": "https://www.uniprot.org/uniprot/A0A1W2PPE0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PPG1", "url": "https://www.uniprot.org/uniprot/A0A1W2PPG1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PPG1-1", "url": "https://www.uniprot.org/uniprot/A0A1W2PPG1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PPG5", "url": "https://www.uniprot.org/uniprot/A0A1W2PPG5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PPG5-1", "url": "https://www.uniprot.org/uniprot/A0A1W2PPG5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PPJ0", "url": "https://www.uniprot.org/uniprot/A0A1W2PPJ0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PPJ0-1", "url": "https://www.uniprot.org/uniprot/A0A1W2PPJ0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PPP5", "url": "https://www.uniprot.org/uniprot/A0A1W2PPP5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PPP5-1", "url": "https://www.uniprot.org/uniprot/A0A1W2PPP5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PPW8", "url": "https://www.uniprot.org/uniprot/A0A1W2PPW8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PPW8-1", "url": "https://www.uniprot.org/uniprot/A0A1W2PPW8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PQ06", "url": "https://www.uniprot.org/uniprot/A0A1W2PQ06", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PQ06-1", "url": "https://www.uniprot.org/uniprot/A0A1W2PQ06-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PQ12", "url": "https://www.uniprot.org/uniprot/A0A1W2PQ12", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PQ12-1", "url": "https://www.uniprot.org/uniprot/A0A1W2PQ12-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PQ38", "url": "https://www.uniprot.org/uniprot/A0A1W2PQ38", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PQ38-1", "url": "https://www.uniprot.org/uniprot/A0A1W2PQ38-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PQ77", "url": "https://www.uniprot.org/uniprot/A0A1W2PQ77", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PQ77-1", "url": "https://www.uniprot.org/uniprot/A0A1W2PQ77-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PQE0", "url": "https://www.uniprot.org/uniprot/A0A1W2PQE0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PQE0-1", "url": "https://www.uniprot.org/uniprot/A0A1W2PQE0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PQM3", "url": "https://www.uniprot.org/uniprot/A0A1W2PQM3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PQM3-1", "url": "https://www.uniprot.org/uniprot/A0A1W2PQM3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PQP2", "url": "https://www.uniprot.org/uniprot/A0A1W2PQP2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PQP2-1", "url": "https://www.uniprot.org/uniprot/A0A1W2PQP2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PQQ4", "url": "https://www.uniprot.org/uniprot/A0A1W2PQQ4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PQQ4-1", "url": "https://www.uniprot.org/uniprot/A0A1W2PQQ4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PQS3", "url": "https://www.uniprot.org/uniprot/A0A1W2PQS3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PQS3-1", "url": "https://www.uniprot.org/uniprot/A0A1W2PQS3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PR02", "url": "https://www.uniprot.org/uniprot/A0A1W2PR02", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PR02-1", "url": "https://www.uniprot.org/uniprot/A0A1W2PR02-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PR23", "url": "https://www.uniprot.org/uniprot/A0A1W2PR23", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PR23-1", "url": "https://www.uniprot.org/uniprot/A0A1W2PR23-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PRC2", "url": "https://www.uniprot.org/uniprot/A0A1W2PRC2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PRC2-1", "url": "https://www.uniprot.org/uniprot/A0A1W2PRC2-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PRD0", "url": "https://www.uniprot.org/uniprot/A0A1W2PRD0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PRD0-1", "url": "https://www.uniprot.org/uniprot/A0A1W2PRD0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PRE6", "url": "https://www.uniprot.org/uniprot/A0A1W2PRE6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PRE6-1", "url": "https://www.uniprot.org/uniprot/A0A1W2PRE6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PRH7", "url": "https://www.uniprot.org/uniprot/A0A1W2PRH7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PRH7-1", "url": "https://www.uniprot.org/uniprot/A0A1W2PRH7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PRL0", "url": "https://www.uniprot.org/uniprot/A0A1W2PRL0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PRL0-1", "url": "https://www.uniprot.org/uniprot/A0A1W2PRL0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PRP7", "url": "https://www.uniprot.org/uniprot/A0A1W2PRP7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PRP7-1", "url": "https://www.uniprot.org/uniprot/A0A1W2PRP7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PRV0", "url": "https://www.uniprot.org/uniprot/A0A1W2PRV0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PRV0-1", "url": "https://www.uniprot.org/uniprot/A0A1W2PRV0-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PS12", "url": "https://www.uniprot.org/uniprot/A0A1W2PS12", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PS12-1", "url": "https://www.uniprot.org/uniprot/A0A1W2PS12-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PS81", "url": "https://www.uniprot.org/uniprot/A0A1W2PS81", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1W2PS81-1", "url": "https://www.uniprot.org/uniprot/A0A1W2PS81-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1X7SBU8", "url": "https://www.uniprot.org/uniprot/A0A1X7SBU8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "A0A1X7SBU8-1", "url": "https://www.uniprot.org/uniprot/A0A1X7SBU8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3L0K1", "url": "https://www.uniprot.org/uniprot/I3L0K1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3L0K1-1", "url": "https://www.uniprot.org/uniprot/I3L0K1-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3L1K7", "url": "https://www.uniprot.org/uniprot/I3L1K7", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3L1K7-1", "url": "https://www.uniprot.org/uniprot/I3L1K7-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3L4Z6", "url": "https://www.uniprot.org/uniprot/I3L4Z6", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3L4Z6-1", "url": "https://www.uniprot.org/uniprot/I3L4Z6-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3NI02", "url": "https://www.uniprot.org/uniprot/I3NI02", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3NI02-1", "url": "https://www.uniprot.org/uniprot/I3NI02-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O14653", "url": "https://www.uniprot.org/uniprot/O14653", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O14653-1", "url": "https://www.uniprot.org/uniprot/O14653-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O14653-2", "url": "https://www.uniprot.org/uniprot/O14653-2", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O14653-3", "url": "https://www.uniprot.org/uniprot/O14653-3", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDLILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYFMIGGMLLTCVVMFLVVQYLT", "length": 212, "header": "sp|O14653-1|GOSR2_HUMAN Isoform 1 of Golgi SNAP receptor complex member 2 OS=Homo sapiens OX=9606 GN=GOSR2 PE=1 SV=2 CANONICAL=O14653-1" }, "isoforms": [ { "isoform_ac": "A0A1W2PNV3-1", "url": "", "sequence": { "sequence": "IFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDLILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYFMIAM", "length": 153, "header": "tr|A0A1W2PNV3-1|GOSR2_HUMAN Computationally mapped isoform of Golgi SNAP receptor complex member 2 OS=Homo sapiens OX=9606 GN=GOSR2 PE=1 SV=1 CANONICAL=O14653-1" }, "locus": { "chromosome": "17", "start_pos": 46952667, "end_pos": 46931134, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000639713.1", "url": "https://www.ensembl.org/id/ENST00000639713.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000491100.1", "url": "https://www.ensembl.org/id/ENSP00000491100.1" } ] } }, { "isoform_ac": "A0A1W2PP28-1", "url": "", "sequence": { "sequence": "MDESLQFNSSLQKVHNGMDDLILDGHNILDGLRTQRLTLKVGSLLGDREKASCFSLIQQFSNCVYILITCPQIVIF", "length": 76, "header": "tr|A0A1W2PP28-1|GOSR2_HUMAN Computationally mapped isoform of Golgi SNAP receptor complex member 2 OS=Homo sapiens OX=9606 GN=GOSR2 PE=1 SV=1 CANONICAL=O14653-1" }, "locus": { "chromosome": "17", "start_pos": 46935277, "end_pos": 46935050, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000639031.1", "url": "https://www.ensembl.org/id/ENST00000639031.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000491283.1", "url": "https://www.ensembl.org/id/ENSP00000491283.1" } ] } }, { "isoform_ac": "A0A1W2PPE0-1", "url": "", "sequence": { "sequence": "MDPLFQQTHNVLYSHRPALSELLRYVAGPRDPVLHGTPGDGRQAVCAQGLRRRSLTLPTCWACPTQ", "length": 66, "header": "tr|A0A1W2PPE0-1|GOSR2_HUMAN Computationally mapped isoform of Golgi SNAP receptor complex member 2 OS=Homo sapiens OX=9606 GN=GOSR2 PE=1 SV=1 CANONICAL=O14653-1" }, "locus": { "chromosome": "17", "start_pos": 46938653, "end_pos": 46923193, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000640711.1", "url": "https://www.ensembl.org/id/ENST00000640711.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000491361.1", "url": "https://www.ensembl.org/id/ENSP00000491361.1" } ] } }, { "isoform_ac": "A0A1W2PPG1-1", "url": "", "sequence": { "sequence": "MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDLILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYFMIENSILLCCPGWSAIAQ", "length": 210, "header": "tr|A0A1W2PPG1-1|GOSR2_HUMAN Computationally mapped isoform of Golgi SNAP receptor complex member 2 OS=Homo sapiens OX=9606 GN=GOSR2 PE=1 SV=1 CANONICAL=O14653-1" }, "locus": { "chromosome": "17", "start_pos": 46963881, "end_pos": 46923193, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000640358.1", "url": "https://www.ensembl.org/id/ENST00000640358.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000491135.1", "url": "https://www.ensembl.org/id/ENSP00000491135.1" } ] } }, { "isoform_ac": "A0A1W2PPG5-1", "url": "", "sequence": { "sequence": "MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDLILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYFMIASVSS", "length": 199, "header": "tr|A0A1W2PPG5-1|GOSR2_HUMAN Computationally mapped isoform of Golgi SNAP receptor complex member 2 OS=Homo sapiens OX=9606 GN=GOSR2 PE=1 SV=1 CANONICAL=O14653-1" }, "locus": { "chromosome": "17", "start_pos": 46948579, "end_pos": 46923193, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000638219.1", "url": "https://www.ensembl.org/id/ENST00000638219.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000491399.1", "url": "https://www.ensembl.org/id/ENSP00000491399.1" } ] } }, { "isoform_ac": "A0A1W2PPJ0-1", "url": "", "sequence": { "sequence": "MPPKCLILGGTPRQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDLILDGHNILDGLRTQ", "length": 157, "header": "tr|A0A1W2PPJ0-1|GOSR2_HUMAN Computationally mapped isoform of Golgi SNAP receptor complex member 2 OS=Homo sapiens OX=9606 GN=GOSR2 PE=1 SV=1 CANONICAL=O14653-1" }, "locus": { "chromosome": "17", "start_pos": 46935154, "end_pos": 46923350, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000640806.1", "url": "https://www.ensembl.org/id/ENST00000640806.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000491432.1", "url": "https://www.ensembl.org/id/ENSP00000491432.1" } ] } }, { "isoform_ac": "A0A1W2PPP5-1", "url": "", "sequence": { "sequence": "MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDLILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYFMIAANRFLDF", "length": 202, "header": "tr|A0A1W2PPP5-1|GOSR2_HUMAN Computationally mapped isoform of Golgi SNAP receptor complex member 2 OS=Homo sapiens OX=9606 GN=GOSR2 PE=1 SV=1 CANONICAL=O14653-1" }, "locus": { "chromosome": "17", "start_pos": 46964366, "end_pos": 46923193, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000639365.1", "url": "https://www.ensembl.org/id/ENST00000639365.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000491253.1", "url": "https://www.ensembl.org/id/ENSP00000491253.1" } ] } }, { "isoform_ac": "A0A1W2PPW8-1", "url": "", "sequence": { "sequence": "MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYFMIENSILLCCPGWSAIAQ", "length": 163, "header": "tr|A0A1W2PPW8-1|GOSR2_HUMAN Computationally mapped isoform of Golgi SNAP receptor complex member 2 OS=Homo sapiens OX=9606 GN=GOSR2 PE=1 SV=1 CANONICAL=O14653-1" }, "locus": { "chromosome": "17", "start_pos": 46963881, "end_pos": 46923193, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000639199.1", "url": "https://www.ensembl.org/id/ENST00000639199.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000491396.1", "url": "https://www.ensembl.org/id/ENSP00000491396.1" } ] } }, { "isoform_ac": "A0A1W2PQ06-1", "url": "", "sequence": { "sequence": "MDPLFQQTHKQVHEIQSCMGRLETADKQSVHKNEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNVSQARGEGRPALDRSWGLEFRSLSAICFGGV", "length": 141, "header": "tr|A0A1W2PQ06-1|GOSR2_HUMAN Computationally mapped isoform of Golgi SNAP receptor complex member 2 OS=Homo sapiens OX=9606 GN=GOSR2 PE=1 SV=1 CANONICAL=O14653-1" }, "locus": { "chromosome": "17", "start_pos": 46932292, "end_pos": 46923193, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000640007.1", "url": "https://www.ensembl.org/id/ENST00000640007.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000491709.1", "url": "https://www.ensembl.org/id/ENSP00000491709.1" } ] } }, { "isoform_ac": "A0A1W2PQ12-1", "url": "", "sequence": { "sequence": "QKKILDIANMLGLSNTVMRLIEKRAFQDKYFMIEPPKFLSQQESNKDLKRLDI", "length": 53, "header": "tr|A0A1W2PQ12-1|GOSR2_HUMAN Computationally mapped isoform of Golgi SNAP receptor complex member 2 OS=Homo sapiens OX=9606 GN=GOSR2 PE=1 SV=1 CANONICAL=O14653-1" }, "locus": { "chromosome": "17", "start_pos": 46955559, "end_pos": 46938605, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000640866.1", "url": "https://www.ensembl.org/id/ENST00000640866.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000491863.1", "url": "https://www.ensembl.org/id/ENSP00000491863.1" } ] } }, { "isoform_ac": "A0A1W2PQ38-1", "url": "", "sequence": { "sequence": "XIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYFMIEGLTLLPRLISNS", "length": 125, "header": "tr|A0A1W2PQ38-1|GOSR2_HUMAN Computationally mapped isoform of Golgi SNAP receptor complex member 2 OS=Homo sapiens OX=9606 GN=GOSR2 PE=1 SV=1 CANONICAL=O14653-1" }, "locus": { "chromosome": "17", "start_pos": 46964040, "end_pos": 46931111, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000638468.1", "url": "https://www.ensembl.org/id/ENST00000638468.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000491749.1", "url": "https://www.ensembl.org/id/ENSP00000491749.1" } ] } }, { "isoform_ac": "A0A1W2PQ77-1", "url": "", "sequence": { "sequence": "MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYFMIGGMLLTCVVMFLVVQYLT", "length": 164, "header": "tr|A0A1W2PQ77-1|GOSR2_HUMAN Computationally mapped isoform of Golgi SNAP receptor complex member 2 OS=Homo sapiens OX=9606 GN=GOSR2 PE=1 SV=1 CANONICAL=O14653-1" }, "locus": { "chromosome": "17", "start_pos": 46938757, "end_pos": 46923193, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000638634.1", "url": "https://www.ensembl.org/id/ENST00000638634.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000491946.1", "url": "https://www.ensembl.org/id/ENSP00000491946.1" } ] } }, { "isoform_ac": "A0A1W2PQE0-1", "url": "", "sequence": { "sequence": "MGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYFMIGGMLLTCVVMFLVVQYLT", "length": 147, "header": "tr|A0A1W2PQE0-1|GOSR2_HUMAN Computationally mapped isoform of Golgi SNAP receptor complex member 2 OS=Homo sapiens OX=9606 GN=GOSR2 PE=1 SV=1 CANONICAL=O14653-1" }, "locus": { "chromosome": "17", "start_pos": 46938757, "end_pos": 46929545, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000393456.7", "url": "https://www.ensembl.org/id/ENST00000393456.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000377101.3", "url": "https://www.ensembl.org/id/ENSP00000377101.3" } ] } }, { "isoform_ac": "A0A1W2PQM3-1", "url": "", "sequence": { "sequence": "MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDLILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYFMIEPPKFLSQQESNKDLKRLDI", "length": 214, "header": "tr|A0A1W2PQM3-1|GOSR2_HUMAN Computationally mapped isoform of Golgi SNAP receptor complex member 2 OS=Homo sapiens OX=9606 GN=GOSR2 PE=1 SV=1 CANONICAL=O14653-1" }, "locus": { "chromosome": "17", "start_pos": 46955559, "end_pos": 46923193, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000638189.1", "url": "https://www.ensembl.org/id/ENST00000638189.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000491785.1", "url": "https://www.ensembl.org/id/ENSP00000491785.1" } ] } }, { "isoform_ac": "A0A1W2PQP2-1", "url": "", "sequence": { "sequence": "XLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDLILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYFMIETRSHHVAQNGPELLSSRDPPASASRSAGIIGEETEAQRG", "length": 214, "header": "tr|A0A1W2PQP2-1|GOSR2_HUMAN Computationally mapped isoform of Golgi SNAP receptor complex member 2 OS=Homo sapiens OX=9606 GN=GOSR2 PE=1 SV=1 CANONICAL=O14653-1" }, "locus": { "chromosome": "17", "start_pos": 46975225, "end_pos": 46929552, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000640723.1", "url": "https://www.ensembl.org/id/ENST00000640723.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000492206.1", "url": "https://www.ensembl.org/id/ENSP00000492206.1" } ] } }, { "isoform_ac": "A0A1W2PQQ4-1", "url": "", "sequence": { "sequence": "RTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDLILDGHNILDGLRTQRLTLKGLLLPPRLECSGVILAYCSLELLGSSGSVTLASQVARTTGDSEEDP", "length": 99, "header": "tr|A0A1W2PQQ4-1|GOSR2_HUMAN Computationally mapped isoform of Golgi SNAP receptor complex member 2 OS=Homo sapiens OX=9606 GN=GOSR2 PE=1 SV=1 CANONICAL=O14653-1" }, "locus": { "chromosome": "17", "start_pos": 46938618, "end_pos": 46932182, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000640871.1", "url": "https://www.ensembl.org/id/ENST00000640871.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000492275.1", "url": "https://www.ensembl.org/id/ENSP00000492275.1" } ] } }, { "isoform_ac": "A0A1W2PQS3-1", "url": "", "sequence": { "sequence": "MDESLQFNSSLQKVHNGMDDLILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYFMIGGMLLTCVVMFLVVQYLT", "length": 93, "header": "tr|A0A1W2PQS3-1|GOSR2_HUMAN Computationally mapped isoform of Golgi SNAP receptor complex member 2 OS=Homo sapiens OX=9606 GN=GOSR2 PE=1 SV=1 CANONICAL=O14653-1" }, "locus": { "chromosome": "17", "start_pos": 46938757, "end_pos": 46935050, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000640495.1", "url": "https://www.ensembl.org/id/ENST00000640495.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000491859.1", "url": "https://www.ensembl.org/id/ENSP00000491859.1" } ] } }, { "isoform_ac": "A0A1W2PR02-1", "url": "", "sequence": { "sequence": "MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYFMIGGMLLTCVVMFLVVQYLT", "length": 165, "header": "tr|A0A1W2PR02-1|GOSR2_HUMAN Computationally mapped isoform of Golgi SNAP receptor complex member 2 OS=Homo sapiens OX=9606 GN=GOSR2 PE=1 SV=1 CANONICAL=O14653-1" }, "locus": { "chromosome": "17", "start_pos": 46938757, "end_pos": 46923193, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000640608.1", "url": "https://www.ensembl.org/id/ENST00000640608.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000491979.1", "url": "https://www.ensembl.org/id/ENSP00000491979.1" } ] } }, { "isoform_ac": "A0A1W2PR23-1", "url": "", "sequence": { "sequence": "MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYFMIAANRFLDF", "length": 155, "header": "tr|A0A1W2PR23-1|GOSR2_HUMAN Computationally mapped isoform of Golgi SNAP receptor complex member 2 OS=Homo sapiens OX=9606 GN=GOSR2 PE=1 SV=1 CANONICAL=O14653-1" }, "locus": { "chromosome": "17", "start_pos": 46964366, "end_pos": 46923193, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000639985.1", "url": "https://www.ensembl.org/id/ENST00000639985.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000492396.1", "url": "https://www.ensembl.org/id/ENSP00000492396.1" } ] } }, { "isoform_ac": "A0A1W2PRC2-1", "url": "", "sequence": { "sequence": "MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDLILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYFMIGGMLLTCVVMFLVVQYLT", "length": 211, "header": "tr|A0A1W2PRC2-1|GOSR2_HUMAN Computationally mapped isoform of Golgi SNAP receptor complex member 2 OS=Homo sapiens OX=9606 GN=GOSR2 PE=1 SV=1 CANONICAL=O14653-1" }, "locus": { "chromosome": "17", "start_pos": 46938757, "end_pos": 46923193, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000638838.1", "url": "https://www.ensembl.org/id/ENST00000638838.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000492524.1", "url": "https://www.ensembl.org/id/ENSP00000492524.1" } ] } }, { "isoform_ac": "A0A1W2PRD0-1", "url": "", "sequence": { "sequence": "MGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNVSQARGEGRPALDR", "length": 108, "header": "tr|A0A1W2PRD0-1|GOSR2_HUMAN Computationally mapped isoform of Golgi SNAP receptor complex member 2 OS=Homo sapiens OX=9606 GN=GOSR2 PE=1 SV=1 CANONICAL=O14653-1" }, "locus": { "chromosome": "17", "start_pos": 46932241, "end_pos": 46929545, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000571048.1", "url": "https://www.ensembl.org/id/ENST00000571048.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000492595.1", "url": "https://www.ensembl.org/id/ENSP00000492595.1" } ] } }, { "isoform_ac": "A0A1W2PRE6-1", "url": "", "sequence": { "sequence": "MGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDLILDGHNILDGLRTQRLTLKVGSLLGDREKASCFSLIQQFSNCVYILITCPQIVIF", "length": 177, "header": "tr|A0A1W2PRE6-1|GOSR2_HUMAN Computationally mapped isoform of Golgi SNAP receptor complex member 2 OS=Homo sapiens OX=9606 GN=GOSR2 PE=1 SV=1 CANONICAL=O14653-1" }, "locus": { "chromosome": "17", "start_pos": 46935277, "end_pos": 46929545, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000640269.1", "url": "https://www.ensembl.org/id/ENST00000640269.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000492146.1", "url": "https://www.ensembl.org/id/ENSP00000492146.1" } ] } }, { "isoform_ac": "A0A1W2PRH7-1", "url": "", "sequence": { "sequence": "MLGLSNTVMRLIEKRAFQDKYFMIGGMLLTCVVMFLVVQYLT", "length": 42, "header": "tr|A0A1W2PRH7-1|GOSR2_HUMAN Computationally mapped isoform of Golgi SNAP receptor complex member 2 OS=Homo sapiens OX=9606 GN=GOSR2 PE=1 SV=1 CANONICAL=O14653-1" }, "locus": { "chromosome": "17", "start_pos": 46938757, "end_pos": 46938632, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000638892.1", "url": "https://www.ensembl.org/id/ENST00000638892.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000492607.1", "url": "https://www.ensembl.org/id/ENSP00000492607.1" } ] } }, { "isoform_ac": "A0A1W2PRL0-1", "url": "", "sequence": { "sequence": "MGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDLILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYFMIGGMLLTCVVMFLVVQYLT", "length": 194, "header": "tr|A0A1W2PRL0-1|GOSR2_HUMAN Computationally mapped isoform of Golgi SNAP receptor complex member 2 OS=Homo sapiens OX=9606 GN=GOSR2 PE=1 SV=1 CANONICAL=O14653-1" }, "locus": { "chromosome": "17", "start_pos": 46938757, "end_pos": 46929545, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000640443.1", "url": "https://www.ensembl.org/id/ENST00000640443.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000492548.1", "url": "https://www.ensembl.org/id/ENSP00000492548.1" } ] } }, { "isoform_ac": "A0A1W2PRP7-1", "url": "", "sequence": { "sequence": "MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYFMIALLRCQGPSAGLLVIHKMDSETATARLSCPPGTQGSCQTAHFGGRSAGSS", "length": 197, "header": "tr|A0A1W2PRP7-1|GOSR2_HUMAN Computationally mapped isoform of Golgi SNAP receptor complex member 2 OS=Homo sapiens OX=9606 GN=GOSR2 PE=1 SV=1 CANONICAL=O14653-1" }, "locus": { "chromosome": "17", "start_pos": 46940610, "end_pos": 46923193, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000638697.1", "url": "https://www.ensembl.org/id/ENST00000638697.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000492360.1", "url": "https://www.ensembl.org/id/ENSP00000492360.1" } ] } }, { "isoform_ac": "A0A1W2PRV0-1", "url": "", "sequence": { "sequence": "MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDLILDGHNILDGLRTQRLTLKVGSLLGDREKASCFSLIQQGLRRRSLTLPTCWACPTQ", "length": 196, "header": "tr|A0A1W2PRV0-1|A0A1W2PRV0_HUMAN Computationally mapped isoform of Golgi SNAP receptor complex member 2 OS=Homo sapiens OX=9606 GN=GOSR2 PE=1 SV=1 CANONICAL=O14653-1" }, "locus": { "chromosome": "17", "start_pos": 46938653, "end_pos": 46923193, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000623037.2", "url": "https://www.ensembl.org/id/ENST00000623037.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000492669.1", "url": "https://www.ensembl.org/id/ENSP00000492669.1" } ] } }, { "isoform_ac": "A0A1W2PS12-1", "url": "", "sequence": { "sequence": "MGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDLILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYFMIENSILLCCPGWSAIAQ", "length": 192, "header": "tr|A0A1W2PS12-1|GOSR2_HUMAN Computationally mapped isoform of Golgi SNAP receptor complex member 2 OS=Homo sapiens OX=9606 GN=GOSR2 PE=1 SV=1 CANONICAL=O14653-1" }, "locus": { "chromosome": "17", "start_pos": 46963881, "end_pos": 46929545, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000639388.1", "url": "https://www.ensembl.org/id/ENST00000639388.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000492544.1", "url": "https://www.ensembl.org/id/ENSP00000492544.1" } ] } }, { "isoform_ac": "A0A1W2PS81-1", "url": "", "sequence": { "sequence": "MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDLILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYFMIDKEHMFLTRECALFPTHSHHWRSLSFGEVGTG", "length": 226, "header": "tr|A0A1W2PS81-1|GOSR2_HUMAN Computationally mapped isoform of Golgi SNAP receptor complex member 2 OS=Homo sapiens OX=9606 GN=GOSR2 PE=1 SV=1 CANONICAL=O14653-1" }, "locus": { "chromosome": "17", "start_pos": 46963791, "end_pos": 46923193, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000640792.1", "url": "https://www.ensembl.org/id/ENST00000640792.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000492736.1", "url": "https://www.ensembl.org/id/ENSP00000492736.1" } ] } }, { "isoform_ac": "A0A1X7SBU8-1", "url": "", "sequence": { "sequence": "MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDLILDGHNILDGLRTQRLTLKVGSLLGDREKASCFSLIQQFSNCVYILITCPQIVIF", "length": 194, "header": "tr|A0A1X7SBU8-1|GOSR2_HUMAN Computationally mapped isoform of Golgi SNAP receptor complex member 2 OS=Homo sapiens OX=9606 GN=GOSR2 PE=1 SV=1 CANONICAL=O14653-1" }, "locus": { "chromosome": "17", "start_pos": 46935277, "end_pos": 46923193, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000415811.7", "url": "https://www.ensembl.org/id/ENST00000415811.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000394559.3", "url": "https://www.ensembl.org/id/ENSP00000394559.3" } ] } }, { "isoform_ac": "I3L0K1-1", "url": "", "sequence": { "sequence": "MCLPHFVIHSSVDGHLSCFHHWAVENNTAMNSGVEVSVLVSLLNFLRQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDLILDGHNILDGLRTQRLTLKG", "length": 197, "header": "tr|I3L0K1-1|GOSR2_HUMAN Computationally mapped isoform of Golgi SNAP receptor complex member 2 OS=Homo sapiens OX=9606 GN=GOSR2 PE=1 SV=2 CANONICAL=O14653-1" }, "locus": { "chromosome": "17", "start_pos": 46938601, "end_pos": 46924329, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000570879.2", "url": "https://www.ensembl.org/id/ENST00000570879.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000458154.2", "url": "https://www.ensembl.org/id/ENSP00000458154.2" } ] } }, { "isoform_ac": "I3L1K7-1", "url": "", "sequence": { "sequence": "MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNVSQARGEGRPALDRSWGLEFRSLSAICFGGV", "length": 143, "header": "tr|I3L1K7-1|GOSR2_HUMAN Computationally mapped isoform of Golgi SNAP receptor complex member 2 OS=Homo sapiens OX=9606 GN=GOSR2 PE=1 SV=1 CANONICAL=O14653-1" }, "locus": { "chromosome": "17", "start_pos": 46932292, "end_pos": 46923193, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000575949.6", "url": "https://www.ensembl.org/id/ENST00000575949.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000458911.1", "url": "https://www.ensembl.org/id/ENSP00000458911.1" } ] } }, { "isoform_ac": "I3L4Z6-1", "url": "", "sequence": { "sequence": "MDPLFQQTHKQVHEIQSCMGRLETADKQSVHKNEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDLILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYFMIGGMLLTCVVMFLVVQYLT", "length": 210, "header": "tr|I3L4Z6-1|GOSR2_HUMAN Computationally mapped isoform of Golgi SNAP receptor complex member 2 OS=Homo sapiens OX=9606 GN=GOSR2 PE=1 SV=2 CANONICAL=O14653-1" }, "locus": { "chromosome": "17", "start_pos": 46938757, "end_pos": 46923193, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000576910.7", "url": "https://www.ensembl.org/id/ENST00000576910.7" }, { "database": "Ensembl Peptide", "id": "ENSP00000461673.2", "url": "https://www.ensembl.org/id/ENSP00000461673.2" } ] } }, { "isoform_ac": "I3NI02-1", "url": "", "sequence": { "sequence": "MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDLILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYFMIETRSHHVAQNGPELLSSRDPPASASRSAGIIGMSHHPDLQIPFELRLGFELWFYQLLAVISDQ", "length": 257, "header": "tr|I3NI02-1|GOSR2_HUMAN Computationally mapped isoform of Golgi SNAP receptor complex member 2 OS=Homo sapiens OX=9606 GN=GOSR2 PE=1 SV=2 CANONICAL=O14653-1" }, "locus": { "chromosome": "17", "start_pos": 46966721, "end_pos": 46923193, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000573224.2", "url": "https://www.ensembl.org/id/ENST00000573224.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000461784.2", "url": "https://www.ensembl.org/id/ENSP00000461784.2" } ] } }, { "isoform_ac": "O14653-1", "url": "", "sequence": { "sequence": "MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDLILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYFMIGGMLLTCVVMFLVVQYLT", "length": 212, "header": "sp|O14653-1|GOSR2_HUMAN Isoform 1 of Golgi SNAP receptor complex member 2 OS=Homo sapiens OX=9606 GN=GOSR2 PE=1 SV=2 CANONICAL=O14653-1" }, "locus": { "chromosome": "17", "start_pos": 46938757, "end_pos": 46923193, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000640051.2", "url": "https://www.ensembl.org/id/ENST00000640051.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000492751.1", "url": "https://www.ensembl.org/id/ENSP00000492751.1" } ] } }, { "isoform_ac": "O14653-2", "url": "", "sequence": { "sequence": "MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDLILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYFMIGTQGSCQTAHFGGRSAGSS", "length": 213, "header": "sp|O14653-2|GOSR2_HUMAN Isoform 2 of Golgi SNAP receptor complex member 2 OS=Homo sapiens OX=9606 GN=GOSR2 PE=1 SV=2 CANONICAL=O14653-1" }, "locus": { "chromosome": "17", "start_pos": 46940610, "end_pos": 46923193, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000225567.9", "url": "https://www.ensembl.org/id/ENST00000225567.9" }, { "database": "Ensembl Peptide", "id": "ENSP00000225567.4", "url": "https://www.ensembl.org/id/ENSP00000225567.4" } ] } }, { "isoform_ac": "O14653-3", "url": "", "sequence": { "sequence": "MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDLILDGHNILDGLRTQRLTLKVGSLLGDREKASCFSLIQQFSNCVYILITCPQIVIF", "length": 195, "header": "sp|O14653-3|GOSR2_HUMAN Isoform 3 of Golgi SNAP receptor complex member 2 OS=Homo sapiens OX=9606 GN=GOSR2 PE=1 SV=2 CANONICAL=O14653-1" }, "locus": { "chromosome": "17", "start_pos": 46935277, "end_pos": 46923193, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000640621.1", "url": "https://www.ensembl.org/id/ENST00000640621.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000492830.1", "url": "https://www.ensembl.org/id/ENSP00000492830.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Coupling of coat assembly and vesicle budding to packaging of putative cargo receptors.", "journal": "Cell", "date": "1999", "authors": "Bremser M, Nickel W, Schweikert M, Ravazzola M, Amherdt M, Hughes CA, Sollner TH, Rothman JE, Wieland FT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "10052452", "url": "https://glygen.org/publication/PubMed/10052452" } ] }, { "title": "GMAP-210, A cis-Golgi network-associated protein, is a minus end microtubule-binding protein.", "journal": "The Journal of cell biology", "date": "1999", "authors": "Infante C, Ramos-Morales F, Fedriani C, Bornens M, Rios RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "10189370", "url": "https://glygen.org/publication/PubMed/10189370" } ] }, { "title": "cDNA characterization and chromosomal mapping of human Golgi SNARE GS27 and GS28 to chromosome 17.", "journal": "Genomics", "date": "1999", "authors": "Bui TD, Levy ER, Subramaniam VN, Lowe SL, Hong W", "evidence": [ { "database": "UniProtKB", "id": "O14653", "url": "https://www.uniprot.org/uniprot/O14653" } ], "reference": [ { "type": "PubMed", "id": "10198168", "url": "https://glygen.org/publication/PubMed/10198168" } ] }, { "title": "GTP-dependent binding of ADP-ribosylation factor to coatomer in close proximity to the binding site for dilysine retrieval motifs and p23.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Zhao L, Helms JB, Brunner J, Wieland FT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "10318838", "url": "https://glygen.org/publication/PubMed/10318838" } ] }, { "title": "NSF N-terminal domain crystal structure: models of NSF function.", "journal": "Molecular cell", "date": "1999", "authors": "Yu RC, Jahn R, Brunger AT", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "10445031", "url": "https://glygen.org/publication/PubMed/10445031" } ] }, { "title": "The lectin ERGIC-53 is a cargo transport receptor for glycoproteins.", "journal": "Nature cell biology", "date": "1999", "authors": "Appenzeller C, Andersson H, Kappeler F, Hauri HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "10559958", "url": "https://glygen.org/publication/PubMed/10559958" } ] }, { "title": "An NSF function distinct from ATPase-dependent SNARE disassembly is essential for Golgi membrane fusion.", "journal": "Nature cell biology", "date": "1999", "authors": "Muller JM, Rabouille C, Newman R, Shorter J, Freemont P, Schiavo G, Warren G, Shima DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "10559959", "url": "https://glygen.org/publication/PubMed/10559959" } ] }, { "title": "Stress-associated endoplasmic reticulum protein 1 (SERP1)/Ribosome-associated membrane protein 4 (RAMP4) stabilizes membrane proteins during stress and facilitates subsequent glycosylation.", "journal": "The Journal of cell biology", "date": "1999", "authors": "Yamaguchi A, Hori O, Stern DM, Hartmann E, Ogawa S, Tohyama M", "evidence": [ { "database": "Reactome", "id": "R-HSA-381038", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381038" } ], "reference": [ { "type": "PubMed", "id": "10601334", "url": "https://glygen.org/publication/PubMed/10601334" } ] }, { "title": "ERGIC-53 and traffic in the secretory pathway.", "journal": "Journal of cell science", "date": "2000", "authors": "Hauri HP, Kappeler F, Andersson H, Appenzeller C", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "10652252", "url": "https://glygen.org/publication/PubMed/10652252" } ] }, { "title": "Similarities in function and gene structure of cytohesin-4 and cytohesin-1, guanine nucleotide-exchange proteins for ADP-ribosylation factors.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Ogasawara M, Kim SC, Adamik R, Togawa A, Ferrans VJ, Takeda K, Kirby M, Moss J, Vaughan M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "10652308", "url": "https://glygen.org/publication/PubMed/10652308" } ] }, { "title": "Turning on ARF: the Sec7 family of guanine-nucleotide-exchange factors.", "journal": "Trends in cell biology", "date": "2000", "authors": "Jackson CL, Casanova JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "10652516", "url": "https://glygen.org/publication/PubMed/10652516" } ] }, { "title": "The role of the tethering proteins p115 and GM130 in transport through the Golgi apparatus in vivo.", "journal": "Molecular biology of the cell", "date": "2000", "authors": "Seemann J, Jokitalo EJ, Warren G", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "10679020", "url": "https://glygen.org/publication/PubMed/10679020" } ] }, { "title": "Asymmetric requirements for a Rab GTPase and SNARE proteins in fusion of COPII vesicles with acceptor membranes.", "journal": "The Journal of cell biology", "date": "2000", "authors": "Cao X, Barlowe C", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "10747087", "url": "https://glygen.org/publication/PubMed/10747087" } ] }, { "title": "Decoding of sorting signals by coatomer through a GTPase switch in the COPI coat complex.", "journal": "Cell", "date": "2000", "authors": "Goldberg J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "10761932", "url": "https://glygen.org/publication/PubMed/10761932" } ] }, { "title": "COPI-coated ER-to-Golgi transport complexes segregate from COPII in close proximity to ER exit sites.", "journal": "Journal of cell science", "date": "2000", "authors": "Stephens DJ, Lin-Marq N, Pagano A, Pepperkok R, Paccaud JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "10825291", "url": "https://glygen.org/publication/PubMed/10825291" } ] }, { "title": "HEDJ, an Hsp40 co-chaperone localized to the endoplasmic reticulum of human cells.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Yu M, Haslam RH, Haslam DB", "evidence": [ { "database": "Reactome", "id": "R-HSA-381038", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381038" } ], "reference": [ { "type": "PubMed", "id": "10827079", "url": "https://glygen.org/publication/PubMed/10827079" } ] }, { "title": "Rab1 recruitment of p115 into a cis-SNARE complex: programming budding COPII vesicles for fusion.", "journal": "Science (New York, N.Y.)", "date": "2000", "authors": "Allan BB, Moyer BD, Balch WE", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "10903204", "url": "https://glygen.org/publication/PubMed/10903204" } ] }, { "title": "COP I domains required for coatomer integrity, and novel interactions with ARF and ARF-GAP.", "journal": "The EMBO journal", "date": "2000", "authors": "Eugster A, Frigerio G, Dale M, Duden R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "10921873", "url": "https://glygen.org/publication/PubMed/10921873" } ] }, { "title": "Dynamics of transitional endoplasmic reticulum sites in vertebrate cells.", "journal": "Molecular biology of the cell", "date": "2000", "authors": "Hammond AT, Glick BS", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "10982397", "url": "https://glygen.org/publication/PubMed/10982397" } ] }, { "title": "Subunit structure of a mammalian ER/Golgi SNARE complex.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Xu D, Joglekar AP, Williams AL, Hay JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "11035026", "url": "https://glygen.org/publication/PubMed/11035026" } ] }, { "title": "The p115-interactive proteins GM130 and giantin participate in endoplasmic reticulum-Golgi traffic.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Alvarez C, Garcia-Mata R, Hauri HP, Sztul E", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "11035033", "url": "https://glygen.org/publication/PubMed/11035033" } ] }, { "title": "Functional characterization of novel human ARFGAP3.", "journal": "FEBS letters", "date": "2001", "authors": "Liu X, Zhang C, Xing G, Chen Q, He F", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "11172815", "url": "https://glygen.org/publication/PubMed/11172815" } ] }, { "title": "Rab1 interaction with a GM130 effector complex regulates COPII vesicle cis--Golgi tethering.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2001", "authors": "Moyer BD, Allan BB, Balch WE", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "11285137", "url": "https://glygen.org/publication/PubMed/11285137" } ] }, { "title": "The Golgi matrix protein GM130: a specific interacting partner of the small GTPase rab1b.", "journal": "EMBO reports", "date": "2001", "authors": "Weide T, Bayer M, Koster M, Siebrasse JP, Peters R, Barnekow A", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "11306556", "url": "https://glygen.org/publication/PubMed/11306556" } ] }, { "title": "beta III spectrin binds to the Arp1 subunit of dynactin.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Holleran EA, Ligon LA, Tokito M, Stankewich MC, Morrow JS, Holzbaur EL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "11461920", "url": "https://glygen.org/publication/PubMed/11461920" } ] }, { "title": "Chimaerins, novel non-protein kinase C phorbol ester receptors, associate with Tmp21-I (p23): evidence for a novel anchoring mechanism involving the chimaerin C1 domain.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Wang H, Kazanietz MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "11689559", "url": "https://glygen.org/publication/PubMed/11689559" } ] }, { "title": "KDEL-cargo regulates interactions between proteins involved in COPI vesicle traffic: measurements in living cells using FRET.", "journal": "Developmental cell", "date": "2001", "authors": "Majoul I, Straub M, Hell SW, Duden R, Soling HD", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "11703931", "url": "https://glygen.org/publication/PubMed/11703931" } ] }, { "title": "Identification of rabaptin-5, rabex-5, and GM130 as putative effectors of rab33b, a regulator of retrograde traffic between the Golgi apparatus and ER.", "journal": "FEBS letters", "date": "2001", "authors": "Valsdottir R, Hashimoto H, Ashman K, Koda T, Storrie B, Nilsson T", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "11718716", "url": "https://glygen.org/publication/PubMed/11718716" } ] }, { "title": "Recruitment to Golgi membranes of ADP-ribosylation factor 1 is mediated by the cytoplasmic domain of p23.", "journal": "The EMBO journal", "date": "2001", "authors": "Gommel DU, Memon AR, Heiss A, Lottspeich F, Pfannstiel J, Lechner J, Reinhard C, Helms JB, Nickel W, Wieland FT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "11726511", "url": "https://glygen.org/publication/PubMed/11726511" } ] }, { "title": "Sorting of Golgi resident proteins into different subpopulations of COPI vesicles: a role for ArfGAP1.", "journal": "The Journal of cell biology", "date": "2001", "authors": "Lanoix J, Ouwendijk J, Stark A, Szafer E, Cassel D, Dejgaard K, Weiss M, Nilsson T", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "11748249", "url": "https://glygen.org/publication/PubMed/11748249" } ] }, { "title": "Sequential tethering of Golgins and catalysis of SNAREpin assembly by the vesicle-tethering protein p115.", "journal": "The Journal of cell biology", "date": "2002", "authors": "Shorter J, Beard MB, Seemann J, Dirac-Svejstrup AB, Warren G", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "11927603", "url": "https://glygen.org/publication/PubMed/11927603" } ] }, { "title": "The Sec34/Sec35p complex, a Ypt1p effector required for retrograde intra-Golgi trafficking, interacts with Golgi SNAREs and COPI vesicle coat proteins.", "journal": "The Journal of cell biology", "date": "2002", "authors": "Suvorova ES, Duden R, Lupashin VV", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "12011112", "url": "https://glygen.org/publication/PubMed/12011112" } ] }, { "title": "GBF1, a guanine nucleotide exchange factor for ADP-ribosylation factors, is localized to the cis-Golgi and involved in membrane association of the COPI coat.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2002", "authors": "Kawamoto K, Yoshida Y, Tamaki H, Torii S, Shinotsuka C, Yamashina S, Nakayama K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "12047556", "url": "https://glygen.org/publication/PubMed/12047556" } ] }, { "title": "Sequential SNARE disassembly and GATE-16-GOS-28 complex assembly mediated by distinct NSF activities drives Golgi membrane fusion.", "journal": "The Journal of cell biology", "date": "2002", "authors": "Muller JM, Shorter J, Newman R, Deinhardt K, Sagiv Y, Elazar Z, Warren G, Shima DT", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "12070132", "url": "https://glygen.org/publication/PubMed/12070132" } ] }, { "title": "Functional analysis of human P5, a protein disulfide isomerase homologue.", "journal": "Journal of biochemistry", "date": "2002", "authors": "Kikuchi M, Doi E, Tsujimoto I, Horibe T, Tsujimoto Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-381038", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381038" } ], "reference": [ { "type": "PubMed", "id": "12204115", "url": "https://glygen.org/publication/PubMed/12204115" } ] }, { "title": "Sec16p potentiates the action of COPII proteins to bud transport vesicles.", "journal": "The Journal of cell biology", "date": "2002", "authors": "Supek F, Madden DT, Hamamoto S, Orci L, Schekman R", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "12235121", "url": "https://glygen.org/publication/PubMed/12235121" } ] }, { "title": "Oligomeric state and stoichiometry of p24 proteins in the early secretory pathway.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Jenne N, Frey K, Brugger B, Wieland FT", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "12237308", "url": "https://glygen.org/publication/PubMed/12237308" } ] }, { "title": "The overexpression of GMAP-210 blocks anterograde and retrograde transport between the ER and the Golgi apparatus.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2002", "authors": "Pernet-Gallay K, Antony C, Johannes L, Bornens M, Goud B, Rios RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "12383348", "url": "https://glygen.org/publication/PubMed/12383348" } ] }, { "title": "GS15 forms a SNARE complex with syntaxin 5, GS28, and Ykt6 and is implicated in traffic in the early cisternae of the Golgi apparatus.", "journal": "Molecular biology of the cell", "date": "2002", "authors": "Xu Y, Martin S, James DE, Hong W", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "12388752", "url": "https://glygen.org/publication/PubMed/12388752" } ] }, { "title": "CASP, the alternatively spliced product of the gene encoding the CCAAT-displacement protein transcription factor, is a Golgi membrane protein related to giantin.", "journal": "Molecular biology of the cell", "date": "2002", "authors": "Gillingham AK, Pfeifer AC, Munro S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "12429822", "url": "https://glygen.org/publication/PubMed/12429822" } ] }, { "title": "The membrane-tethering protein p115 interacts with GBF1, an ARF guanine-nucleotide-exchange factor.", "journal": "EMBO reports", "date": "2003", "authors": "Garcia-Mata R, Sztul E", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "12634853", "url": "https://glygen.org/publication/PubMed/12634853" } ] }, { "title": "Lipid packing sensed by ArfGAP1 couples COPI coat disassembly to membrane bilayer curvature.", "journal": "Nature", "date": "2003", "authors": "Bigay J, Gounon P, Robineau S, Antonny B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "14654841", "url": "https://glygen.org/publication/PubMed/14654841" } ] }, { "title": "Countercurrent distribution of two distinct SNARE complexes mediating transport within the Golgi stack.", "journal": "Molecular biology of the cell", "date": "2004", "authors": "Volchuk A, Ravazzola M, Perrelet A, Eng WS, Di Liberto M, Varlamov O, Fukasawa M, Engel T, Sollner TH, Rothman JE, Orci L", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "14742712", "url": "https://glygen.org/publication/PubMed/14742712" } ] }, { "title": "Multiple binding proteins suggest diverse functions for the N-ethylmaleimide sensitive factor.", "journal": "Journal of structural biology", "date": "2004", "authors": "Whiteheart SW, Matveeva EA", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "15037235", "url": "https://glygen.org/publication/PubMed/15037235" } ] }, { "title": "A role for the thiol isomerase protein ERP5 in platelet function.", "journal": "Blood", "date": "2005", "authors": "Jordan PA, Stevens JM, Hubbard GP, Barrett NE, Sage T, Authi KS, Gibbins JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381038", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381038" } ], "reference": [ { "type": "PubMed", "id": "15466936", "url": "https://glygen.org/publication/PubMed/15466936" } ] }, { "title": "The GTPase Arf1p and the ER to Golgi cargo receptor Erv14p cooperate to recruit the golgin Rud3p to the cis-Golgi.", "journal": "The Journal of cell biology", "date": "2004", "authors": "Gillingham AK, Tong AH, Boone C, Munro S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "15504911", "url": "https://glygen.org/publication/PubMed/15504911" } ] }, { "title": "Dynamics of GBF1, a Brefeldin A-sensitive Arf1 exchange factor at the Golgi.", "journal": "Molecular biology of the cell", "date": "2005", "authors": "Niu TK, Pfeifer AC, Lippincott-Schwartz J, Jackson CL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "15616190", "url": "https://glygen.org/publication/PubMed/15616190" } ] }, { "title": "Live imaging of bidirectional traffic from the ERGIC.", "journal": "Journal of cell science", "date": "2005", "authors": "Ben-Tekaya H, Miura K, Pepperkok R, Hauri HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "15632110", "url": "https://glygen.org/publication/PubMed/15632110" } ] }, { "title": "Golgin tethers define subpopulations of COPI vesicles.", "journal": "Science (New York, N.Y.)", "date": "2005", "authors": "Malsam J, Satoh A, Pelletier L, Warren G", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "15718469", "url": "https://glygen.org/publication/PubMed/15718469" } ] }, { "title": "Cog3p depletion blocks vesicle-mediated Golgi retrograde trafficking in HeLa cells.", "journal": "The Journal of cell biology", "date": "2005", "authors": "Zolov SN, Lupashin VV", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "15728195", "url": "https://glygen.org/publication/PubMed/15728195" } ] }, { "title": "Cisternal rab proteins regulate Golgi apparatus redistribution in response to hypotonic stress.", "journal": "Molecular biology of the cell", "date": "2005", "authors": "Jiang S, Storrie B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "15758030", "url": "https://glygen.org/publication/PubMed/15758030" } ] }, { "title": "Dissection of membrane dynamics of the ARF-guanine nucleotide exchange factor GBF1.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2005", "authors": "Szul T, Garcia-Mata R, Brandon E, Shestopal S, Alvarez C, Sztul E", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "15813748", "url": "https://glygen.org/publication/PubMed/15813748" } ] }, { "title": "A cryptic Rab1-binding site in the p115 tethering protein.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Beard M, Satoh A, Shorter J, Warren G", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "15878873", "url": "https://glygen.org/publication/PubMed/15878873" } ] }, { "title": "Isoform-selective effects of the depletion of ADP-ribosylation factors 1-5 on membrane traffic.", "journal": "Molecular biology of the cell", "date": "2005", "authors": "Volpicelli-Daley LA, Li Y, Zhang CJ, Kahn RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "16030262", "url": "https://glygen.org/publication/PubMed/16030262" } ] }, { "title": "Sugar-binding properties of VIP36, an intracellular animal lectin operating as a cargo receptor.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Kamiya Y, Yamaguchi Y, Takahashi N, Arata Y, Kasai K, Ihara Y, Matsuo I, Ito Y, Yamamoto K, Kato K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "16129679", "url": "https://glygen.org/publication/PubMed/16129679" } ] }, { "title": "Cysteine-disulfide cross-linking to monitor SNARE complex assembly during endoplasmic reticulum-Golgi transport.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Flanagan JJ, Barlowe C", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "16303754", "url": "https://glygen.org/publication/PubMed/16303754" } ] }, { "title": "ADP-ribosylation factor, a small GTP-binding protein, is required for binding of the coatomer protein beta-COP to Golgi membranes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1992", "authors": "Donaldson JG, Cassel D, Kahn RA, Klausner RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "1631136", "url": "https://glygen.org/publication/PubMed/1631136" } ] }, { "title": "pXBP1(U) encoded in XBP1 pre-mRNA negatively regulates unfolded protein response activator pXBP1(S) in mammalian ER stress response.", "journal": "The Journal of cell biology", "date": "2006", "authors": "Yoshida H, Oku M, Suzuki M, Mori K", "evidence": [ { "database": "Reactome", "id": "R-HSA-381038", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381038" } ], "reference": [ { "type": "PubMed", "id": "16461360", "url": "https://glygen.org/publication/PubMed/16461360" } ] }, { "title": "XBP1 induces WFS1 through an endoplasmic reticulum stress response element-like motif in SH-SY5Y cells.", "journal": "Journal of neurochemistry", "date": "2006", "authors": "Kakiuchi C, Ishiwata M, Hayashi A, Kato T", "evidence": [ { "database": "Reactome", "id": "R-HSA-381038", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381038" } ], "reference": [ { "type": "PubMed", "id": "16539657", "url": "https://glygen.org/publication/PubMed/16539657" } ] }, { "title": "On and off membrane dynamics of the endoplasmic reticulum-golgi tethering factor p115 in vivo.", "journal": "Molecular biology of the cell", "date": "2006", "authors": "Brandon E, Szul T, Alvarez C, Grabski R, Benjamin R, Kawai R, Sztul E", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "16624868", "url": "https://glygen.org/publication/PubMed/16624868" } ] }, { "title": "ARF proteins: roles in membrane traffic and beyond.", "journal": "Nature reviews. Molecular cell biology", "date": "2006", "authors": "D'Souza-Schorey C, Chavrier P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "16633337", "url": "https://glygen.org/publication/PubMed/16633337" } ] }, { "title": "The ER-Golgi intermediate compartment (ERGIC): in search of its identity and function.", "journal": "Journal of cell science", "date": "2006", "authors": "Appenzeller-Herzog C, Hauri HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "16723730", "url": "https://glygen.org/publication/PubMed/16723730" } ] }, { "title": "ADP-ribosylation factor is a subunit of the coat of Golgi-derived COP-coated vesicles: a novel role for a GTP-binding protein.", "journal": "Cell", "date": "1991", "authors": "Serafini T, Orci L, Amherdt M, Brunner M, Kahn RA, Rothman JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "1680566", "url": "https://glygen.org/publication/PubMed/1680566" } ] }, { "title": "SNAREs--engines for membrane fusion.", "journal": "Nature reviews. Molecular cell biology", "date": "2006", "authors": "Jahn R, Scheller RH", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "16912714", "url": "https://glygen.org/publication/PubMed/16912714" } ] }, { "title": "GBF1, a cis-Golgi and VTCs-localized ARF-GEF, is implicated in ER-to-Golgi protein traffic.", "journal": "Journal of cell science", "date": "2006", "authors": "Zhao X, Claude A, Chun J, Shields DJ, Presley JF, Melancon P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "16926190", "url": "https://glygen.org/publication/PubMed/16926190" } ] }, { "title": "Coatomer, the coat protein of COPI transport vesicles, discriminates endoplasmic reticulum residents from p24 proteins.", "journal": "Molecular and cellular biology", "date": "2006", "authors": "Bethune J, Kol M, Hoffmann J, Reckmann I, Brugger B, Wieland F", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "16940185", "url": "https://glygen.org/publication/PubMed/16940185" } ] }, { "title": "Sec16 defines endoplasmic reticulum exit sites and is required for secretory cargo export in mammalian cells.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2006", "authors": "Watson P, Townley AK, Koka P, Palmer KJ, Stephens DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "17005010", "url": "https://glygen.org/publication/PubMed/17005010" } ] }, { "title": "Cargo selectivity of the ERGIC-53/MCFD2 transport receptor complex.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2006", "authors": "Nyfeler B, Zhang B, Ginsburg D, Kaufman RJ, Hauri HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "17010120", "url": "https://glygen.org/publication/PubMed/17010120" } ] }, { "title": "SNARE status regulates tether recruitment and function in homotypic COPII vesicle fusion.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Bentley M, Liang Y, Mullen K, Xu D, Sztul E, Hay JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "17038314", "url": "https://glygen.org/publication/PubMed/17038314" } ] }, { "title": "Two mammalian Sec16 homologues have nonredundant functions in endoplasmic reticulum (ER) export and transitional ER organization.", "journal": "Molecular biology of the cell", "date": "2007", "authors": "Bhattacharyya D, Glick BS", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "17192411", "url": "https://glygen.org/publication/PubMed/17192411" } ] }, { "title": "Two lipid-packing sensor motifs contribute to the sensitivity of ArfGAP1 to membrane curvature.", "journal": "Biochemistry", "date": "2007", "authors": "Mesmin B, Drin G, Levi S, Rawet M, Cassel D, Bigay J, Antonny B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "17253781", "url": "https://glygen.org/publication/PubMed/17253781" } ] }, { "title": "The interaction of two tethering factors, p115 and COG complex, is required for Golgi integrity.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2007", "authors": "Sohda M, Misumi Y, Yoshimura S, Nakamura N, Fusano T, Ogata S, Sakisaka S, Ikehara Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "17274799", "url": "https://glygen.org/publication/PubMed/17274799" } ] }, { "title": "TRAPPI tethers COPII vesicles by binding the coat subunit Sec23.", "journal": "Nature", "date": "2007", "authors": "Cai H, Yu S, Menon S, Cai Y, Lazarova D, Fu C, Reinisch K, Hay JC, Ferro-Novick S", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "17287728", "url": "https://glygen.org/publication/PubMed/17287728" } ] }, { "title": "Mechanisms of COPII vesicle formation and protein sorting.", "journal": "FEBS letters", "date": "2007", "authors": "Sato K, Nakano A", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "17316621", "url": "https://glygen.org/publication/PubMed/17316621" } ] }, { "title": "Differential localization of coatomer complex isoforms within the Golgi apparatus.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Moelleken J, Malsam J, Betts MJ, Movafeghi A, Reckmann I, Meissner I, Hellwig A, Russell RB, Sollner T, Brugger B, Wieland FT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "17360540", "url": "https://glygen.org/publication/PubMed/17360540" } ] }, { "title": "Rab1b interacts with GBF1 and modulates both ARF1 dynamics and COPI association.", "journal": "Molecular biology of the cell", "date": "2007", "authors": "Monetta P, Slavin I, Romero N, Alvarez C", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "17429068", "url": "https://glygen.org/publication/PubMed/17429068" } ] }, { "title": "Multiple and stepwise interactions between coatomer and ADP-ribosylation factor-1 (Arf1)-GTP.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2007", "authors": "Sun Z, Anderl F, Frohlich K, Zhao L, Hanke S, Brugger B, Wieland F, Bethune J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "17451557", "url": "https://glygen.org/publication/PubMed/17451557" } ] }, { "title": "The transport signal on Sec22 for packaging into COPII-coated vesicles is a conformational epitope.", "journal": "Molecular cell", "date": "2007", "authors": "Mancias JD, Goldberg J", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "17499046", "url": "https://glygen.org/publication/PubMed/17499046" } ] }, { "title": "Specific Rab GTPase-activating proteins define the Shiga toxin and epidermal growth factor uptake pathways.", "journal": "The Journal of cell biology", "date": "2007", "authors": "Fuchs E, Haas AK, Spooner RA, Yoshimura S, Lord JM, Barr FA", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "17562788", "url": "https://glygen.org/publication/PubMed/17562788" } ] }, { "title": "Cornichon regulates transport and secretion of TGFalpha-related proteins in metazoan cells.", "journal": "Journal of cell science", "date": "2007", "authors": "Castro CP, Piscopo D, Nakagawa T, Derynck R", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "17607000", "url": "https://glygen.org/publication/PubMed/17607000" } ] }, { "title": "Analysis of GTPase-activating proteins: Rab1 and Rab43 are key Rabs required to maintain a functional Golgi complex in human cells.", "journal": "Journal of cell science", "date": "2007", "authors": "Haas AK, Yoshimura S, Stephens DJ, Preisinger C, Fuchs E, Barr FA", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "17684057", "url": "https://glygen.org/publication/PubMed/17684057" } ] }, { "title": "Two human ARFGAPs associated with COP-I-coated vesicles.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2007", "authors": "Frigerio G, Grimsey N, Dale M, Majoul I, Duden R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "17760859", "url": "https://glygen.org/publication/PubMed/17760859" } ] }, { "title": "Mammalian GPI-anchored proteins require p24 proteins for their efficient transport from the ER to the plasma membrane.", "journal": "The Biochemical journal", "date": "2008", "authors": "Takida S, Maeda Y, Kinoshita T", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "17927562", "url": "https://glygen.org/publication/PubMed/17927562" } ] }, { "title": "Dissecting the role of the ARF guanine nucleotide exchange factor GBF1 in Golgi biogenesis and protein trafficking.", "journal": "Journal of cell science", "date": "2007", "authors": "Szul T, Grabski R, Lyons S, Morohashi Y, Shestopal S, Lowe M, Sztul E", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "17956946", "url": "https://glygen.org/publication/PubMed/17956946" } ] }, { "title": "Molecular basis of sugar recognition by the human L-type lectins ERGIC-53, VIPL, and VIP36.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Kamiya Y, Kamiya D, Yamamoto K, Nyfeler B, Hauri HP, Kato K", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "18025080", "url": "https://glygen.org/publication/PubMed/18025080" } ] }, { "title": "Interaction of the conserved oligomeric Golgi complex with t-SNARE Syntaxin5a/Sed5 enhances intra-Golgi SNARE complex stability.", "journal": "The Journal of cell biology", "date": "2007", "authors": "Shestakova A, Suvorova E, Pavliv O, Khaidakova G, Lupashin V", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "18086915", "url": "https://glygen.org/publication/PubMed/18086915" } ] }, { "title": "A conformational change in the alpha-subunit of coatomer induced by ligand binding to gamma-COP revealed by single-pair FRET.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2008", "authors": "Langer JD, Roth CM, Bethune J, Stoops EH, Brugger B, Herten DP, Wieland FT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "18182008", "url": "https://glygen.org/publication/PubMed/18182008" } ] }, { "title": "Large scale screening for novel rab effectors reveals unexpected broad Rab binding specificity.", "journal": "Molecular & cellular proteomics : MCP", "date": "2008", "authors": "Fukuda M, Kanno E, Ishibashi K, Itoh T", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "18256213", "url": "https://glygen.org/publication/PubMed/18256213" } ] }, { "title": "Identification of ERGIC-53 as an intracellular transport receptor of alpha1-antitrypsin.", "journal": "The Journal of cell biology", "date": "2008", "authors": "Nyfeler B, Reiterer V, Wendeler MW, Stefan E, Zhang B, Michnick SW, Hauri HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "18283111", "url": "https://glygen.org/publication/PubMed/18283111" } ] }, { "title": "The yeast p24 complex is required for the formation of COPI retrograde transport vesicles from the Golgi apparatus.", "journal": "The Journal of cell biology", "date": "2008", "authors": "Aguilera-Romero A, Kaminska J, Spang A, Riezman H, Muniz M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "18283113", "url": "https://glygen.org/publication/PubMed/18283113" } ] }, { "title": "The cargo receptors Surf4, endoplasmic reticulum-Golgi intermediate compartment (ERGIC)-53, and p25 are required to maintain the architecture of ERGIC and Golgi.", "journal": "Molecular biology of the cell", "date": "2008", "authors": "Mitrovic S, Ben-Tekaya H, Koegler E, Gruenberg J, Hauri HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "18287528", "url": "https://glygen.org/publication/PubMed/18287528" } ] }, { "title": "Asymmetric tethering of flat and curved lipid membranes by a golgin.", "journal": "Science (New York, N.Y.)", "date": "2008", "authors": "Drin G, Morello V, Casella JF, Gounon P, Antonny B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "18451304", "url": "https://glygen.org/publication/PubMed/18451304" } ] }, { "title": "Characterization of class I and II ADP-ribosylation factors (Arfs) in live cells: GDP-bound class II Arfs associate with the ER-Golgi intermediate compartment independently of GBF1.", "journal": "Molecular biology of the cell", "date": "2008", "authors": "Chun J, Shapovalova Z, Dejgaard SY, Presley JF, Melancon P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "18524849", "url": "https://glygen.org/publication/PubMed/18524849" } ] }, { "title": "Human HRD1 promoter carries a functional unfolded protein response element to which XBP1 but not ATF6 directly binds.", "journal": "Journal of biochemistry", "date": "2008", "authors": "Yamamoto K, Suzuki N, Wada T, Okada T, Yoshida H, Kaufman RJ, Mori K", "evidence": [ { "database": "Reactome", "id": "R-HSA-381038", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381038" } ], "reference": [ { "type": "PubMed", "id": "18664523", "url": "https://glygen.org/publication/PubMed/18664523" } ] }, { "title": "Consensus nomenclature for the human ArfGAP domain-containing proteins.", "journal": "The Journal of cell biology", "date": "2008", "authors": "Kahn RA, Bruford E, Inoue H, Logsdon JM Jr, Nie Z, Premont RT, Randazzo PA, Satake M, Theibert AB, Zapp ML, Cassel D", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "18809720", "url": "https://glygen.org/publication/PubMed/18809720" } ] }, { "title": "Structural basis of cargo membrane protein discrimination by the human COPII coat machinery.", "journal": "The EMBO journal", "date": "2008", "authors": "Mancias JD, Goldberg J", "evidence": [ { "database": "UniProtKB", "id": "O14653", "url": "https://www.uniprot.org/uniprot/O14653" }, { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "18843296", "url": "https://glygen.org/publication/PubMed/18843296" } ] }, { "title": "'Coatomer': a cytosolic protein complex containing subunits of non-clathrin-coated Golgi transport vesicles.", "journal": "Nature", "date": "1991", "authors": "Waters MG, Serafini T, Rothman JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "1898986", "url": "https://glygen.org/publication/PubMed/1898986" } ] }, { "title": "Differential roles of ArfGAP1, ArfGAP2, and ArfGAP3 in COPI trafficking.", "journal": "The Journal of cell biology", "date": "2008", "authors": "Weimer C, Beck R, Eckert P, Reckmann I, Moelleken J, Brugger B, Wieland F", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "19015319", "url": "https://glygen.org/publication/PubMed/19015319" } ] }, { "title": "Discrete determinants in ArfGAP2/3 conferring Golgi localization and regulation by the COPI coat.", "journal": "Molecular biology of the cell", "date": "2009", "authors": "Kliouchnikov L, Bigay J, Mesmin B, Parnis A, Rawet M, Goldfeder N, Antonny B, Cassel D", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "19109418", "url": "https://glygen.org/publication/PubMed/19109418" } ] }, { "title": "Membrane fusion: grappling with SNARE and SM proteins.", "journal": "Science (New York, N.Y.)", "date": "2009", "authors": "Sudhof TC, Rothman JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "19164740", "url": "https://glygen.org/publication/PubMed/19164740" } ] }, { "title": "Functional proteomics identify cornichon proteins as auxiliary subunits of AMPA receptors.", "journal": "Science (New York, N.Y.)", "date": "2009", "authors": "Schwenk J, Harmel N, Zolles G, Bildl W, Kulik A, Heimrich B, Chisaka O, Jonas P, Schulte U, Fakler B, Klocker N", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "19265014", "url": "https://glygen.org/publication/PubMed/19265014" } ] }, { "title": "TANGO1 facilitates cargo loading at endoplasmic reticulum exit sites.", "journal": "Cell", "date": "2009", "authors": "Saito K, Chen M, Bard F, Chen S, Zhou H, Woodley D, Polischuk R, Schekman R, Malhotra V", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "19269366", "url": "https://glygen.org/publication/PubMed/19269366" } ] }, { "title": "Arf GAP2 is positively regulated by coatomer and cargo.", "journal": "Cellular signalling", "date": "2009", "authors": "Luo R, Ha VL, Hayashi R, Randazzo PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "19296914", "url": "https://glygen.org/publication/PubMed/19296914" } ] }, { "title": "Direct interaction between the COG complex and the SM protein, Sly1, is required for Golgi SNARE pairing.", "journal": "The EMBO journal", "date": "2009", "authors": "Laufman O, Kedan A, Hong W, Lev S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "19536132", "url": "https://glygen.org/publication/PubMed/19536132" } ] }, { "title": "The p24 family and selective transport processes at the ER-Golgi interface.", "journal": "Biology of the cell", "date": "2009", "authors": "Strating JR, Martens GJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "19566487", "url": "https://glygen.org/publication/PubMed/19566487" } ] }, { "title": "Binding of ARF and beta-COP to Golgi membranes: possible regulation by a trimeric G protein.", "journal": "Science (New York, N.Y.)", "date": "1991", "authors": "Donaldson JG, Kahn RA, Lippincott-Schwartz J, Klausner RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "1957170", "url": "https://glygen.org/publication/PubMed/1957170" } ] }, { "title": "The COPI system: molecular mechanisms and function.", "journal": "FEBS letters", "date": "2009", "authors": "Beck R, Rawet M, Wieland FT, Cassel D", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "19631211", "url": "https://glygen.org/publication/PubMed/19631211" } ] }, { "title": "Organisation of human ER-exit sites: requirements for the localisation of Sec16 to transitional ER.", "journal": "Journal of cell science", "date": "2009", "authors": "Hughes H, Budnik A, Schmidt K, Palmer KJ, Mantell J, Noakes C, Johnson A, Carter DA, Verkade P, Watson P, Stephens DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "19638414", "url": "https://glygen.org/publication/PubMed/19638414" } ] }, { "title": "mTrs130 is a component of a mammalian TRAPPII complex, a Rab1 GEF that binds to COPI-coated vesicles.", "journal": "Molecular biology of the cell", "date": "2009", "authors": "Yamasaki A, Menon S, Yu S, Barrowman J, Meerloo T, Oorschot V, Klumperman J, Satoh A, Ferro-Novick S", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "19656848", "url": "https://glygen.org/publication/PubMed/19656848" } ] }, { "title": "Golgi localisation of GMAP210 requires two distinct cis-membrane binding mechanisms.", "journal": "BMC biology", "date": "2009", "authors": "Cardenas J, Rivero S, Goud B, Bornens M, Rios RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "19715559", "url": "https://glygen.org/publication/PubMed/19715559" } ] }, { "title": "A link between ER tethering and COP-I vesicle uncoating.", "journal": "Developmental cell", "date": "2009", "authors": "Zink S, Wenzel D, Wurm CA, Schmitt HD", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "19758564", "url": "https://glygen.org/publication/PubMed/19758564" } ] }, { "title": "Rab33b and Rab6 are functionally overlapping regulators of Golgi homeostasis and trafficking.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2010", "authors": "Starr T, Sun Y, Wilkins N, Storrie B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "20163571", "url": "https://glygen.org/publication/PubMed/20163571" } ] }, { "title": "Arf3 is activated uniquely at the trans-Golgi network by brefeldin A-inhibited guanine nucleotide exchange factors.", "journal": "Molecular biology of the cell", "date": "2010", "authors": "Manolea F, Chun J, Chen DW, Clarke I, Summerfeldt N, Dacks JB, Melancon P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "20357002", "url": "https://glygen.org/publication/PubMed/20357002" } ] }, { "title": "Selective export of human GPI-anchored proteins from the endoplasmic reticulum.", "journal": "Journal of cell science", "date": "2010", "authors": "Bonnon C, Wendeler MW, Paccaud JP, Hauri HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "20427317", "url": "https://glygen.org/publication/PubMed/20427317" } ] }, { "title": "Role of the lectin VIP36 in post-ER quality control of human alpha1-antitrypsin.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2010", "authors": "Reiterer V, Nyfeler B, Hauri HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "20477988", "url": "https://glygen.org/publication/PubMed/20477988" } ] }, { "title": "Protein sorting receptors in the early secretory pathway.", "journal": "Annual review of biochemistry", "date": "2010", "authors": "Dancourt J, Barlowe C", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "20533886", "url": "https://glygen.org/publication/PubMed/20533886" } ] }, { "title": "A targeted siRNA screen to identify SNAREs required for constitutive secretion in mammalian cells.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2010", "authors": "Gordon DE, Bond LM, Sahlender DA, Peden AA", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "20545907", "url": "https://glygen.org/publication/PubMed/20545907" } ] }, { "title": "Models for the functions of Arf GAPs.", "journal": "Seminars in cell & developmental biology", "date": "2011", "authors": "East MP, Kahn RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "20637885", "url": "https://glygen.org/publication/PubMed/20637885" } ] }, { "title": "p125A exists as part of the mammalian Sec13/Sec31 COPII subcomplex to facilitate ER-Golgi transport.", "journal": "The Journal of cell biology", "date": "2010", "authors": "Ong YS, Tang BL, Loo LS, Hong W", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "20679433", "url": "https://glygen.org/publication/PubMed/20679433" } ] }, { "title": "Functional comparison of the effects of TARPs and cornichons on AMPA receptor trafficking and gating.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2010", "authors": "Shi Y, Suh YH, Milstein AD, Isozaki K, Schmid SM, Roche KW, Nicoll RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "20805473", "url": "https://glygen.org/publication/PubMed/20805473" } ] }, { "title": "Interaction of Golgin-84 with the COG complex mediates the intra-Golgi retrograde transport.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2010", "authors": "Sohda M, Misumi Y, Yamamoto A, Nakamura N, Ogata S, Sakisaka S, Hirose S, Ikehara Y, Oda K", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "20874812", "url": "https://glygen.org/publication/PubMed/20874812" } ] }, { "title": "TRAPP complexes in membrane traffic: convergence through a common Rab.", "journal": "Nature reviews. Molecular cell biology", "date": "2010", "authors": "Barrowman J, Bhandari D, Reinisch K, Ferro-Novick S", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "20966969", "url": "https://glygen.org/publication/PubMed/20966969" } ] }, { "title": "Proteinase-activated receptors, nucleotide P2Y receptors, and mu-opioid receptor-1B are under the control of the type I transmembrane proteins p23 and p24A in post-Golgi trafficking.", "journal": "Journal of neurochemistry", "date": "2011", "authors": "Luo W, Wang Y, Reiser G", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "21219331", "url": "https://glygen.org/publication/PubMed/21219331" } ] }, { "title": "Role of miR-204 in the regulation of apoptosis, endoplasmic reticulum stress response, and inflammation in human trabecular meshwork cells.", "journal": "Investigative ophthalmology & visual science", "date": "2011", "authors": "Li G, Luna C, Qiu J, Epstein DL, Gonzalez P", "evidence": [ { "database": "Reactome", "id": "R-HSA-381038", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381038" } ], "reference": [ { "type": "PubMed", "id": "21282569", "url": "https://glygen.org/publication/PubMed/21282569" } ] }, { "title": "TFG-1 function in protein secretion and oncogenesis.", "journal": "Nature cell biology", "date": "2011", "authors": "Witte K, Schuh AL, Hegermann J, Sarkeshik A, Mayers JR, Schwarze K, Yates JR 3rd, Eimer S, Audhya A", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "21478858", "url": "https://glygen.org/publication/PubMed/21478858" } ] }, { "title": "cTAGE5 mediates collagen secretion through interaction with TANGO1 at endoplasmic reticulum exit sites.", "journal": "Molecular biology of the cell", "date": "2011", "authors": "Saito K, Yamashiro K, Ichikawa Y, Erlmann P, Kontani K, Malhotra V, Katada T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "21525241", "url": "https://glygen.org/publication/PubMed/21525241" } ] }, { "title": "Sequential interactions with Sec23 control the direction of vesicle traffic.", "journal": "Nature", "date": "2011", "authors": "Lord C, Bhandari D, Menon S, Ghassemian M, Nycz D, Hay J, Ghosh P, Ferro-Novick S", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "21532587", "url": "https://glygen.org/publication/PubMed/21532587" } ] }, { "title": "A mutation in the Golgi Qb-SNARE gene GOSR2 causes progressive myoclonus epilepsy with early ataxia.", "journal": "American journal of human genetics", "date": "2011", "authors": "Corbett MA, Schwake M, Bahlo M, Dibbens LM, Lin M, Gandolfo LC, Vears DF, O'Sullivan JD, Robertson T, Bayly MA, Gardner AE, Vlaar AM, Korenke GC, Bloem BR, de Coo IF, Verhagen JM, Lehesjoki AE, Gecz J, Berkovic SF", "evidence": [ { "database": "UniProtKB", "id": "O14653", "url": "https://www.uniprot.org/uniprot/O14653" } ], "reference": [ { "type": "PubMed", "id": "21549339", "url": "https://glygen.org/publication/PubMed/21549339" } ] }, { "title": "Requirements for the catalytic cycle of the N-ethylmaleimide-Sensitive Factor (NSF).", "journal": "Biochimica et biophysica acta", "date": "2012", "authors": "Zhao C, Smith EC, Whiteheart SW", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "21689688", "url": "https://glygen.org/publication/PubMed/21689688" } ] }, { "title": "The COG complex interacts directly with Syntaxin 6 and positively regulates endosome-to-TGN retrograde transport.", "journal": "The Journal of cell biology", "date": "2011", "authors": "Laufman O, Hong W, Lev S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "21807881", "url": "https://glygen.org/publication/PubMed/21807881" } ] }, { "title": "COPI budding within the Golgi stack.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2011", "authors": "Popoff V, Adolf F, Brugger B, Wieland F", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "21844168", "url": "https://glygen.org/publication/PubMed/21844168" } ] }, { "title": "Protein export at the ER: loading big collagens into COPII carriers.", "journal": "The EMBO journal", "date": "2011", "authors": "Malhotra V, Erlmann P", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "21878990", "url": "https://glygen.org/publication/PubMed/21878990" } ] }, { "title": "COPII and COPI traffic at the ER-Golgi interface.", "journal": "Physiology (Bethesda, Md.)", "date": "2011", "authors": "Szul T, Sztul E", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "22013193", "url": "https://glygen.org/publication/PubMed/22013193" } ] }, { "title": "p24 proteins are required for secretion of Wnt ligands.", "journal": "EMBO reports", "date": "2011", "authors": "Buechling T, Chaudhary V, Spirohn K, Weiss M, Boutros M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "22094269", "url": "https://glygen.org/publication/PubMed/22094269" } ] }, { "title": "Sec24p and Sec16p cooperate to regulate the GTP cycle of the COPII coat.", "journal": "The EMBO journal", "date": "2012", "authors": "Kung LF, Pagant S, Futai E, D'Arcangelo JG, Buchanan R, Dittmar JC, Reid RJ, Rothstein R, Hamamoto S, Snapp EL, Schekman R, Miller EA", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "22157747", "url": "https://glygen.org/publication/PubMed/22157747" } ] }, { "title": "Rab30 is required for the morphological integrity of the Golgi apparatus.", "journal": "Biology of the cell", "date": "2012", "authors": "Kelly EE, Giordano F, Horgan CP, Jollivet F, Raposo G, McCaffrey MW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "22188167", "url": "https://glygen.org/publication/PubMed/22188167" } ] }, { "title": "A structure-based mechanism for Arf1-dependent recruitment of coatomer to membranes.", "journal": "Cell", "date": "2012", "authors": "Yu X, Breitman M, Goldberg J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "22304919", "url": "https://glygen.org/publication/PubMed/22304919" } ] }, { "title": "Insights into structural and regulatory roles of Sec16 in COPII vesicle formation at ER exit sites.", "journal": "Molecular biology of the cell", "date": "2012", "authors": "Yorimitsu T, Sato K", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "22675024", "url": "https://glygen.org/publication/PubMed/22675024" } ] }, { "title": "Ric1-Rgp1 complex is a guanine nucleotide exchange factor for the late Golgi Rab6A GTPase and an effector of the medial Golgi Rab33B GTPase.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Pusapati GV, Luchetti G, Pfeffer SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "23091056", "url": "https://glygen.org/publication/PubMed/23091056" } ] }, { "title": "Molecular insights into vesicle tethering at the Golgi by the conserved oligomeric Golgi (COG) complex and the golgin TATA element modulatory factor (TMF).", "journal": "The Journal of biological chemistry", "date": "2013", "authors": "Miller VJ, Sharma P, Kudlyk TA, Frost L, Rofe AP, Watson IJ, Duden R, Lowe M, Lupashin VV, Ungar D", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "23239882", "url": "https://glygen.org/publication/PubMed/23239882" } ] }, { "title": "The COG complex interacts with multiple Golgi SNAREs and enhances fusogenic assembly of SNARE complexes.", "journal": "Journal of cell science", "date": "2013", "authors": "Laufman O, Hong W, Lev S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "23378023", "url": "https://glygen.org/publication/PubMed/23378023" } ] }, { "title": "The highly conserved COPII coat complex sorts cargo from the endoplasmic reticulum and targets it to the golgi.", "journal": "Cold Spring Harbor perspectives in biology", "date": "2013", "authors": "Lord C, Ferro-Novick S, Miller EA", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "23378591", "url": "https://glygen.org/publication/PubMed/23378591" } ] }, { "title": "COG complexes form spatial landmarks for distinct SNARE complexes.", "journal": "Nature communications", "date": "2013", "authors": "Willett R, Kudlyk T, Pokrovskaya I, Schonherr R, Ungar D, Duden R, Lupashin V", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "23462996", "url": "https://glygen.org/publication/PubMed/23462996" } ] }, { "title": "Inhibition of TFG function causes hereditary axon degeneration by impairing endoplasmic reticulum structure.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2013", "authors": "Beetz C, Johnson A, Schuh AL, Thakur S, Varga RE, Fothergill T, Hertel N, Bomba-Warczak E, Thiele H, Nurnberg G, Altmuller J, Saxena R, Chapman ER, Dent EW, Nurnberg P, Audhya A", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "23479643", "url": "https://glygen.org/publication/PubMed/23479643" } ] }, { "title": "Organization of the ER-Golgi interface for membrane traffic control.", "journal": "Nature reviews. Molecular cell biology", "date": "2013", "authors": "Brandizzi F, Barlowe C", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "23698585", "url": "https://glygen.org/publication/PubMed/23698585" } ] }, { "title": "The Golgi puppet master: COG complex at center stage of membrane trafficking interactions.", "journal": "Histochemistry and cell biology", "date": "2013", "authors": "Willett R, Ungar D, Lupashin V", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "23839779", "url": "https://glygen.org/publication/PubMed/23839779" } ] }, { "title": "Combined deficiency of coagulation factors V and VIII: an update.", "journal": "Seminars in thrombosis and hemostasis", "date": "2013", "authors": "Zheng C, Zhang B", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "23852824", "url": "https://glygen.org/publication/PubMed/23852824" } ] }, { "title": "Sit4p/PP6 regulates ER-to-Golgi traffic by controlling the dephosphorylation of COPII coat subunits.", "journal": "Molecular biology of the cell", "date": "2013", "authors": "Bhandari D, Zhang J, Menon S, Lord C, Chen S, Helm JR, Thorsen K, Corbett KD, Hay JC, Ferro-Novick S", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "23864707", "url": "https://glygen.org/publication/PubMed/23864707" } ] }, { "title": "Rab41 is a novel regulator of Golgi apparatus organization that is needed for ER-to-Golgi trafficking and cell growth.", "journal": "PloS one", "date": "2013", "authors": "Liu S, Hunt L, Storrie B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "23936529", "url": "https://glygen.org/publication/PubMed/23936529" } ] }, { "title": "Structural basis for membrane recruitment and allosteric activation of cytohesin family Arf GTPase exchange factors.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2013", "authors": "Malaby AW, van den Berg B, Lambright DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "23940353", "url": "https://glygen.org/publication/PubMed/23940353" } ] }, { "title": "Tethering the assembly of SNARE complexes.", "journal": "Trends in cell biology", "date": "2014", "authors": "Hong W, Lev S", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "24119662", "url": "https://glygen.org/publication/PubMed/24119662" } ] }, { "title": "Ramsay Hunt syndrome: clinical characterization of progressive myoclonus ataxia caused by GOSR2 mutation.", "journal": "Movement disorders : official journal of the Movement Disorder Society", "date": "2014-01", "authors": "van Egmond Martje E, Verschuuren-Bemelmans Corien C, Nibbeling Esther A, Elting Jan Willem J, Sival Deborah A, Brouwer Oebele F, de Vries Jeroen J, Kremer Hubertus P, Sinke Richard J, Tijssen Marina A, de Koning Tom J", "evidence": [ { "database": "UniProtKB", "id": "O14653", "url": "https://www.uniprot.org/uniprot/O14653" } ], "reference": [ { "type": "PubMed", "id": "24458321", "url": "https://glygen.org/publication/PubMed/24458321" } ] }, { "title": "TMEM115 is an integral membrane protein of the Golgi complex involved in retrograde transport.", "journal": "Journal of cell science", "date": "2014", "authors": "Ong YS, Tran TH, Gounko NV, Hong W", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "24806965", "url": "https://glygen.org/publication/PubMed/24806965" } ] }, { "title": "In sickness and in health: the role of TRAPP and associated proteins in disease.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2014", "authors": "Brunet S, Sacher M", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "24917561", "url": "https://glygen.org/publication/PubMed/24917561" } ] }, { "title": "Concentration of Sec12 at ER exit sites via interaction with cTAGE5 is required for collagen export.", "journal": "The Journal of cell biology", "date": "2014", "authors": "Saito K, Yamashiro K, Shimazu N, Tanabe T, Kontani K, Katada T", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "25202031", "url": "https://glygen.org/publication/PubMed/25202031" } ] }, { "title": "p115-SNARE interactions: a dynamic cycle of p115 binding monomeric SNARE motifs and releasing assembled bundles.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2015", "authors": "Wang T, Grabski R, Sztul E, Hay JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "25406594", "url": "https://glygen.org/publication/PubMed/25406594" } ] }, { "title": "Diverse roles for the p24 family of proteins in eukaryotic cells.", "journal": "Biomolecular concepts", "date": "2012", "authors": "Schuiki I, Volchuk A", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "25436559", "url": "https://glygen.org/publication/PubMed/25436559" } ] }, { "title": "Three alphaSNAP and 10 ATP molecules are used in SNARE complex disassembly by N-ethylmaleimide-sensitive factor (NSF).", "journal": "The Journal of biological chemistry", "date": "2015", "authors": "Shah N, Colbert KN, Enos MD, Herschlag D, Weis WI", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "25492864", "url": "https://glygen.org/publication/PubMed/25492864" } ] }, { "title": "TFG clusters COPII-coated transport carriers and promotes early secretory pathway organization.", "journal": "The EMBO journal", "date": "2015", "authors": "Johnson A, Bhattacharya N, Hanna M, Pennington JG, Schuh AL, Wang L, Otegui MS, Stagg SM, Audhya A", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "25586378", "url": "https://glygen.org/publication/PubMed/25586378" } ] }, { "title": "SEC16 in COPII coat dynamics at ER exit sites.", "journal": "Biochemical Society transactions", "date": "2015", "authors": "Sprangers J, Rabouille C", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "25619252", "url": "https://glygen.org/publication/PubMed/25619252" } ] }, { "title": "Procollagen export from the endoplasmic reticulum.", "journal": "Biochemical Society transactions", "date": "2015", "authors": "Malhotra V, Erlmann P, Nogueira C", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "25619253", "url": "https://glygen.org/publication/PubMed/25619253" } ] }, { "title": "How Rab proteins determine Golgi structure.", "journal": "International review of cell and molecular biology", "date": "2015", "authors": "Liu S, Storrie B", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "25708460", "url": "https://glygen.org/publication/PubMed/25708460" } ] }, { "title": "TRAPPC11 and GOSR2 mutations associate with hypoglycosylation of alpha-dystroglycan and muscular dystrophy.", "journal": "Skeletal muscle", "date": "2018", "authors": "Larson AA, Baker PR 2nd, Milev MP, Press CA, Sokol RJ, Cox MO, Lekostaj JK, Stence AA, Bossler AD, Mueller JM, Prematilake K, Tadjo TF, Williams CA, Sacher M, Moore SA", "evidence": [ { "database": "UniProtKB", "id": "O14653", "url": "https://www.uniprot.org/uniprot/O14653" }, { "database": "RefSeq", "id": "NP_001012529", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001012529" } ], "reference": [ { "type": "PubMed", "id": "29855340", "url": "https://glygen.org/publication/PubMed/29855340" } ] }, { "title": "Compound heterozygous variants in GOSR2 associated with congenital muscular dystrophy: A case report.", "journal": "European journal of medical genetics", "date": "2021-04", "authors": "Henige Hannah, Kaur Shagun, Pappas Kara", "evidence": [ { "database": "UniProtKB", "id": "O14653", "url": "https://www.uniprot.org/uniprot/O14653" } ], "reference": [ { "type": "PubMed", "id": "33639315", "url": "https://glygen.org/publication/PubMed/33639315" } ] }, { "title": "Myopathy can be a key phenotype of membrin (GOSR2) deficiency.", "journal": "Human mutation", "date": "2021-09", "authors": "Stemmerik Mads G, Borch Josefine de S, Dun\u00f8 Morten, Krag Thomas, Vissing John", "evidence": [ { "database": "UniProtKB", "id": "O14653", "url": "https://www.uniprot.org/uniprot/O14653" } ], "reference": [ { "type": "PubMed", "id": "34167170", "url": "https://glygen.org/publication/PubMed/34167170" } ] }, { "title": "Computational estimates of annular diameter reveal genetic determinants of mitral valve function and disease.", "journal": "JCI insight", "date": "2022", "authors": "Yu M, Tcheandjieu C, Georges A, Xiao K, Tejeda H, Dina C, Le Tourneau T, Fiterau M, Judy R, Tsao NL, Amgalan D, Munger CJ, Engreitz JM, Damrauer SM, Bouatia-Naji N, Priest JR", "evidence": [ { "database": "RefSeq", "id": "NP_001012529", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001012529" } ], "reference": [ { "type": "PubMed", "id": "35132965", "url": "https://glygen.org/publication/PubMed/35132965" } ] }, { "title": "Novel Genetic and Phenotypic Expansion in GOSR2-Related Progressive Myoclonus Epilepsy.", "journal": "Genes", "date": "2023-09-25", "authors": "Hentrich Lea, Parnes Mered, Lotze Timothy Edward, Coorg Rohini, de Koning Tom J, Nguyen Kha M, Yip Calvin K, Jungbluth Heinz, Koy Anne, Dafsari Hormos Salimi", "evidence": [ { "database": "RefSeq", "id": "NP_001012529", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001012529" } ], "reference": [ { "type": "PubMed", "id": "37895210", "url": "https://glygen.org/publication/PubMed/37895210" } ] }, { "title": "Cloning and sequencing of the cDNA encoding human P5.", "journal": "Gene", "date": "1995", "authors": "Hayano T, Kikuchi M", "evidence": [ { "database": "Reactome", "id": "R-HSA-381038", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381038" } ], "reference": [ { "type": "PubMed", "id": "7590364", "url": "https://glygen.org/publication/PubMed/7590364" } ] }, { "title": "Giantin, a novel conserved Golgi membrane protein containing a cytoplasmic domain of at least 350 kDa.", "journal": "Molecular biology of the cell", "date": "1993", "authors": "Linstedt AD, Hauri HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "7691276", "url": "https://glygen.org/publication/PubMed/7691276" } ] }, { "title": "Coatomer is essential for retrieval of dilysine-tagged proteins to the endoplasmic reticulum.", "journal": "Cell", "date": "1994", "authors": "Letourneur F, Gaynor EC, Hennecke S, Demolliere C, Duden R, Emr SD, Riezman H, Cosson P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "8001155", "url": "https://glygen.org/publication/PubMed/8001155" } ] }, { "title": "Coatomer interaction with di-lysine endoplasmic reticulum retention motifs.", "journal": "Science (New York, N.Y.)", "date": "1994", "authors": "Cosson P, Letourneur F", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "8128252", "url": "https://glygen.org/publication/PubMed/8128252" } ] }, { "title": "En bloc incorporation of coatomer subunits during the assembly of COP-coated vesicles.", "journal": "The Journal of cell biology", "date": "1994", "authors": "Hara-Kuge S, Kuge O, Orci L, Amherdt M, Ravazzola M, Wieland FT, Rothman JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "8132710", "url": "https://glygen.org/publication/PubMed/8132710" } ] }, { "title": "A protein assembly-disassembly pathway in vitro that may correspond to sequential steps of synaptic vesicle docking, activation, and fusion.", "journal": "Cell", "date": "1993", "authors": "Sollner T, Bennett MK, Whiteheart SW, Scheller RH, Rothman JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "8221884", "url": "https://glygen.org/publication/PubMed/8221884" } ] }, { "title": "Hydrolysis of bound GTP by ARF protein triggers uncoating of Golgi-derived COP-coated vesicles.", "journal": "The Journal of cell biology", "date": "1993", "authors": "Tanigawa G, Orci L, Amherdt M, Ravazzola M, Helms JB, Rothman JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "8253837", "url": "https://glygen.org/publication/PubMed/8253837" } ] }, { "title": "Binding of coatomer to Golgi membranes requires ADP-ribosylation factor.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Palmer DJ, Helms JB, Beckers CJ, Orci L, Rothman JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "8505331", "url": "https://glygen.org/publication/PubMed/8505331" } ] }, { "title": "Sec18p (NSF)-driven release of Sec17p (alpha-SNAP) can precede docking and fusion of yeast vacuoles.", "journal": "Cell", "date": "1996", "authors": "Mayer A, Wickner W, Haas A", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "8620540", "url": "https://glygen.org/publication/PubMed/8620540" } ] }, { "title": "A v-SNARE implicated in intra-Golgi transport.", "journal": "The Journal of cell biology", "date": "1996", "authors": "Nagahama M, Orci L, Ravazzola M, Amherdt M, Lacomis L, Tempst P, Rothman JE, Sollner TH", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "8636227", "url": "https://glygen.org/publication/PubMed/8636227" } ] }, { "title": "Mammalian Sly1 regulates syntaxin 5 function in endoplasmic reticulum to Golgi transport.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Dascher C, Balch WE", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "8663406", "url": "https://glygen.org/publication/PubMed/8663406" } ] }, { "title": "Cloning, expression, and cellular localization of the oncogenic 58-kDa inhibitor of the RNA-activated human and mouse protein kinase.", "journal": "Gene", "date": "1996", "authors": "Korth MJ, Lyons CN, Wambach M, Katze MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-381038", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381038" } ], "reference": [ { "type": "PubMed", "id": "8666242", "url": "https://glygen.org/publication/PubMed/8666242" } ] }, { "title": "A human exchange factor for ARF contains Sec7- and pleckstrin-homology domains.", "journal": "Nature", "date": "1996", "authors": "Chardin P, Paris S, Antonny B, Robineau S, Beraud-Dufour S, Jackson CL, Chabre M", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "8945478", "url": "https://glygen.org/publication/PubMed/8945478" } ] }, { "title": "Centractin (ARP1) associates with spectrin revealing a potential mechanism to link dynactin to intracellular organelles.", "journal": "The Journal of cell biology", "date": "1996", "authors": "Holleran EA, Tokito MK, Karki S, Holzbaur EL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "8991093", "url": "https://glygen.org/publication/PubMed/8991093" } ] }, { "title": "Identification and localization of the gene for EXTL, a third member of the multiple exostoses gene family.", "journal": "Genome research", "date": "1997", "authors": "Wise CA, Clines GA, Massa H, Trask BJ, Lovett M", "evidence": [ { "database": "Reactome", "id": "R-HSA-381038", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381038" } ], "reference": [ { "type": "PubMed", "id": "9037597", "url": "https://glygen.org/publication/PubMed/9037597" } ] }, { "title": "Protein interactions regulating vesicle transport between the endoplasmic reticulum and Golgi apparatus in mammalian cells.", "journal": "Cell", "date": "1997", "authors": "Hay JC, Chao DS, Kuo CS, Scheller RH", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "9094723", "url": "https://glygen.org/publication/PubMed/9094723" } ] }, { "title": "Direct and GTP-dependent interaction of ADP ribosylation factor 1 with coatomer subunit beta.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Zhao L, Helms JB, Brugger B, Harter C, Martoglio B, Graf R, Brunner J, Wieland FT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "9114004", "url": "https://glygen.org/publication/PubMed/9114004" } ] }, { "title": "The vesicle docking protein p115 binds GM130, a cis-Golgi matrix protein, in a mitotically regulated manner.", "journal": "Cell", "date": "1997", "authors": "Nakamura N, Lowe M, Levine TP, Rabouille C, Warren G", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "9150144", "url": "https://glygen.org/publication/PubMed/9150144" } ] }, { "title": "Assembly and disassembly of a ternary complex of synaptobrevin, syntaxin, and SNAP-25 in the membrane of synaptic vesicles.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Otto H, Hanson PI, Jahn R", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "9177194", "url": "https://glygen.org/publication/PubMed/9177194" } ] }, { "title": "Bidirectional transport by distinct populations of COPI-coated vesicles.", "journal": "Cell", "date": "1997", "authors": "Orci L, Stamnes M, Ravazzola M, Amherdt M, Perrelet A, Sollner TH, Rothman JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "9244307", "url": "https://glygen.org/publication/PubMed/9244307" } ] }, { "title": "ER-to-Golgi transport visualized in living cells.", "journal": "Nature", "date": "1997", "authors": "Presley JF, Cole NB, Schroer TA, Hirschberg K, Zaal KJ, Lippincott-Schwartz J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "9288971", "url": "https://glygen.org/publication/PubMed/9288971" } ] }, { "title": "An isoform of the Golgi t-SNARE, syntaxin 5, with an endoplasmic reticulum retrieval signal.", "journal": "Molecular biology of the cell", "date": "1997", "authors": "Hui N, Nakamura N, Sonnichsen B, Shima DT, Nilsson T, Warren G", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "9307973", "url": "https://glygen.org/publication/PubMed/9307973" } ] }, { "title": "Visualization of ER-to-Golgi transport in living cells reveals a sequential mode of action for COPII and COPI.", "journal": "Cell", "date": "1997", "authors": "Scales SJ, Pepperkok R, Kreis TE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "9323141", "url": "https://glygen.org/publication/PubMed/9323141" } ] }, { "title": "A SNARE involved in protein transport through the Golgi apparatus.", "journal": "Nature", "date": "1997", "authors": "Lowe SL, Peter F, Subramaniam VN, Wong SH, Hong W", "evidence": [ { "database": "UniProtKB", "id": "O14653", "url": "https://www.uniprot.org/uniprot/O14653" } ], "reference": [ { "type": "PubMed", "id": "9349823", "url": "https://glygen.org/publication/PubMed/9349823" } ] }, { "title": "Na,K-ATPase transport from endoplasmic reticulum to Golgi requires the Golgi spectrin-ankyrin G119 skeleton in Madin Darby canine kidney cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1997", "authors": "Devarajan P, Stabach PR, De Matteis MA, Morrow JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "9380700", "url": "https://glygen.org/publication/PubMed/9380700" } ] }, { "title": "The mammalian protein (rbet1) homologous to yeast Bet1p is primarily associated with the pre-Golgi intermediate compartment and is involved in vesicular transport from the endoplasmic reticulum to the Golgi apparatus.", "journal": "The Journal of cell biology", "date": "1997", "authors": "Zhang T, Wong SH, Tang BL, Xu Y, Peter F, Subramaniam VN, Hong W", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "9382863", "url": "https://glygen.org/publication/PubMed/9382863" } ] }, { "title": "The recycling of ERGIC-53 in the early secretory pathway. ERGIC-53 carries a cytosolic endoplasmic reticulum-exit determinant interacting with COPII.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Kappeler F, Klopfenstein DR, Foguet M, Paccaud JP, Hauri HP", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "9395526", "url": "https://glygen.org/publication/PubMed/9395526" } ] }, { "title": "The KDEL receptor, ERD2, regulates intracellular traffic by recruiting a GTPase-activating protein for ARF1.", "journal": "The EMBO journal", "date": "1997", "authors": "Aoe T, Cukierman E, Lee A, Cassel D, Peters PJ, Hsu VW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "9405360", "url": "https://glygen.org/publication/PubMed/9405360" } ] }, { "title": "Identification and characterization of a novel member of the EXT gene family, EXTL2.", "journal": "European journal of human genetics : EJHG", "date": "1997", "authors": "Wuyts W, Van Hul W, Hendrickx J, Speleman F, Wauters J, De Boulle K, Van Roy N, Van Agtmael T, Bossuyt P, Willems PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-381038", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381038" } ], "reference": [ { "type": "PubMed", "id": "9450183", "url": "https://glygen.org/publication/PubMed/9450183" } ] }, { "title": "gp25L/emp24/p24 protein family members of the cis-Golgi network bind both COP I and II coatomer.", "journal": "The Journal of cell biology", "date": "1998", "authors": "Dominguez M, Dejgaard K, Fullekrug J, Dahan S, Fazel A, Paccaud JP, Thomas DY, Bergeron JJ, Nilsson T", "evidence": [ { "database": "Reactome", "id": "R-HSA-5694530", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530" } ], "reference": [ { "type": "PubMed", "id": "9472029", "url": "https://glygen.org/publication/PubMed/9472029" } ] }, { "title": "Structure, chromosomal location, and expression profile of EXTR1 and EXTR2, new members of the multiple exostoses gene family.", "journal": "Biochemical and biophysical research communications", "date": "1998", "authors": "Saito T, Seki N, Yamauchi M, Tsuji S, Hayashi A, Kozuma S, Hori T", "evidence": [ { "database": "Reactome", "id": "R-HSA-381038", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381038" } ], "reference": [ { "type": "PubMed", "id": "9473480", "url": "https://glygen.org/publication/PubMed/9473480" } ] }, { "title": "Structure of the guanine nucleotide exchange factor Sec7 domain of human arno and analysis of the interaction with ARF GTPase.", "journal": "Cell", "date": "1998", "authors": "Mossessova E, Gulbis JM, Goldberg J", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "9476900", "url": "https://glygen.org/publication/PubMed/9476900" } ] }, { "title": "A role for giantin in docking COPI vesicles to Golgi membranes.", "journal": "The Journal of cell biology", "date": "1998", "authors": "Sonnichsen B, Lowe M, Levine T, Jamsa E, Dirac-Svejstrup B, Warren G", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "9490716", "url": "https://glygen.org/publication/PubMed/9490716" } ] }, { "title": "Structure of the Sec7 domain of the Arf exchange factor ARNO.", "journal": "Nature", "date": "1998", "authors": "Cherfils J, Menetrey J, Mathieu M, Le Bras G, Robineau S, Beraud-Dufour S, Antonny B, Chardin P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "9510256", "url": "https://glygen.org/publication/PubMed/9510256" } ] }, { "title": "Localization, dynamics, and protein interactions reveal distinct roles for ER and Golgi SNAREs.", "journal": "The Journal of cell biology", "date": "1998", "authors": "Hay JC, Klumperman J, Oorschot V, Steegmaier M, Kuo CS, Scheller RH", "evidence": [ { "database": "Reactome", "id": "R-HSA-204005", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005" } ], "reference": [ { "type": "PubMed", "id": "9647643", "url": "https://glygen.org/publication/PubMed/9647643" } ] }, { "title": "Solution structure of the cytohesin-1 (B2-1) Sec7 domain and its interaction with the GTPase ADP ribosylation factor 1.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Betz SF, Schnuchel A, Wang H, Olejniczak ET, Meadows RP, Lipsky BP, Harris EA, Staunton DE, Fesik SW", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "9653114", "url": "https://glygen.org/publication/PubMed/9653114" } ] }, { "title": "ADP ribosylation factor regulates spectrin binding to the Golgi complex.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Godi A, Santone I, Pertile P, Devarajan P, Stabach PR, Morrow JS, Di Tullio G, Polishchuk R, Petrucci TC, Luini A, De Matteis MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "9671725", "url": "https://glygen.org/publication/PubMed/9671725" } ] }, { "title": "ARNO3, a Sec7-domain guanine nucleotide exchange factor for ADP ribosylation factor 1, is involved in the control of Golgi structure and function.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Franco M, Boretto J, Robineau S, Monier S, Goud B, Chardin P, Chavrier P", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "9707577", "url": "https://glygen.org/publication/PubMed/9707577" } ] }, { "title": "A single binding site for dilysine retrieval motifs and p23 within the gamma subunit of coatomer.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Harter C, Wieland FT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "9751720", "url": "https://glygen.org/publication/PubMed/9751720" } ] }, { "title": "Identification and characterization of golgin-84, a novel Golgi integral membrane protein with a cytoplasmic coiled-coil domain.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Bascom RA, Srinivasan S, Nussbaum RL", "evidence": [ { "database": "Reactome", "id": "R-HSA-6811438", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438" } ], "reference": [ { "type": "PubMed", "id": "9915833", "url": "https://glygen.org/publication/PubMed/9915833" } ] }, { "title": "Receptor-induced polymerization of coatomer.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Reinhard C, Harter C, Bremser M, Brugger B, Sohn K, Helms JB, Wieland F", "evidence": [ { "database": "Reactome", "id": "R-HSA-6807878", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878" } ], "reference": [ { "type": "PubMed", "id": "9990005", "url": "https://glygen.org/publication/PubMed/9990005" } ] } ], "pathway": [ { "id": "hsa:9570", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:9570", "resource": "KEGG Pathway" }, { "id": "R-HSA-204005", "name": "COPII-mediated vesicle transport", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-204005", "resource": "Reactome", "description": "COPII-mediated vesicle transport" }, { "id": "R-HSA-381038", "name": "XBP1(S) activates chaperone genes", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381038", "resource": "Reactome", "description": "XBP1(S) activates chaperone genes" }, { "id": "R-HSA-5694530", "name": "Cargo concentration in the ER", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-5694530", "resource": "Reactome", "description": "Cargo concentration in the ER" }, { "id": "R-HSA-6807878", "name": "COPI-mediated anterograde transport", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6807878", "resource": "Reactome", "description": "COPI-mediated anterograde transport" }, { "id": "R-HSA-6811438", "name": "Intra-Golgi traffic", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6811438", "resource": "Reactome", "description": "Intra-Golgi traffic" } ], "orthologs": [ { "uniprot_canonical_ac": "O35165-1", "protein_name": "Golgi SNAP receptor complex member 2", "gene_name": "Gosr2", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MEPLYQQTHKQVHEIQSHMGRLETADKQSVHLVENEIQASIDQIFSHLERLEILSSKEPPNRRQNAKLRVDQLKYDVQHLQTALRNFQHRRQAKEQQERQRDELLSRTFTTNDSDTTIPMDESLQFNSSLQNIHHGMDDLIGGGHSILEGLRAQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYFMIGGMLLTCAVMFLVVQYLT", "length": 212 }, "evidence": [ { "id": "45928246", "url": "http://www.informatics.jax.org/homology/45928246", "database": "MGI" }, { "id": "O14653", "url": "https://omabrowser.org/oma/group/O14653/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "O35166-1", "protein_name": "Golgi SNAP receptor complex member 2", "gene_name": "Gosr2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MEPLYQQTNKQVQEIQSHMGRLERADKQSVHLVENEIQASIEQIFSHLERLEILSSKEPLNRRQNAKLRVDQLKYDVQHLQTALRNFQHRRQVREQQERQRDELLSRTFTTNDSDTTIPMDESLQFNSSLHNIHHGMDDLIGGGHSILEGLRAQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDKYFMIGGMLLTCAVMFLVVQYLT", "length": 212 }, "evidence": [ { "id": "45928246", "url": "http://www.informatics.jax.org/homology/45928246", "database": "MGI" }, { "id": "O14653", "url": "https://omabrowser.org/oma/group/O14653/", "database": "OMA" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9VRL2-1", "protein_name": "Probable Golgi SNAP receptor complex member 2", "gene_name": "Membrin", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MESLYHQTNNVVKDIERDFQRLSQLSAQESLDVENGIQLKITQANANCDRLDVLLYKVPPSQRQSSKLRVDQLKYDLRHLQTSLQTARERRQRRMQEISEREQLLNHRFTANSAQPEETRLQLDYELQHHTQLGNAHRGVDDMIASGSGILESLISQRMTLGGAHKRIQAIGSTLGLSNHTMKLIERRLVEDRRIFIGGVVVTLLIIALIIYFLVL", "length": 216 }, "evidence": [ { "id": "O14653", "url": "https://omabrowser.org/oma/group/O14653/", "database": "OMA" } ], "common_name": "Fruit fly" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 10, "go_terms": [ { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "O14653", "url": "https://www.uniprot.org/uniprot/O14653" } ], "pmid": "" }, { "name": "Golgi apparatus", "id": "GO:0005794", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005794", "evidence": [ { "database": "UniProtKB", "id": "O14653", "url": "https://www.uniprot.org/uniprot/O14653" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "O14653", "url": "https://www.uniprot.org/uniprot/O14653" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "O14653", "url": "https://www.uniprot.org/uniprot/O14653" } ], "pmid": "" }, { "name": "Golgi membrane", "id": "GO:0000139", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000139", "evidence": [ { "database": "UniProtKB", "id": "O14653", "url": "https://www.uniprot.org/uniprot/O14653" } ], "pmid": "" }, { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "O14653", "url": "https://www.uniprot.org/uniprot/O14653" } ], "pmid": "" }, { "name": "late endosome membrane", "id": "GO:0031902", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031902", "evidence": [ { "database": "UniProtKB", "id": "O14653", "url": "https://www.uniprot.org/uniprot/O14653" } ], "pmid": "" }, { "name": "ER to Golgi transport vesicle membrane", "id": "GO:0012507", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0012507", "evidence": [ { "database": "UniProtKB", "id": "O14653", "url": "https://www.uniprot.org/uniprot/O14653" } ], "pmid": "" }, { "name": "endoplasmic reticulum-Golgi intermediate compartment membrane", "id": "GO:0033116", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033116", "evidence": [ { "database": "UniProtKB", "id": "O14653", "url": "https://www.uniprot.org/uniprot/O14653" } ], "pmid": "" }, { "name": "SNARE complex", "id": "GO:0031201", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031201", "evidence": [ { "database": "UniProtKB", "id": "O14653", "url": "https://www.uniprot.org/uniprot/O14653" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "protein transport", "id": "GO:0015031", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015031", "evidence": [ { "database": "UniProtKB", "id": "O14653", "url": "https://www.uniprot.org/uniprot/O14653" } ], "pmid": "" }, { "name": "vesicle-mediated transport", "id": "GO:0016192", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016192", "evidence": [ { "database": "UniProtKB", "id": "O14653", "url": "https://www.uniprot.org/uniprot/O14653" } ], "pmid": "" }, { "name": "vesicle fusion", "id": "GO:0006906", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006906", "evidence": [ { "database": "UniProtKB", "id": "O14653", "url": "https://www.uniprot.org/uniprot/O14653" } ], "pmid": "" }, { "name": "intra-Golgi vesicle-mediated transport", "id": "GO:0006891", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006891", "evidence": [ { "database": "UniProtKB", "id": "O14653", "url": "https://www.uniprot.org/uniprot/O14653" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "SNAP receptor activity", "id": "GO:0005484", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005484", "evidence": [ { "database": "UniProtKB", "id": "O14653", "url": "https://www.uniprot.org/uniprot/O14653" } ], "pmid": "" }, { "name": "SNARE binding", "id": "GO:0000149", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000149", "evidence": [ { "database": "UniProtKB", "id": "O14653", "url": "https://www.uniprot.org/uniprot/O14653" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 112, "end_pos": 114, "annotation": "n_glycosylation_sequon" }, { "start_pos": 127, "end_pos": 129, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 112, "end_pos": 114 }, { "start_pos": 127, "end_pos": 129 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 208 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }