{ "uniprot_canonical_ac": "O14618-1", "uniprot_ac": "O14618", "uniprot_id": "CCS_HUMAN", "mass": { "chemical_mass": 29041.0, "monoisotopic_mass": 29041.0 }, "refseq": { "ac": "NP_005116", "name": "copper chaperone for superoxide dismutase", "summary": "Copper chaperone for superoxide dismutase specifically delivers Cu to copper/zinc superoxide dismutase and may activate copper/zinc superoxide dismutase through direct insertion of the Cu cofactor. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005116" }, "gene_names": [ { "name": "CCS", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O14618", "id": "O14618" }, { "name": "CCS", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005116", "id": "NP_005116" } ], "protein_names": [ { "name": "Copper chaperone for superoxide dismutase", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O14618" }, { "name": "Superoxide dismutase copper chaperone", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O14618" }, { "name": "copper chaperone for superoxide dismutase", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005116", "id": "NP_005116" }, { "name": "superoxide dismutase copper chaperone", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005116", "id": "NP_005116" } ], "function": [ { "annotation": "CRISPR/Cas9 screens unravel miR-3689a-3p regulating sorafenib resistance in hepatocellular carcinoma via suppressing CCS/SOD1-dependent mitochondrial oxidative stress.", "evidence": [ { "database": "RefSeq", "id": "NP_005116", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005116" }, { "database": "PubMed", "id": "37924725", "url": "https://glygen.org/publication/PubMed/37924725" } ] }, { "annotation": "Copper chaperone for superoxide dismutase specifically delivers Cu to copper/zinc superoxide dismutase and may activate copper/zinc superoxide dismutase through direct insertion of the Cu cofactor. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_005116", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005116" } ] }, { "annotation": "Delivers copper to copper zinc superoxide dismutase (SOD1).", "evidence": [ { "database": "UniProtKB", "id": "O14618", "url": "https://www.uniprot.org/uniprot/O14618#function" } ] }, { "annotation": "Here, we show that DCAC50, a recently developed small-molecule inhibitor of the intracellular copper chaperones, ATOX1 and CCS, reduces cell proliferation and elevates oxidative stress, triggering apoptosis in a panel of triple-negative breast cancer (TNBC) cells.", "evidence": [ { "database": "RefSeq", "id": "NP_005116", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005116" }, { "database": "PubMed", "id": "30824611", "url": "https://glygen.org/publication/PubMed/30824611" } ] }, { "annotation": "Mutations in Superoxide Dismutase 1 (Sod1) Linked to Familial Amyotrophic Lateral Sclerosis Can Disrupt High-Affinity Zinc-Binding Promoted by the Copper Chaperone for Sod1 (Ccs). Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_005116", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005116" }, { "database": "PubMed", "id": "32121118", "url": "https://glygen.org/publication/PubMed/32121118" } ] }, { "annotation": "The copper chaperone CCS facilitates copper binding to MEK1/2 to promote kinase activation.", "evidence": [ { "database": "RefSeq", "id": "NP_005116", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005116" }, { "database": "PubMed", "id": "34715128", "url": "https://glygen.org/publication/PubMed/34715128" } ] } ], "disease": [], "snv": [], "mutagenesis": [ { "start_pos": 22, "end_pos": 22, "sequence_org": "C", "sequence_mut": "S", "comment": "Reduces copper binding by half; when associated with S-25. Negligible effect on zinc binding.", "evidence": [ { "database": "UniProtKB", "id": "O14618", "url": "https://www.uniprot.org/uniprot/O14618" }, { "database": "PubMed", "id": "15736924", "url": "https://glygen.org/publication/PubMed/15736924" } ] }, { "start_pos": 244, "end_pos": 244, "sequence_org": "C", "sequence_mut": "S", "comment": "Reduces copper binding by half; when associated with S-246. Negligible effect on zinc binding.", "evidence": [ { "database": "UniProtKB", "id": "O14618", "url": "https://www.uniprot.org/uniprot/O14618" }, { "database": "PubMed", "id": "15736924", "url": "https://glygen.org/publication/PubMed/15736924" } ] }, { "start_pos": 246, "end_pos": 246, "sequence_org": "C", "sequence_mut": "S", "comment": "Reduces copper binding by half; when associated with S-244. Negligible effect on zinc binding.", "evidence": [ { "database": "UniProtKB", "id": "O14618", "url": "https://www.uniprot.org/uniprot/O14618" }, { "database": "PubMed", "id": "15736924", "url": "https://glygen.org/publication/PubMed/15736924" } ] }, { "start_pos": 25, "end_pos": 25, "sequence_org": "C", "sequence_mut": "S", "comment": "Reduces copper binding by half; when associated with S-22. Negligible effect on zinc binding.", "evidence": [ { "database": "UniProtKB", "id": "O14618", "url": "https://www.uniprot.org/uniprot/O14618" }, { "database": "PubMed", "id": "15736924", "url": "https://glygen.org/publication/PubMed/15736924" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "85.39", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000173992", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000173992" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "77.02", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000173992", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000173992" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "84.31", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000173992", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000173992" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "84.14", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000173992", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000173992" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "94.79", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000173992", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000173992" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "89.32", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000173992", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000173992" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "79.73", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000173992", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000173992" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "88.88", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000173992", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000173992" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "94.14", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000173992", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000173992" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "74.79", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000173992", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000173992" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "91.13", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000173992", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000173992" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "96.46", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000173992", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000173992" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "92.7", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000173992", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000173992" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O14618", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14618" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O14618", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14618" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O14618", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14618" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O14618", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14618" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O14618", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14618" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O14618", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14618" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O14618", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14618" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O14618", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14618" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O14618", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14618" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O14618", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14618" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O14618", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14618" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O14618", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14618" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O14618", "url": "https://www.uniprot.org/uniprot/O14618" } ], "common_name": "Human" } ], "gene": [ { "name": "CCS", "url": "https://www.uniprot.org/uniprot/O14618", "locus": { "chromosome": "11", "start_pos": 66606019, "end_pos": 66593153, "strand": "-", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000173992", "url": "https://www.ensembl.org/id/ENSG00000173992" } ] } } ], "crossref": [ { "id": "ENSG00000173992", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000173992", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00305", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00305", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "cd00371", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00371", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "CCS", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=CCS", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "9973", "url": "https://www.ncbi.nlm.nih.gov/gene/9973", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "1613", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=1613", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "J3KNF4", "url": "https://www.ebi.ac.uk/intact/interactors/id:J3KNF4*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "O14618", "url": "https://www.ebi.ac.uk/intact/interactors/id:O14618*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR001424", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001424", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006121", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006121", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR018152", "url": "https://www.ebi.ac.uk/interpro/entry/IPR018152", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR024134", "url": "https://www.ebi.ac.uk/interpro/entry/IPR024134", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036163", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036163", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036423", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036423", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:9973", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:9973", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "603864", "url": "http://www.omim.org/entry/603864", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O14618", "url": "https://www.nextprot.org/entry/NX_O14618", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "O14618", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14618", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "KNVWEER", "url": "https://omabrowser.org/oma/group/KNVWEER/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "1693333at2759", "url": "http://www.orthodb.org/?query=1693333at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10003", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10003", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10003:SF86", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10003:SF86", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "1DO5", "url": "https://www.rcsb.org/structure/1DO5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2CRL", "url": "https://www.rcsb.org/structure/2CRL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "2RSQ", "url": "https://www.rcsb.org/structure/2RSQ", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6FN8", "url": "https://www.rcsb.org/structure/6FN8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6FOL", "url": "https://www.rcsb.org/structure/6FOL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6FON", "url": "https://www.rcsb.org/structure/6FON", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6FP6", "url": "https://www.rcsb.org/structure/6FP6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00080", "url": "http://pfam.xfam.org/family/PF00080", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "PF00403", "url": "http://pfam.xfam.org/family/PF00403", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O14618", "url": "https://pharos.nih.gov/targets/O14618", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O14618", "url": "http://purl.obolibrary.org/obo/PR_O14618", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_005116", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005116", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "E9PK03", "url": "https://www.uniprot.org/uniprot/E9PK03", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PK03-1", "url": "https://www.uniprot.org/uniprot/E9PK03-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PP76", "url": "https://www.uniprot.org/uniprot/E9PP76", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "E9PP76-1", "url": "https://www.uniprot.org/uniprot/E9PP76-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "J3KNF4", "url": "https://www.uniprot.org/uniprot/J3KNF4", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "J3KNF4-1", "url": "https://www.uniprot.org/uniprot/J3KNF4-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O14618", "url": "https://www.uniprot.org/uniprot/O14618", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O14618-1", "url": "https://www.uniprot.org/uniprot/O14618-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MASDSGNQGTLCTLEFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHTTLPSQEVQALLEGTGRQAVLKGMGSGQLQNLGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGLEPGLHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIARSAGLFQNPKQICSCDGLTIWEERGRPIAGKGRKESAQPPAHL", "length": 274, "header": "sp|O14618-1|CCS_HUMAN Isoform 1 of Copper chaperone for superoxide dismutase OS=Homo sapiens OX=9606 GN=CCS PE=1 SV=1 CANONICAL=O14618-1" }, "isoforms": [ { "isoform_ac": "E9PK03-1", "url": "", "sequence": { "sequence": "MASDSGNQGTLCTLEFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHTTLPSQEVQALLEGTGRQAVLKGMGSGQLQNLGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGLEPGLHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRTGPRGPCLPSPWGAQILRDWYPQEEMGTLGKQEEASESGNQKIAAWHHVAHIPYTHTGSHSSTAETWAMSVLMLTAAPSSEWRMSS", "length": 249, "header": "tr|E9PK03-1|E9PK03_HUMAN Computationally mapped isoform of Superoxide dismutase copper chaperone OS=Homo sapiens OX=9606 GN=CCS PE=1 SV=1 CANONICAL=O14618-1" }, "locus": { "chromosome": "11", "start_pos": 66605411, "end_pos": 66593262, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000530961.5", "url": "https://www.ensembl.org/id/ENST00000530961.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000433609.1", "url": "https://www.ensembl.org/id/ENSP00000433609.1" } ] } }, { "isoform_ac": "E9PP76-1", "url": "", "sequence": { "sequence": "MEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIARSAGLFQNPKQICSCDGLT", "length": 68, "header": "tr|E9PP76-1|E9PP76_HUMAN Computationally mapped isoform of Copper chaperone for superoxide dismutase OS=Homo sapiens OX=9606 GN=CCS PE=1 SV=1 CANONICAL=O14618-1" }, "locus": { "chromosome": "11", "start_pos": 66605780, "end_pos": 66605396, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000534763.1", "url": "https://www.ensembl.org/id/ENST00000534763.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000436379.1", "url": "https://www.ensembl.org/id/ENSP00000436379.1" } ] } }, { "isoform_ac": "J3KNF4-1", "url": "", "sequence": { "sequence": "MTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHTTLPSQEVQALLEGTGRQAVLKGMGSGQLQNLGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGLEPGLHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIARSAGLFQNPKQICSCDGLTIWEERGRPIAGKGRKESAQPPAHL", "length": 255, "header": "tr|J3KNF4-1|J3KNF4_HUMAN Computationally mapped isoform of Superoxide dismutase copper chaperone OS=Homo sapiens OX=9606 GN=CCS PE=1 SV=1 CANONICAL=O14618-1" }, "locus": { "chromosome": "11", "start_pos": 66605852, "end_pos": 66593660, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000310190.8", "url": "https://www.ensembl.org/id/ENST00000310190.8" }, { "database": "Ensembl Peptide", "id": "ENSP00000307870.4", "url": "https://www.ensembl.org/id/ENSP00000307870.4" } ] } }, { "isoform_ac": "O14618-1", "url": "", "sequence": { "sequence": "MASDSGNQGTLCTLEFAVQMTCQSCVDAVRKSLQGVAGVQDVEVHLEDQMVLVHTTLPSQEVQALLEGTGRQAVLKGMGSGQLQNLGAAVAILGGPGTVQGVVRFLQLTPERCLIEGTIDGLEPGLHGLHVHQYGDLTNNCNSCGNHFNPDGASHGGPQDSDRHRGDLGNVRADADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGIIARSAGLFQNPKQICSCDGLTIWEERGRPIAGKGRKESAQPPAHL", "length": 274, "header": "sp|O14618-1|CCS_HUMAN Isoform 1 of Copper chaperone for superoxide dismutase OS=Homo sapiens OX=9606 GN=CCS PE=1 SV=1 CANONICAL=O14618-1" }, "locus": { "chromosome": "11", "start_pos": 66605852, "end_pos": 66593262, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000533244.6", "url": "https://www.ensembl.org/id/ENST00000533244.6" }, { "database": "Ensembl Peptide", "id": "ENSP00000436318.1", "url": "https://www.ensembl.org/id/ENSP00000436318.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "O14618", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14618" }, { "id": "23301498", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/23301498" } ] } ], "phosphorylation": [ { "start_pos": 267, "end_pos": 267, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O14618", "url": "https://www.uniprot.org/uniprot/O14618" }, { "database": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" }, { "database": "iPTMnet", "id": "O14618", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14618" }, { "database": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" }, { "database": "PubMed", "id": "20166139", "url": "https://glygen.org/publication/PubMed/20166139" }, { "database": "phospho.ELM", "id": "O14618", "url": "http://phospho.elm.eu.org/byAccession/O14618.html" } ], "site_lbl": "Ser267" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "NADPH oxidase: an update.", "journal": "Blood", "date": "1999", "authors": "Babior BM", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "10029572", "url": "https://glygen.org/publication/PubMed/10029572" } ] }, { "title": "Characterization of human and murine PMP20 peroxisomal proteins that exhibit antioxidant activity in vitro.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Yamashita H, Avraham S, Jiang S, London R, Van Veldhoven PP, Subramani S, Rogers RA, Avraham H", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "10514471", "url": "https://glygen.org/publication/PubMed/10514471" } ] }, { "title": "Cloning and characterization of AOEB166, a novel mammalian antioxidant enzyme of the peroxiredoxin family.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Knoops B, Clippe A, Bogard C, Arsalane K, Wattiez R, Hermans C, Duconseille E, Falmagne P, Bernard A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "10521424", "url": "https://glygen.org/publication/PubMed/10521424" } ] }, { "title": "Active and inhibited human catalase structures: ligand and NADPH binding and catalytic mechanism.", "journal": "Journal of molecular biology", "date": "2000", "authors": "Putnam CD, Arvai AS, Bourne Y, Tainer JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "10656833", "url": "https://glygen.org/publication/PubMed/10656833" } ] }, { "title": "Crystal structure of the second domain of the human copper chaperone for superoxide dismutase.", "journal": "Biochemistry", "date": "2000", "authors": "Lamb AL, Wernimont AK, Pufahl RA, O'Halloran TV, Rosenzweig AC", "evidence": [ { "database": "UniProtKB", "id": "O14618", "url": "https://www.uniprot.org/uniprot/O14618" } ], "reference": [ { "type": "PubMed", "id": "10677207", "url": "https://glygen.org/publication/PubMed/10677207" } ] }, { "title": "Mitochondrial GPx1 decreases induced but not basal oxidative damage to mtDNA in T47D cells.", "journal": "Biochemical and biophysical research communications", "date": "2000", "authors": "Legault J, Carrier C, Petrov P, Renard P, Remacle J, Mirault ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "10833429", "url": "https://glygen.org/publication/PubMed/10833429" } ] }, { "title": "The role of cellular glutathione peroxidase redox regulation in the suppression of tumor cell growth by manganese superoxide dismutase.", "journal": "Cancer research", "date": "2000", "authors": "Li S, Yan T, Yang JQ, Oberley TD, Oberley LW", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "10919671", "url": "https://glygen.org/publication/PubMed/10919671" } ] }, { "title": "The kinetics of the reduction of cytochrome c by the superoxide anion radical.", "journal": "Biochimica et biophysica acta", "date": "1976", "authors": "Koppenol WH, van Buuren KJ, Butler J, Braams R", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "10982", "url": "https://glygen.org/publication/PubMed/10982" } ] }, { "title": "Mechanism of Cu,Zn-superoxide dismutase activation by the human metallochaperone hCCS.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Rae TD, Torres AS, Pufahl RA, O'Halloran TV", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "11018045", "url": "https://glygen.org/publication/PubMed/11018045" } ] }, { "title": "Mitochondrial respiratory chain-dependent generation of superoxide anion and its release into the intermembrane space.", "journal": "The Biochemical journal", "date": "2001", "authors": "Han D, Williams E, Cadenas E", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "11139407", "url": "https://glygen.org/publication/PubMed/11139407" } ] }, { "title": "Subcellular distribution of superoxide dismutases (SOD) in rat liver: Cu,Zn-SOD in mitochondria.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Okado-Matsumoto A, Fridovich I", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "11507097", "url": "https://glygen.org/publication/PubMed/11507097" } ] }, { "title": "Crystal structure of human peroxiredoxin 5, a novel type of mammalian peroxiredoxin at 1.5 A resolution.", "journal": "Journal of molecular biology", "date": "2001", "authors": "Declercq JP, Evrard C, Clippe A, Stricht DV, Bernard A, Knoops B", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "11518528", "url": "https://glygen.org/publication/PubMed/11518528" } ] }, { "title": "Mutant Cu, Zn superoxide dismutase that causes motoneuron degeneration is present in mitochondria in the CNS.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2002", "authors": "Higgins CM, Jung C, Ding H, Xu Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "11886899", "url": "https://glygen.org/publication/PubMed/11886899" } ] }, { "title": "Catalytic pathway of manganese superoxide dismutase by direct observation of superoxide.", "journal": "Methods in enzymology", "date": "2002", "authors": "Silverman DN, Nick HS", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "11912930", "url": "https://glygen.org/publication/PubMed/11912930" } ] }, { "title": "Peroxynitrite reactions and formation in mitochondria.", "journal": "Free radical biology & medicine", "date": "2002", "authors": "Radi R, Cassina A, Hodara R, Quijano C, Castro L", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "12446202", "url": "https://glygen.org/publication/PubMed/12446202" } ] }, { "title": "Overexpression of cytosolic glutathione peroxidase (GPX1) delays endothelial cell growth and increases resistance to toxic challenges.", "journal": "Biochimie", "date": "2003", "authors": "Faucher K, Rabinovitch-Chable H, Barriere G, Cook-Moreau J, Rigaud M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "12829378", "url": "https://glygen.org/publication/PubMed/12829378" } ] }, { "title": "The intracellular proteolytic processing of extracellular superoxide dismutase (EC-SOD) is a two-step event.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Olsen DA, Petersen SV, Oury TD, Valnickova Z, Thogersen IB, Kristensen T, Bowler RP, Crapo JD, Enghild JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "15044467", "url": "https://glygen.org/publication/PubMed/15044467" } ] }, { "title": "Crystal structure of a dimeric oxidized form of human peroxiredoxin 5.", "journal": "Journal of molecular biology", "date": "2004", "authors": "Evrard C, Capron A, Marchand C, Clippe A, Wattiez R, Soumillion P, Knoops B, Declercq JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "15046979", "url": "https://glygen.org/publication/PubMed/15046979" } ] }, { "title": "Oxygen and the copper chaperone CCS regulate posttranslational activation of Cu,Zn superoxide dismutase.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Brown NM, Torres AS, Doan PE, O'Halloran TV", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "15064408", "url": "https://glygen.org/publication/PubMed/15064408" } ] }, { "title": "Human peroxiredoxin 5 is a peroxynitrite reductase.", "journal": "FEBS letters", "date": "2004", "authors": "Dubuisson M, Vander Stricht D, Clippe A, Etienne F, Nauser T, Kissner R, Koppenol WH, Rees JF, Knoops B", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "15280035", "url": "https://glygen.org/publication/PubMed/15280035" } ] }, { "title": "Complex III releases superoxide to both sides of the inner mitochondrial membrane.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Muller FL, Liu Y, Van Remmen H", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "15317809", "url": "https://glygen.org/publication/PubMed/15317809" } ] }, { "title": "Structure and substrate-binding mechanism of human Ap4A hydrolase.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Swarbrick JD, Buyya S, Gunawardana D, Gayler KR, McLennan AG, Gooley PR", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "15596429", "url": "https://glygen.org/publication/PubMed/15596429" } ] }, { "title": "Cysteine-to-serine mutants of the human copper chaperone for superoxide dismutase reveal a copper cluster at a domain III dimer interface.", "journal": "Biochemistry", "date": "2005", "authors": "Stasser JP, Eisses JF, Barry AN, Kaplan JH, Blackburn NJ", "evidence": [ { "database": "UniProtKB", "id": "O14618", "url": "https://www.uniprot.org/uniprot/O14618" } ], "reference": [ { "type": "PubMed", "id": "15736924", "url": "https://glygen.org/publication/PubMed/15736924" } ] }, { "title": "Functional analysis of Nox4 reveals unique characteristics compared to other NADPH oxidases.", "journal": "Cellular signalling", "date": "2006", "authors": "Martyn KD, Frederick LM, von Loehneysen K, Dinauer MC, Knaus UG", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "15927447", "url": "https://glygen.org/publication/PubMed/15927447" } ] }, { "title": "Direct evidence for the formation of a complex between 1-cysteine peroxiredoxin and glutathione S-transferase pi with activity changes in both enzymes.", "journal": "Biochemistry", "date": "2006", "authors": "Ralat LA, Manevich Y, Fisher AB, Colman RF", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "16401067", "url": "https://glygen.org/publication/PubMed/16401067" } ] }, { "title": "Mitochondrial metabolic states regulate nitric oxide and hydrogen peroxide diffusion to the cytosol.", "journal": "Biochimica et biophysica acta", "date": "2006", "authors": "Boveris A, Valdez LB, Zaobornyj T, Bustamante J", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "16615992", "url": "https://glygen.org/publication/PubMed/16615992" } ] }, { "title": "A three-step purification of manganese superoxide dismutase from human liver on both large and small scales.", "journal": "Protein expression and purification", "date": "1991", "authors": "Matsuda Y, Suzuki K, Ookawara T, Nakata T, Seo HG, Kawata S, Tarui S, Deutsch HF, Taniguchi N", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "1668270", "url": "https://glygen.org/publication/PubMed/1668270" } ] }, { "title": "Truncated mutants of human thioredoxin reductase 1 do not exhibit glutathione reductase activity.", "journal": "FEBS letters", "date": "2006", "authors": "Urig S, Lieske J, Fritz-Wolf K, Irmler A, Becker K", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "16750198", "url": "https://glygen.org/publication/PubMed/16750198" } ] }, { "title": "The effects of glutaredoxin and copper activation pathways on the disulfide and stability of Cu,Zn superoxide dismutase.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Carroll MC, Outten CE, Proescher JB, Rosenfeld L, Watson WH, Whitson LJ, Hart PJ, Jensen LT, Cizewski Culotta V", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "16880213", "url": "https://glygen.org/publication/PubMed/16880213" } ] }, { "title": "NOX5 variants are functionally active in endothelial cells.", "journal": "Free radical biology & medicine", "date": "2007", "authors": "BelAiba RS, Djordjevic T, Petry A, Diemer K, Bonello S, Banfi B, Hess J, Pogrebniak A, Bickel C, Gorlach A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "17275676", "url": "https://glygen.org/publication/PubMed/17275676" } ] }, { "title": "Global proteomic profiling of phosphopeptides using electron transfer dissociation tandem mass spectrometry.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Molina H, Horn DM, Tang N, Mathivanan S, Pandey A", "evidence": [ { "database": "iPTMnet", "id": "O14618", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14618" } ], "reference": [ { "type": "PubMed", "id": "17287340", "url": "https://glygen.org/publication/PubMed/17287340" } ] }, { "title": "Human peroxiredoxin 1 and 2 are not duplicate proteins: the unique presence of CYS83 in Prx1 underscores the structural and functional differences between Prx1 and Prx2.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Lee W, Choi KS, Riddell J, Ip C, Ghosh D, Park JH, Park YM", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "17519234", "url": "https://glygen.org/publication/PubMed/17519234" } ] }, { "title": "Point mutation in the cytoplasmic domain of the neutrophil p22-phox cytochrome b subunit is associated with a nonfunctional NADPH oxidase and chronic granulomatous disease.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1991", "authors": "Dinauer MC, Pierce EA, Erickson RW, Muhlebach TJ, Messner H, Orkin SH, Seger RA, Curnutte JT", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "1763037", "url": "https://glygen.org/publication/PubMed/1763037" } ] }, { "title": "Reconstitution of the mitochondrial PrxIII antioxidant defence pathway: general properties and factors affecting PrxIII activity and oligomeric state.", "journal": "Journal of molecular biology", "date": "2007", "authors": "Cao Z, Bhella D, Lindsay JG", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "17707404", "url": "https://glygen.org/publication/PubMed/17707404" } ] }, { "title": "Characterization of the complex of glutathione S-transferase pi and 1-cysteine peroxiredoxin.", "journal": "Archives of biochemistry and biophysics", "date": "2008", "authors": "Ralat LA, Misquitta SA, Manevich Y, Fisher AB, Colman RF", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "18358825", "url": "https://glygen.org/publication/PubMed/18358825" } ] }, { "title": "Different regulation of wild-type and mutant Cu,Zn superoxide dismutase localization in mammalian mitochondria.", "journal": "Human molecular genetics", "date": "2008", "authors": "Kawamata H, Manfredi G", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "18703498", "url": "https://glygen.org/publication/PubMed/18703498" } ] }, { "title": "Glutathione peroxidase 3 mediates the antioxidant effect of peroxisome proliferator-activated receptor gamma in human skeletal muscle cells.", "journal": "Molecular and cellular biology", "date": "2009", "authors": "Chung SS, Kim M, Youn BS, Lee NS, Park JW, Lee IK, Lee YS, Kim JB, Cho YM, Lee HK, Park KS", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "18936159", "url": "https://glygen.org/publication/PubMed/18936159" } ] }, { "title": "Regulation of the extracellular antioxidant selenoprotein plasma glutathione peroxidase (GPx-3) in mammalian cells.", "journal": "Molecular and cellular biochemistry", "date": "2009", "authors": "Ottaviano FG, Tang SS, Handy DE, Loscalzo J", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "19219623", "url": "https://glygen.org/publication/PubMed/19219623" } ] }, { "title": "Activation of Cu,Zn-superoxide dismutase in the absence of oxygen and the copper chaperone CCS.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Leitch JM, Jensen LT, Bouldin SD, Outten CE, Hart PJ, Culotta VC", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "19542232", "url": "https://glygen.org/publication/PubMed/19542232" } ] }, { "title": "Acatalasemia.", "journal": "Human genetics", "date": "1991", "authors": "Ogata M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "1999334", "url": "https://glygen.org/publication/PubMed/1999334" } ] }, { "title": "Irreversible inactivation of glutathione peroxidase 1 and reversible inactivation of peroxiredoxin II by H2O2 in red blood cells.", "journal": "Antioxidants & redox signaling", "date": "2010", "authors": "Cho CS, Lee S, Lee GT, Woo HA, Choi EJ, Rhee SG", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "20070187", "url": "https://glygen.org/publication/PubMed/20070187" } ] }, { "title": "Regulation of the copper chaperone CCS by XIAP-mediated ubiquitination.", "journal": "Molecular and cellular biology", "date": "2010", "authors": "Brady GF, Galban S, Liu X, Basrur V, Gitlin JD, Elenitoba-Johnson KS, Wilson TE, Duckett CS", "evidence": [ { "database": "UniProtKB", "id": "O14618", "url": "https://www.uniprot.org/uniprot/O14618" } ], "reference": [ { "type": "PubMed", "id": "20154138", "url": "https://glygen.org/publication/PubMed/20154138" } ] }, { "title": "Phosphoproteome analysis of human liver tissue by long-gradient nanoflow LC coupled with multiple stage MS analysis.", "journal": "Electrophoresis", "date": "2010", "authors": "Han G, Ye M, Liu H, Song C, Sun D, Wu Y, Jiang X, Chen R, Wang C, Wang L, Zou H", "evidence": [ { "database": "iPTMnet", "id": "O14618", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14618" } ], "reference": [ { "type": "PubMed", "id": "20166139", "url": "https://glygen.org/publication/PubMed/20166139" } ] }, { "title": "Import, maturation, and function of SOD1 and its copper chaperone CCS in the mitochondrial intermembrane space.", "journal": "Antioxidants & redox signaling", "date": "2010", "authors": "Kawamata H, Manfredi G", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "20367259", "url": "https://glygen.org/publication/PubMed/20367259" } ] }, { "title": "Cu,Zn superoxide dismutase maturation and activity are regulated by COMMD1.", "journal": "J. Biol. Chem.", "date": "2010", "authors": "Vonk Willianne I M, Wijmenga Cisca, Berger Ruud, van de Sluis Bart, Klomp Leo W J", "evidence": [ { "database": "UniProtKB", "id": "O14618", "url": "https://www.uniprot.org/uniprot/O14618" } ], "reference": [ { "type": "PubMed", "id": "20595380", "url": "https://glygen.org/publication/PubMed/20595380" } ] }, { "title": "Does cellular hydrogen peroxide diffuse or act locally?", "journal": "Antioxidants & redox signaling", "date": "2011", "authors": "Mishina NM, Tyurin-Kuzmin PA, Markvicheva KN, Vorotnikov AV, Tkachuk VA, Laketa V, Schultz C, Lukyanov S, Belousov VV", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "20690882", "url": "https://glygen.org/publication/PubMed/20690882" } ] }, { "title": "Biochemical and stability properties of recombinant human MnSOD.", "journal": "Free radical research communications", "date": "1991", "authors": "Werber MM, Greenstein LA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "2071038", "url": "https://glygen.org/publication/PubMed/2071038" } ] }, { "title": "Two endoplasmic reticulum PDI peroxidases increase the efficiency of the use of peroxide during disulfide bond formation.", "journal": "Journal of molecular biology", "date": "2011", "authors": "Nguyen VD, Saaranen MJ, Karala AR, Lappi AK, Wang L, Raykhel IB, Alanen HI, Salo KE, Wang CC, Ruddock LW", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "21215271", "url": "https://glygen.org/publication/PubMed/21215271" } ] }, { "title": "Model for the exceptional reactivity of peroxiredoxins 2 and 3 with hydrogen peroxide: a kinetic and computational study.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "Nagy P, Karton A, Betz A, Peskin AV, Pace P, O'Reilly RJ, Hampton MB, Radom L, Winterbourn CC", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "21385867", "url": "https://glygen.org/publication/PubMed/21385867" } ] }, { "title": "Mitochondrial Cu,Zn-superoxide dismutase mediates pulmonary fibrosis by augmenting H2O2 generation.", "journal": "The Journal of biological chemistry", "date": "2011", "authors": "He C, Murthy S, McCormick ML, Spitz DR, Ryan AJ, Carter AB", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "21393238", "url": "https://glygen.org/publication/PubMed/21393238" } ] }, { "title": "Mitochondrial regulation of cell cycle and proliferation.", "journal": "Antioxidants & redox signaling", "date": "2012", "authors": "Antico Arciuch VG, Elguero ME, Poderoso JJ, Carreras MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "21967640", "url": "https://glygen.org/publication/PubMed/21967640" } ] }, { "title": "Site of mitochondrial reactive oxygen species production in skeletal muscle of chronic obstructive pulmonary disease and its relationship with exercise oxidative stress.", "journal": "American journal of respiratory cell and molecular biology", "date": "2012", "authors": "Puente-Maestu L, Tejedor A, Lazaro A, de Miguel J, Alvarez-Sala L, Gonzalez-Aragoneses F, Simon C, Agusti A", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "22493009", "url": "https://glygen.org/publication/PubMed/22493009" } ] }, { "title": "Molecular and biochemical characterization of a unique mutation in CCS, the human copper chaperone to superoxide dismutase.", "journal": "Human mutation", "date": "2012", "authors": "Huppke P, Brendel C, Korenke GC, Marquardt I, Donsante A, Yi L, Hicks JD, Steinbach PJ, Wilson C, Elpeleg O, Moller LB, Christodoulou J, Kaler SG, Gartner J", "evidence": [ { "database": "UniProtKB", "id": "O14618", "url": "https://www.uniprot.org/uniprot/O14618" } ], "reference": [ { "type": "PubMed", "id": "22508683", "url": "https://glygen.org/publication/PubMed/22508683" } ] }, { "title": "Human superoxide dismutase 1 (hSOD1) maturation through interaction with human copper chaperone for SOD1 (hCCS).", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2012", "authors": "Banci L, Bertini I, Cantini F, Kozyreva T, Massagni C, Palumaa P, Rubino JT, Zovo K", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "22869735", "url": "https://glygen.org/publication/PubMed/22869735" } ] }, { "title": "Mitochondrial aquaporin-8 knockdown in human hepatoma HepG2 cells causes ROS-induced mitochondrial depolarization and loss of viability.", "journal": "Toxicology and applied pharmacology", "date": "2012", "authors": "Marchissio MJ, Frances DE, Carnovale CE, Marinelli RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "22910329", "url": "https://glygen.org/publication/PubMed/22910329" } ] }, { "title": "ZNF143 transcription factor mediates cell survival through upregulation of the GPX1 activity in the mitochondrial respiratory dysfunction.", "journal": "Cell death & disease", "date": "2012", "authors": "Lu W, Chen Z, Zhang H, Wang Y, Luo Y, Huang P", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "23152058", "url": "https://glygen.org/publication/PubMed/23152058" } ] }, { "title": "Functional interaction of glutathione S-transferase pi and peroxiredoxin 6 in intact cells.", "journal": "The international journal of biochemistry & cell biology", "date": "2013", "authors": "Zhou S, Lien YC, Shuvaeva T, DeBolt K, Feinstein SI, Fisher AB", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "23164639", "url": "https://glygen.org/publication/PubMed/23164639" } ] }, { "title": "Proteome wide purification and identification of O-GlcNAc-modified proteins using click chemistry and mass spectrometry.", "journal": "Journal of proteome research", "date": "2013", "authors": "Hahne H, Sobotzki N, Nyberg T, Helm D, Borodkin VS, van Aalten DM, Agnew B, Kuster B", "evidence": [ { "database": "O-GlcNAc Database", "id": "O14618", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14618" } ], "reference": [ { "type": "PubMed", "id": "23301498", "url": "https://glygen.org/publication/PubMed/23301498" } ] }, { "title": "Protein disulfide isomerase and glutathione are alternative substrates in the one Cys catalytic cycle of glutathione peroxidase 7.", "journal": "Biochimica et biophysica acta", "date": "2013", "authors": "Bosello-Travain V, Conrad M, Cozza G, Negro A, Quartesan S, Rossetto M, Roveri A, Toppo S, Ursini F, Zaccarin M, Maiorino M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "23454490", "url": "https://glygen.org/publication/PubMed/23454490" } ] }, { "title": "Mechanistic insights into the superoxide-cytochrome c reaction by lysine surface scanning.", "journal": "Journal of biological inorganic chemistry : JBIC : a publication of the Society of Biological Inorganic Chemistry", "date": "2013", "authors": "Wegerich F, Giachetti A, Allegrozzi M, Lisdat F, Turano P", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "23455484", "url": "https://glygen.org/publication/PubMed/23455484" } ] }, { "title": "Mechanistic aspects of hSOD1 maturation from the solution structure of Cu(I) -loaded hCCS domain 1 and analysis of disulfide-free hSOD1 mutants.", "journal": "ChemBioChem", "date": "2013", "authors": "Banci L, Cantini F, Kozyreva T, Rubino JT", "evidence": [ { "database": "UniProtKB", "id": "O14618", "url": "https://www.uniprot.org/uniprot/O14618" } ], "reference": [ { "type": "PubMed", "id": "23625804", "url": "https://glygen.org/publication/PubMed/23625804" } ] }, { "title": "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.", "journal": "Journal of proteomics", "date": "2014", "authors": "Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H", "evidence": [ { "database": "UniProtKB", "id": "O14618", "url": "https://www.uniprot.org/uniprot/O14618" }, { "database": "iPTMnet", "id": "O14618", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14618" } ], "reference": [ { "type": "PubMed", "id": "24275569", "url": "https://glygen.org/publication/PubMed/24275569" } ] }, { "title": "Natural allelic variations in glutathione peroxidase-1 affect its subcellular localization and function.", "journal": "Cancer research", "date": "2014", "authors": "Bera S, Weinberg F, Ekoue DN, Ansenberger-Fricano K, Mao M, Bonini MG, Diamond AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "25047527", "url": "https://glygen.org/publication/PubMed/25047527" } ] }, { "title": "Inhibition of Copper Transport Induces Apoptosis in Triple-Negative Breast Cancer Cells and Suppresses Tumor Angiogenesis.", "journal": "Molecular cancer therapeutics", "date": "2019", "authors": "Karginova O, Weekley CM, Raoul A, Alsayed A, Wu T, Lee SS, He C, Olopade OI", "evidence": [ { "database": "RefSeq", "id": "NP_005116", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005116" } ], "reference": [ { "type": "PubMed", "id": "30824611", "url": "https://glygen.org/publication/PubMed/30824611" } ] }, { "title": "Copper-zinc superoxide dismutase (Sod1) activation terminates interaction between its copper chaperone (Ccs) and the cytosolic metal-binding domain of the copper importer Ctr1.", "journal": "BioMetals", "date": "2019", "authors": "Skopp Am\u00e9lie, Boyd Stefanie D, Ullrich Morgan S, Liu Li, Winkler Duane D", "evidence": [ { "database": "UniProtKB", "id": "O14618", "url": "https://www.uniprot.org/uniprot/O14618" } ], "reference": [ { "type": "PubMed", "id": "31292775", "url": "https://glygen.org/publication/PubMed/31292775" } ] }, { "title": "Mutations in Superoxide Dismutase 1 (Sod1) Linked to Familial Amyotrophic Lateral Sclerosis Can Disrupt High-Affinity Zinc-Binding Promoted by the Copper Chaperone for Sod1 (Ccs).", "journal": "Molecules (Basel, Switzerland)", "date": "2020", "authors": "Boyd SD, Ullrich MS, Calvo JS, Behnia F, Meloni G, Winkler DD", "evidence": [ { "database": "RefSeq", "id": "NP_005116", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005116" } ], "reference": [ { "type": "PubMed", "id": "32121118", "url": "https://glygen.org/publication/PubMed/32121118" } ] }, { "title": "Glutathione peroxidase protein. Absence in selenium deficiency states and correlation with enzymatic activity.", "journal": "The Journal of clinical investigation", "date": "1986", "authors": "Takahashi K, Newburger PE, Cohen HJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "3457020", "url": "https://glygen.org/publication/PubMed/3457020" } ] }, { "title": "The copper chaperone CCS facilitates copper binding to MEK1/2 to promote kinase activation.", "journal": "The Journal of biological chemistry", "date": "2021", "authors": "Grasso M, Bond GJ, Kim YJ, Boyd S, Matson Dzebo M, Valenzuela S, Tsang T, Schibrowsky NA, Alwan KB, Blackburn NJ, Burslem GM, Wittung-Stafshede P, Winkler DD, Marmorstein R, Brady DC", "evidence": [ { "database": "RefSeq", "id": "NP_005116", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005116" } ], "reference": [ { "type": "PubMed", "id": "34715128", "url": "https://glygen.org/publication/PubMed/34715128" } ] }, { "title": "High-level expression of enzymatically active human Cu/Zn superoxide dismutase in Escherichia coli.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1986", "authors": "Hartman JR, Geller T, Yavin Z, Bartfeld D, Kanner D, Aviv H, Gorecki M", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "3532102", "url": "https://glygen.org/publication/PubMed/3532102" } ] }, { "title": "Purification and characterization of human plasma glutathione peroxidase: a selenoglycoprotein distinct from the known cellular enzyme.", "journal": "Archives of biochemistry and biophysics", "date": "1987", "authors": "Takahashi K, Avissar N, Whitin J, Cohen H", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "3619451", "url": "https://glygen.org/publication/PubMed/3619451" } ] }, { "title": "Characterization of the major hydroperoxide-reducing activity of human plasma. Purification and properties of a selenium-dependent glutathione peroxidase.", "journal": "The Journal of biological chemistry", "date": "1987", "authors": "Maddipati KR, Marnett LJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "3693360", "url": "https://glygen.org/publication/PubMed/3693360" } ] }, { "title": "CRISPR/Cas9 screens unravel miR-3689a-3p regulating sorafenib resistance in hepatocellular carcinoma via suppressing CCS/SOD1-dependent mitochondrial oxidative stress.", "journal": "Drug resistance updates : reviews and commentaries in antimicrobial and anticancer chemotherapy", "date": "2023-11", "authors": "Lu Yuanjun, Chan Yau-Tuen, Wu Junyu, Feng Zixin, Yuan Hongchao, Li Qiucheng, Xing Tingyuan, Xu Lin, Zhang Cheng, Tan Hor-Yue, Lee Terence Kin-Wah, Feng Yibin, Wang Ning", "evidence": [ { "database": "RefSeq", "id": "NP_005116", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_005116" } ], "reference": [ { "type": "PubMed", "id": "37924725", "url": "https://glygen.org/publication/PubMed/37924725" } ] }, { "title": "Superoxide dismutase. An enzymic function for erythrocuprein (hemocuprein).", "journal": "The Journal of biological chemistry", "date": "1969", "authors": "McCord JM, Fridovich I", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "5389100", "url": "https://glygen.org/publication/PubMed/5389100" } ] }, { "title": "The reaction between the superoxide anion radical and cytochrome c.", "journal": "Biochimica et biophysica acta", "date": "1975", "authors": "Butler J, Jayson GG, Swallow AJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "60", "url": "https://glygen.org/publication/PubMed/60" } ] }, { "title": "Kinetics and mechanism of the reduction of ferricytochrome c by the superoxide anion.", "journal": "The Journal of biological chemistry", "date": "1982", "authors": "Butler J, Koppenol WH, Margoliash E", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "6286671", "url": "https://glygen.org/publication/PubMed/6286671" } ] }, { "title": "Human copper-containing superoxide dismutase of high molecular weight.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1982", "authors": "Marklund SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "6961438", "url": "https://glygen.org/publication/PubMed/6961438" } ] }, { "title": "Purification of superoxide dismutases from human placenta using immunoadsorbent columns.", "journal": "Journal of pharmacobio-dynamics", "date": "1981", "authors": "Sugiura M, Adachi T, Inoue H, Ito Y, Hirano K", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "7021796", "url": "https://glygen.org/publication/PubMed/7021796" } ] }, { "title": "Superoxide dismutase in extracellular fluids.", "journal": "Clinica chimica acta; international journal of clinical chemistry", "date": "1982", "authors": "Marklund SL, Holme E, Hellner L", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "7172448", "url": "https://glygen.org/publication/PubMed/7172448" } ] }, { "title": "Human diadenosine 5',5`'-P1,P4-tetraphosphate pyrophosphohydrolase is a member of the MutT family of nucleotide pyrophosphatases.", "journal": "The Biochemical journal", "date": "1995", "authors": "Thorne NM, Hankin S, Wilkinson MC, Nunez C, Barraclough R, McLennan AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "7487923", "url": "https://glygen.org/publication/PubMed/7487923" } ] }, { "title": "Purification and properties of human erythrocyte glutathione peroxidase.", "journal": "The Journal of biological chemistry", "date": "1975", "authors": "Awasthi YC, Beutler E, Srivastava SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "807573", "url": "https://glygen.org/publication/PubMed/807573" } ] }, { "title": "Heparin-affinity patterns and composition of extracellular superoxide dismutase in human plasma and tissues.", "journal": "The Biochemical journal", "date": "1993", "authors": "Sandstrom J, Karlsson K, Edlund T, Marklund SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "8379940", "url": "https://glygen.org/publication/PubMed/8379940" } ] }, { "title": "Expression, characterization, and tissue distribution of a new cellular selenium-dependent glutathione peroxidase, GSHPx-GI.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Chu FF, Doroshow JH, Esworthy RS", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "8428933", "url": "https://glygen.org/publication/PubMed/8428933" } ] }, { "title": "Proteolytic modification of the heparin-binding affinity of extracellular superoxide dismutase.", "journal": "The Biochemical journal", "date": "1993", "authors": "Karlsson K, Edlund A, Sandstrom J, Marklund SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "8452552", "url": "https://glygen.org/publication/PubMed/8452552" } ] }, { "title": "Catalytic properties of human manganese superoxide dismutase.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Hsu JL, Hsieh Y, Tu C, O'Connor D, Nick HS, Silverman DN", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "8663465", "url": "https://glygen.org/publication/PubMed/8663465" } ] }, { "title": "The copper chaperone for superoxide dismutase.", "journal": "J. Biol. Chem.", "date": "1997", "authors": "Culotta VC, Klomp LW, Strain J, Casareno RL, Krems B, Gitlin JD", "evidence": [ { "database": "UniProtKB", "id": "O14618", "url": "https://www.uniprot.org/uniprot/O14618" }, { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "9295278", "url": "https://glygen.org/publication/PubMed/9295278" } ] }, { "title": "High protonic potential actuates a mechanism of production of reactive oxygen species in mitochondria.", "journal": "FEBS letters", "date": "1997", "authors": "Korshunov SS, Skulachev VP, Starkov AA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "9369223", "url": "https://glygen.org/publication/PubMed/9369223" } ] }, { "title": "The majority of human glutathione peroxidase type 5 (GPX5) transcripts are incorrectly spliced: implications for the role of GPX5 in the male reproductive tract.", "journal": "The Biochemical journal", "date": "1998", "authors": "Hall L, Williams K, Perry AC, Frayne J, Jury JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "9639555", "url": "https://glygen.org/publication/PubMed/9639555" } ] }, { "title": "The copper chaperone CCS directly interacts with copper/zinc superoxide dismutase.", "journal": "J. Biol. Chem.", "date": "1998", "authors": "Casareno RL, Waggoner D, Gitlin JD", "evidence": [ { "database": "UniProtKB", "id": "O14618", "url": "https://www.uniprot.org/uniprot/O14618" }, { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "9726962", "url": "https://glygen.org/publication/PubMed/9726962" } ] }, { "title": "Cloning, sequencing and functional expression of a novel human thioredoxin reductase.", "journal": "FEBS letters", "date": "1999", "authors": "Gasdaska PY, Berggren MM, Berry MJ, Powis G", "evidence": [ { "database": "Reactome", "id": "R-HSA-3299685", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685" } ], "reference": [ { "type": "PubMed", "id": "9923614", "url": "https://glygen.org/publication/PubMed/9923614" } ] } ], "pathway": [ { "id": "hsa:9973", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:9973", "resource": "KEGG Pathway" }, { "id": "R-HSA-3299685", "name": "Detoxification of Reactive Oxygen Species", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-3299685", "resource": "Reactome", "description": "Detoxification of Reactive Oxygen Species" } ], "orthologs": [ { "uniprot_canonical_ac": "E1JH26-1", "protein_name": "Superoxide dismutase [Cu-Zn]", "gene_name": "Ccs", "tax_id": 7227, "organism": "Drosophila melanogaster", "sequence": { "sequence": "MSSIKIEFAVQMRRGDESYAGALRSALDGVGQVEIDTQEGRVIIQTQRPWSEIQDKIEATGVRAVLSGFGGQSAVALINTTGSVVDKTPIQGVVRFTTITADKKPGVVVDGVVDGLSPGLHGLHIHESGDTSAGCSSVGEHYNPRQSPHGSPAAGAEERHAGDLGNIRADENGRATFRFVDPVLEVWDIIGRAVVLTANADDLGRGGNDQSLIDGNSGERIACGIIARSAGILENFKRICACDGVTLWDERNKPLAGKERSQKL", "length": 264 }, "evidence": [ { "id": "O14618", "url": "https://omabrowser.org/oma/group/O14618/", "database": "OMA" } ], "common_name": "Fruit fly" }, { "uniprot_canonical_ac": "P40202-1", "protein_name": "Superoxide dismutase 1 copper chaperone", "gene_name": "CCS1", "tax_id": 559292, "organism": "Saccharomyces cerevisiae S288C", "sequence": { "sequence": "MTTNDTYEATYAIPMHCENCVNDIKACLKNVPGINSLNFDIEQQIMSVESSVAPSTIINTLRNCGKDAIIRGAGKPNSSAVAILETFQKYTIDQKKDTAVRGLARIVQVGENKTLFDITVNGVPEAGNYHASIHEKGDVSKGVESTGKVWHKFDEPIECFNESDLGKNLYSGKTFLSAPLPTWQLIGRSFVISKSLNHPENEPSSVKDYSFLGVIARSAGVWENNKQVCACTGKTVWEERKDALANNIK", "length": 249 }, "evidence": [ { "id": "O14618", "url": "https://omabrowser.org/oma/group/O14618/", "database": "OMA" } ], "common_name": "Yeast" }, { "uniprot_canonical_ac": "Q9JK72-1", "protein_name": "Copper chaperone for superoxide dismutase", "gene_name": "Ccs", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MASKSGDGGTMCALEFTVQMSCQSCVDAVHKTLKGAAGVQNVEVQLENQMVLVQTTLPSQEVQALLESTGRQAVLKGMGSSQLKNLGAAVAIMEGSGTVQGVVRFLQLSSELCLIEGTIDGLEPGLHGLHVHQYGDLTKDCSSCGDHFNPDGASHGGPQDTDRHRGDLGNVHAEASGRATFRIEDKQLKVWDVIGRSLVVDEGEDDLGRGGHPLSKVTGNSGKRLACGIIARSAGLFQNPKQICSCDGLTIWEERGRPIAGQGRKDSAQPPAHL", "length": 274 }, "evidence": [ { "id": "45923448", "url": "http://www.informatics.jax.org/homology/45923448", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q9WU84-1", "protein_name": "Copper chaperone for superoxide dismutase", "gene_name": "Ccs", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MASKSGDGGTVCALEFAVQMSCQSCVDAVHKTLKGVAGVQNVDVQLENQMVLVQTTLPSQEVQALLESTGRQAVLKGMGSSQLQNLGAAVAILEGCGSIQGVVRFLQLSSELCLIEGTIDGLEPGLHGLHVHQYGDLTRDCNSCGDHFNPDGASHGGPQDTDRHRGDLGNVRAEAGGRATFRIEDKQLKVWDVIGRSLVIDEGEDDLGRGGHPLSKITGNSGKRLACGIIARSAGLFQNPKQICSCDGLTIWEERGRPIAGQGRKDSAQPPAHL", "length": 274 }, "evidence": [ { "id": "45923448", "url": "http://www.informatics.jax.org/homology/45923448", "database": "MGI" }, { "id": "O14618", "url": "https://omabrowser.org/oma/group/O14618/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Cellular Component", "total": 3, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "O14618", "url": "https://www.uniprot.org/uniprot/O14618" } ], "pmid": "" }, { "name": "cytoplasm", "id": "GO:0005737", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005737", "evidence": [ { "database": "UniProtKB", "id": "O14618", "url": "https://www.uniprot.org/uniprot/O14618" } ], "pmid": "" }, { "name": "cytosol", "id": "GO:0005829", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005829", "evidence": [ { "database": "UniProtKB", "id": "O14618", "url": "https://www.uniprot.org/uniprot/O14618" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "cadherin binding", "id": "GO:0045296", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045296", "evidence": [ { "database": "UniProtKB", "id": "O14618", "url": "https://www.uniprot.org/uniprot/O14618" } ], "pmid": "" }, { "name": "copper ion binding", "id": "GO:0005507", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005507", "evidence": [ { "database": "UniProtKB", "id": "O14618", "url": "https://www.uniprot.org/uniprot/O14618" } ], "pmid": "" }, { "name": "protein-disulfide reductase activity", "id": "GO:0015035", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015035", "evidence": [ { "database": "UniProtKB", "id": "O14618", "url": "https://www.uniprot.org/uniprot/O14618" } ], "pmid": "" }, { "name": "superoxide dismutase copper chaperone activity", "id": "GO:0016532", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016532", "evidence": [ { "database": "UniProtKB", "id": "O14618", "url": "https://www.uniprot.org/uniprot/O14618" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 4, "go_terms": [ { "name": "cellular response to oxidative stress", "id": "GO:0034599", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034599", "evidence": [ { "database": "UniProtKB", "id": "O14618", "url": "https://www.uniprot.org/uniprot/O14618" } ], "pmid": "" }, { "name": "removal of superoxide radicals", "id": "GO:0019430", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0019430", "evidence": [ { "database": "UniProtKB", "id": "O14618", "url": "https://www.uniprot.org/uniprot/O14618" } ], "pmid": "" }, { "name": "protein maturation by copper ion transfer", "id": "GO:0015680", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0015680", "evidence": [ { "database": "UniProtKB", "id": "O14618", "url": "https://www.uniprot.org/uniprot/O14618" } ], "pmid": "" }, { "name": "superoxide metabolic process", "id": "GO:0006801", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006801", "evidence": [ { "database": "UniProtKB", "id": "O14618", "url": "https://www.uniprot.org/uniprot/O14618" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [ { "annotation": "Ubiquitinion by XIAP/BIRC4 leads to enhancement of its chaperone activity toward its physiologic target, SOD1, rather than proteasomal degradation. XIAP/BIRC4 preferentially ubiquitinates at Lys-241.", "evidence": [ { "database": "UniProtKB", "id": "O14618", "url": "https://www.uniprot.org/uniprot/O14618" }, { "database": "PubMed", "id": "20154138", "url": "https://glygen.org/publication/PubMed/20154138" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.oma", "label": "OMA Homologs" }, { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [ 267 ], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 89 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }