{ "uniprot_canonical_ac": "O14610-1", "uniprot_ac": "O14610", "uniprot_id": "GBGT2_HUMAN", "mass": { "chemical_mass": 7747.0, "monoisotopic_mass": 7747.0 }, "refseq": { "ac": "NP_001185683", "name": "guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2", "summary": "Phototransduction in rod and cone photoreceptors is regulated by groups of signaling proteins. The encoded protein is thought to play a crucial role in cone phototransduction. It belongs to the G protein gamma family and localized specifically in cones. Several transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Nov 2010].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001185683" }, "gene_names": [ { "name": "GNGT2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O14610", "id": "O14610" }, { "name": "G-GAMMA-8; G-GAMMA-C; GNG9; GNGT8; HG3I", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001185683", "id": "NP_001185683" }, { "name": "GNG8", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O14610", "id": "O14610" }, { "name": "GNG9", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O14610", "id": "O14610" }, { "name": "GNGT2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001185683", "id": "NP_001185683" }, { "name": "GNGT8", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O14610", "id": "O14610" } ], "protein_names": [ { "name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O14610" }, { "name": "G gamma-C", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O14610" }, { "name": "G-gamma-8", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O14610" }, { "name": "G-gamma-9", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O14610" }, { "name": "Guanine nucleotide binding protein gamma transducing activity polypeptide 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O14610" }, { "name": "gamma-T2 subunit; G protein cone gamma 8 subunit; guanine nucleotide binding protein gamma 9; G-gamma-9; g gamma-C; guanine nucleotide binding protein gamma transducing activity polypeptide 2; guanine nucleotide binding protein (G protein), gamma transducing activity polypeptide 2; heterotrimeric guanine nucleotide-binding protein 3I", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001185683", "id": "NP_001185683" }, { "name": "guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001185683", "id": "NP_001185683" } ], "function": [ { "annotation": "Gbetagamma translocation to the Golgi apparatus activates ARF1 to spatiotemporally regulate G protein-coupled receptor signaling to MAPK.", "evidence": [ { "database": "RefSeq", "id": "NP_001185683", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001185683" }, { "database": "PubMed", "id": "34022220", "url": "https://glygen.org/publication/PubMed/34022220" } ] }, { "annotation": "Guanine nucleotide-binding proteins (G proteins) are involved as a modulator or transducer in various transmembrane signaling systems. The beta and gamma chains are required for the GTPase activity, for replacement of GDP by GTP, and for G protein-effector interaction.", "evidence": [ { "database": "UniProtKB", "id": "O14610", "url": "https://www.uniprot.org/uniprot/O14610#function" }, { "database": "UniProtKB", "id": "D6RDH5", "url": "https://www.uniprot.org/uniprot/D6RDH5#function" }, { "database": "UniProtKB", "id": "RU004973", "url": "https://www.uniprot.org/uniprot/RU004973#function" } ] }, { "annotation": "Integrated genomics analysis highlights important SNPs and genes implicated in moderate-to-severe asthma based on GWAS and eQTL datasets. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_001185683", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001185683" }, { "database": "PubMed", "id": "33066754", "url": "https://glygen.org/publication/PubMed/33066754" } ] }, { "annotation": "Phototransduction in rod and cone photoreceptors is regulated by groups of signaling proteins. The encoded protein is thought to play a crucial role in cone phototransduction. It belongs to the G protein gamma family and localized specifically in cones. Several transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Nov 2010].", "evidence": [ { "database": "RefSeq", "id": "NP_001185683", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001185683" } ] }, { "annotation": "Results identify novel functions of beta-arrestin1 in binding to the beta1gamma2 subunits of heterotrimeric G-proteins and promoting G(betagamma)-mediated Akt signalling for NF-kappaB activation.", "evidence": [ { "database": "RefSeq", "id": "NP_001185683", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001185683" }, { "database": "PubMed", "id": "18729826", "url": "https://glygen.org/publication/PubMed/18729826" } ] }, { "annotation": "Survival analysis showed that G protein subunit gamma transducin 2 (GNGT2) was closely related to survival of esophageal cancer. Expression of GNGT2 was evaluated by quantitative real time polymerase chain reaction, and the results showed that GNGT2 expression was significantly upregulated in esophageal cancer patient samples and cell lines, and that GNGT2 could promote the proliferation of esophageal cancer cell lines.", "evidence": [ { "database": "RefSeq", "id": "NP_001185683", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001185683" }, { "database": "PubMed", "id": "31908393", "url": "https://glygen.org/publication/PubMed/31908393" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "67.95", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000167083", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000167083" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "58.66", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000167083", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000167083" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "67.11", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000167083", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000167083" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "72.92", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000167083", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000167083" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "77.91", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000167083", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000167083" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "65.33", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000167083", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000167083" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "70.61", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000167083", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000167083" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "61.66", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000167083", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000167083" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "68.22", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000167083", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000167083" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "65.13", "present": "MEDIUM", "evidence": [ { "database": "Bgee", "id": "ENSG00000167083", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000167083" } ] } ], "expression_disease": [ { "significant": "No", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O14610", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14610" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O14610", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14610" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O14610", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14610" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O14610", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14610" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O14610", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14610" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O14610", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14610" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O14610", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14610" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O14610", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14610" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O14610", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14610" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O14610", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14610" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O14610", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14610" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O14610", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14610" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O14610", "url": "https://www.uniprot.org/uniprot/O14610" } ], "common_name": "Human" } ], "gene": [ { "name": "GNGT2", "url": "https://www.uniprot.org/uniprot/O14610", "locus": { "chromosome": "17", "start_pos": 49202791, "end_pos": 49210574, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000167083", "url": "https://www.ensembl.org/id/ENSG00000167083" } ] } } ], "crossref": [ { "id": "ENSG00000167083", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000167083", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd00068", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd00068", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "GNGT2", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=GNGT2", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "2793", "url": "https://www.ncbi.nlm.nih.gov/gene/2793", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "4412", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=4412", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "IPR001770", "url": "https://www.ebi.ac.uk/interpro/entry/IPR001770", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR015898", "url": "https://www.ebi.ac.uk/interpro/entry/IPR015898", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036284", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036284", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:2793", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:2793", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "139391", "url": "http://www.omim.org/entry/139391", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O14610", "url": "https://www.nextprot.org/entry/NX_O14610", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "SWLEIAW", "url": "https://omabrowser.org/oma/group/SWLEIAW/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5344095at2759", "url": "http://www.orthodb.org/?query=5344095at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR13809", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13809", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR13809:SF28", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR13809:SF28", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF00631", "url": "http://pfam.xfam.org/family/PF00631", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O14610", "url": "https://pharos.nih.gov/targets/O14610", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O14610", "url": "http://purl.obolibrary.org/obo/PR_O14610", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-1296041", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1296041", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-202040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202040", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-392170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-392170", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-392451", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-392451", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-392851", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-392851", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-400042", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400042", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-418217", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418217", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-418592", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418592", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-418594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418594", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-418597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418597", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-420092", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-420092", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-428930", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-428930", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-432040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432040", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-456926", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-456926", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-500657", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-500657", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6814122", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6814122", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8964315", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964315", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-8964616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964616", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9634597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634597", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-9660821", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9660821", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-997272", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-997272", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_001185683", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001185683", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "D6RDH5", "url": "https://www.uniprot.org/uniprot/D6RDH5", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "D6RDH5-1", "url": "https://www.uniprot.org/uniprot/D6RDH5-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O14610", "url": "https://www.uniprot.org/uniprot/O14610", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O14610-1", "url": "https://www.uniprot.org/uniprot/O14610-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS", "length": 69, "header": "sp|O14610-1|GBGT2_HUMAN Isoform 1 of Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2 OS=Homo sapiens OX=9606 GN=GNGT2 PE=2 SV=1 CANONICAL=O14610-1" }, "isoforms": [ { "isoform_ac": "D6RDH5-1", "url": "", "sequence": { "sequence": "MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGPTFNALLLLLGRASWLELTWSRTP", "length": 88, "header": "tr|D6RDH5-1|D6RDH5_HUMAN Computationally mapped isoform of Guanine nucleotide-binding protein subunit gamma OS=Homo sapiens OX=9606 GN=GNGT2 PE=1 SV=1 CANONICAL=O14610-1" }, "locus": { "chromosome": "17", "start_pos": 49207422, "end_pos": 49202959, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000503070.5", "url": "https://www.ensembl.org/id/ENST00000503070.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000420946.1", "url": "https://www.ensembl.org/id/ENSP00000420946.1" } ] } }, { "isoform_ac": "O14610-1", "url": "", "sequence": { "sequence": "MAQDLSEKDLLKMEVEQLKKEVKNTRIPISKAGKEIKEYVEAQAGNDPFLKGIPEDKNPFKEKGGCLIS", "length": 69, "header": "sp|O14610-1|GBGT2_HUMAN Isoform 1 of Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2 OS=Homo sapiens OX=9606 GN=GNGT2 PE=2 SV=1 CANONICAL=O14610-1" }, "locus": { "chromosome": "17", "start_pos": 49207422, "end_pos": 49206760, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000511277.5", "url": "https://www.ensembl.org/id/ENST00000511277.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000426022.1", "url": "https://www.ensembl.org/id/ENSP00000426022.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "Genomic organization of the human galpha14 and Galphaq genes and mutation analysis in chorea-acanthocytosis (CHAC).", "journal": "Genomics", "date": "1999", "authors": "Rubio JP, Levy ER, Dobson-Stone C, Monaco AP", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "10191087", "url": "https://glygen.org/publication/PubMed/10191087" } ] }, { "title": "Nonselective coupling of the human mu-opioid receptor to multiple inhibitory G-protein isoforms.", "journal": "European journal of biochemistry", "date": "1999", "authors": "Gaibelet G, Meilhoc E, Riond J, Saves I, Exner T, Liaubet L, Nurnberg B, Masson JM, Emorine LJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-202040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202040" } ], "reference": [ { "type": "PubMed", "id": "10215864", "url": "https://glygen.org/publication/PubMed/10215864" } ] }, { "title": "cAMP-dependent mobilization of intracellular Ca2+ stores by activation of ryanodine receptors in pancreatic beta-cells. A Ca2+ signaling system stimulated by the insulinotropic hormone glucagon-like peptide-1-(7-37).", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Holz GG, Leech CA, Heller RS, Castonguay M, Habener JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "10318832", "url": "https://glygen.org/publication/PubMed/10318832" } ] }, { "title": "Enhancement of insulin-like growth factor signaling in human breast cancer: estrogen regulation of insulin receptor substrate-1 expression in vitro and in vivo.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "1999", "authors": "Lee AV, Jackson JG, Gooch JL, Hilsenbeck SG, Coronado-Heinsohn E, Osborne CK, Yee D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "10319328", "url": "https://glygen.org/publication/PubMed/10319328" } ] }, { "title": "Glucagon-like Peptide 2.", "journal": "Trends in endocrinology and metabolism: TEM", "date": "1999", "authors": "Drucker DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-420092", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-420092" } ], "reference": [ { "type": "PubMed", "id": "10322410", "url": "https://glygen.org/publication/PubMed/10322410" } ] }, { "title": "WRM-1 activates the LIT-1 protein kinase to transduce anterior/posterior polarity signals in C. elegans.", "journal": "Cell", "date": "1999", "authors": "Rocheleau CE, Yasuda J, Shin TH, Lin R, Sawa H, Okano H, Priess JR, Davis RJ, Mello CC", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "10380924", "url": "https://glygen.org/publication/PubMed/10380924" } ] }, { "title": "MAP kinase and Wnt pathways converge to downregulate an HMG-domain repressor in Caenorhabditis elegans.", "journal": "Nature", "date": "1999", "authors": "Meneghini MD, Ishitani T, Carter JC, Hisamoto N, Ninomiya-Tsuji J, Thorpe CJ, Hamill DR, Matsumoto K, Bowerman B", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "10391246", "url": "https://glygen.org/publication/PubMed/10391246" } ] }, { "title": "The TAK1-NLK-MAPK-related pathway antagonizes signalling between beta-catenin and transcription factor TCF.", "journal": "Nature", "date": "1999", "authors": "Ishitani T, Ninomiya-Tsuji J, Nagai S, Nishita M, Meneghini M, Barker N, Waterman M, Bowerman B, Clevers H, Shibuya H, Matsumoto K", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "10391247", "url": "https://glygen.org/publication/PubMed/10391247" } ] }, { "title": "Protein kinase C is differentially stimulated by Wnt and Frizzled homologs in a G-protein-dependent manner.", "journal": "Current biology : CB", "date": "1999", "authors": "Sheldahl LC, Park M, Malbon CC, Moon RT", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "10395542", "url": "https://glygen.org/publication/PubMed/10395542" } ] }, { "title": "Shc and FAK differentially regulate cell motility and directionality modulated by PTEN.", "journal": "The Journal of cell biology", "date": "1999", "authors": "Gu J, Tamura M, Pankov R, Danen EH, Takino T, Matsumoto K, Yamada KM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "10427092", "url": "https://glygen.org/publication/PubMed/10427092" } ] }, { "title": "Regions on adenylyl cyclase that are necessary for inhibition of activity by beta gamma and G(ialpha) subunits of heterotrimeric G proteins.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Wittpoth C, Scholich K, Yigzaw Y, Stringfield TM, Patel TB", "evidence": [ { "database": "Reactome", "id": "R-HSA-400042", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400042" } ], "reference": [ { "type": "PubMed", "id": "10449730", "url": "https://glygen.org/publication/PubMed/10449730" } ] }, { "title": "MOM-4, a MAP kinase kinase kinase-related protein, activates WRM-1/LIT-1 kinase to transduce anterior/posterior polarity signals in C. elegans.", "journal": "Molecular cell", "date": "1999", "authors": "Shin TH, Yasuda J, Rocheleau CE, Lin R, Soto M, Bei Y, Davis RJ, Mello CC", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "10488343", "url": "https://glygen.org/publication/PubMed/10488343" } ] }, { "title": "Characterization of human A(2B) adenosine receptors: radioligand binding, western blotting, and coupling to G(q) in human embryonic kidney 293 cells and HMC-1 mast cells.", "journal": "Molecular pharmacology", "date": "1999", "authors": "Linden J, Thai T, Figler H, Jin X, Robeva AS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9660821", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9660821" } ], "reference": [ { "type": "PubMed", "id": "10496952", "url": "https://glygen.org/publication/PubMed/10496952" } ] }, { "title": "Selective regulation of Galpha(q/11) by an RGS domain in the G protein-coupled receptor kinase, GRK2.", "journal": "The Journal of biological chemistry", "date": "1999", "authors": "Carman CV, Parent JL, Day PW, Pronin AN, Sternweis PM, Wedegaertner PB, Gilman AG, Benovic JL, Kozasa T", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "10567430", "url": "https://glygen.org/publication/PubMed/10567430" } ] }, { "title": "Activation of a frizzled-2/beta-adrenergic receptor chimera promotes Wnt signaling and differentiation of mouse F9 teratocarcinoma cells via Galphao and Galphat.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Liu X, Liu T, Slusarski DC, Yang-Snyder J, Malbon CC, Moon RT, Wang H", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "10588714", "url": "https://glygen.org/publication/PubMed/10588714" } ] }, { "title": "The utilization of recombinant prostanoid receptors to determine the affinities and selectivities of prostaglandins and related analogs.", "journal": "Biochimica et biophysica acta", "date": "2000", "authors": "Abramovitz M, Adam M, Boie Y, Carriere M, Denis D, Godbout C, Lamontagne S, Rochette C, Sawyer N, Tremblay NM, Belley M, Gallant M, Dufresne C, Gareau Y, Ruel R, Juteau H, Labelle M, Ouimet N, Metters KM", "evidence": [ { "database": "Reactome", "id": "R-HSA-392851", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-392851" } ], "reference": [ { "type": "PubMed", "id": "10634944", "url": "https://glygen.org/publication/PubMed/10634944" } ] }, { "title": "Mutagenesis in the switch IV of the helical domain of the human Gsalpha reduces its GDP/GTP exchange rate.", "journal": "Journal of cellular biochemistry", "date": "2000", "authors": "Echeverria V, Hinrichs MV, Torrejon M, Ropero S, Martinez J, Toro MJ, Olate J", "evidence": [ { "database": "Reactome", "id": "R-HSA-432040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432040" } ], "reference": [ { "type": "PubMed", "id": "10649434", "url": "https://glygen.org/publication/PubMed/10649434" } ] }, { "title": "Osteoblast-derived cells express functional glucose-dependent insulinotropic peptide receptors.", "journal": "Endocrinology", "date": "2000", "authors": "Bollag RJ, Zhong Q, Phillips P, Min L, Zhong L, Cameron R, Mulloy AL, Rasmussen H, Qin F, Ding KH, Isales CM", "evidence": [ { "database": "Reactome", "id": "R-HSA-420092", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-420092" } ], "reference": [ { "type": "PubMed", "id": "10698200", "url": "https://glygen.org/publication/PubMed/10698200" } ] }, { "title": "Cooperative effect of hepatocyte growth factor and fibronectin in anchorage-independent survival of mammary carcinoma cells: requirement for phosphatidylinositol 3-kinase activity.", "journal": "Cell growth & differentiation : the molecular biology journal of the American Association for Cancer Research", "date": "2000", "authors": "Qiao H, Saulnier R, Patryzkat A, Rahimi N, Raptis L, Rossiter J, Tremblay E, Elliott B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634597" } ], "reference": [ { "type": "PubMed", "id": "10714768", "url": "https://glygen.org/publication/PubMed/10714768" } ] }, { "title": "Selective regulation of Gq signaling by G protein-coupled receptor kinase 2: direct interaction of kinase N terminus with activated galphaq.", "journal": "Molecular pharmacology", "date": "2000", "authors": "Sallese M, Mariggio S, D'Urbano E, Iacovelli L, De Blasi A", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "10727532", "url": "https://glygen.org/publication/PubMed/10727532" } ] }, { "title": "Estrogen receptor alpha rapidly activates the IGF-1 receptor pathway.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Kahlert S, Nuedling S, van Eickels M, Vetter H, Meyer R, Grohe C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "10749889", "url": "https://glygen.org/publication/PubMed/10749889" } ] }, { "title": "The P2Y1 receptor mediates ADP-induced p38 kinase-activating factor generation in human platelets.", "journal": "European journal of biochemistry", "date": "2000", "authors": "Dangelmaier C, Jin J, Daniel JL, Smith JB, Kunapuli SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-418592", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418592" } ], "reference": [ { "type": "PubMed", "id": "10759852", "url": "https://glygen.org/publication/PubMed/10759852" } ] }, { "title": "Ca(2+)/calmodulin-dependent protein kinase II is stimulated by Wnt and Frizzled homologs and promotes ventral cell fates in Xenopus.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Kuhl M, Sheldahl LC, Malbon CC, Moon RT", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "10777564", "url": "https://glygen.org/publication/PubMed/10777564" } ] }, { "title": "FAK integrates growth-factor and integrin signals to promote cell migration.", "journal": "Nature cell biology", "date": "2000", "authors": "Sieg DJ, Hauck CR, Ilic D, Klingbeil CK, Schaefer E, Damsky CH, Schlaepfer DD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "10806474", "url": "https://glygen.org/publication/PubMed/10806474" } ] }, { "title": "The Wnt/Ca2+ pathway: a new vertebrate Wnt signaling pathway takes shape.", "journal": "Trends in genetics : TIG", "date": "2000", "authors": "Kuhl M, Sheldahl LC, Park M, Miller JR, Moon RT", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "10858654", "url": "https://glygen.org/publication/PubMed/10858654" } ] }, { "title": "G protein-coupled receptor kinase-5 regulates thrombin-activated signaling in endothelial cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2000", "authors": "Tiruppathi C, Yan W, Sandoval R, Naqvi T, Pronin AN, Benovic JL, Malik AB", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "10861009", "url": "https://glygen.org/publication/PubMed/10861009" } ] }, { "title": "Loss of signaling through the G protein, Gz, results in abnormal platelet activation and altered responses to psychoactive drugs.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2000", "authors": "Yang J, Wu J, Kowalska MA, Dalvi A, Prevost N, O'Brien PJ, Manning D, Poncz M, Lucki I, Blendy JA, Brass LF", "evidence": [ { "database": "Reactome", "id": "R-HSA-418597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418597" } ], "reference": [ { "type": "PubMed", "id": "10954748", "url": "https://glygen.org/publication/PubMed/10954748" } ] }, { "title": "Src tyrosine kinase is a novel direct effector of G proteins.", "journal": "Cell", "date": "2000", "authors": "Ma YC, Huang J, Ali S, Lowry W, Huang XY", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "11007482", "url": "https://glygen.org/publication/PubMed/11007482" } ] }, { "title": "Structure, function, and control of phosphoinositide-specific phospholipase C.", "journal": "Physiological reviews", "date": "2000", "authors": "Rebecchi MJ, Pentyala SN", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "11015615", "url": "https://glygen.org/publication/PubMed/11015615" } ] }, { "title": "Interaction of oestrogen receptor with the regulatory subunit of phosphatidylinositol-3-OH kinase.", "journal": "Nature", "date": "2000", "authors": "Simoncini T, Hafezi-Moghadam A, Brazil DP, Ley K, Chin WW, Liao JK", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "11029009", "url": "https://glygen.org/publication/PubMed/11029009" } ] }, { "title": "Membrane estrogen receptor engagement activates endothelial nitric oxide synthase via the PI3-kinase-Akt pathway in human endothelial cells.", "journal": "Circulation research", "date": "2000", "authors": "Haynes MP, Sinha D, Russell KS, Collinge M, Fulton D, Morales-Ruiz M, Sessa WC, Bender JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "11029403", "url": "https://glygen.org/publication/PubMed/11029403" } ] }, { "title": "Concerted dephosphorylation of the transcription factor NFAT1 induces a conformational switch that regulates transcriptional activity.", "journal": "Molecular cell", "date": "2000", "authors": "Okamura H, Aramburu J, Garcia-Rodriguez C, Viola JP, Raghavan A, Tahiliani M, Zhang X, Qin J, Hogan PG, Rao A", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "11030334", "url": "https://glygen.org/publication/PubMed/11030334" } ] }, { "title": "Structural determinants of water permeation through aquaporin-1.", "journal": "Nature", "date": "2000", "authors": "Murata K, Mitsuoka K, Hirai T, Walz T, Agre P, Heymann JB, Engel A, Fujiyoshi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-432040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432040" } ], "reference": [ { "type": "PubMed", "id": "11034202", "url": "https://glygen.org/publication/PubMed/11034202" } ] }, { "title": "Estrogen-induced activation of Erk-1 and Erk-2 requires the G protein-coupled receptor homolog, GPR30, and occurs via trans-activation of the epidermal growth factor receptor through release of HB-EGF.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2000", "authors": "Filardo EJ, Quinn JA, Bland KI, Frackelton AR Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "11043579", "url": "https://glygen.org/publication/PubMed/11043579" } ] }, { "title": "Estrogen induces the Akt-dependent activation of endothelial nitric-oxide synthase in vascular endothelial cells.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Hisamoto K, Ohmichi M, Kurachi H, Hayakawa J, Kanda Y, Nishio Y, Adachi K, Tasaka K, Miyoshi E, Fujiwara N, Taniguchi N, Murata Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "11044445", "url": "https://glygen.org/publication/PubMed/11044445" } ] }, { "title": "Human secretin (SCT): gene structure, chromosome location, and distribution of mRNA.", "journal": "Cytogenetics and cell genetics", "date": "2000", "authors": "Whitmore TE, Holloway JL, Lofton-Day CE, Maurer MF, Chen L, Quinton TJ, Vincent JB, Scherer SW, Lok S", "evidence": [ { "database": "Reactome", "id": "R-HSA-420092", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-420092" } ], "reference": [ { "type": "PubMed", "id": "11060443", "url": "https://glygen.org/publication/PubMed/11060443" } ] }, { "title": "Expression of cAMP-regulated guanine nucleotide exchange factors in pancreatic beta-cells.", "journal": "Biochemical and biophysical research communications", "date": "2000", "authors": "Leech CA, Holz GG, Chepurny O, Habener JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "11071853", "url": "https://glygen.org/publication/PubMed/11071853" } ] }, { "title": "The subcellular localization of an aquaporin-2 tetramer depends on the stoichiometry of phosphorylated and nonphosphorylated monomers.", "journal": "The Journal of cell biology", "date": "2000", "authors": "Kamsteeg EJ, Heijnen I, van Os CH, Deen PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-432040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432040" } ], "reference": [ { "type": "PubMed", "id": "11076974", "url": "https://glygen.org/publication/PubMed/11076974" } ] }, { "title": "Sphingosine 1-phosphate activates Erk-1/-2 by transactivating epidermal growth factor receptor in rat-2 cells.", "journal": "IUBMB life", "date": "2000", "authors": "Kim JH, Kim JH, Song WK, Kim JH, Chun JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "11185956", "url": "https://glygen.org/publication/PubMed/11185956" } ] }, { "title": "Identification of the platelet ADP receptor targeted by antithrombotic drugs.", "journal": "Nature", "date": "2001", "authors": "Hollopeter G, Jantzen HM, Vincent D, Li G, England L, Ramakrishnan V, Yang RB, Nurden P, Nurden A, Julius D, Conley PB", "evidence": [ { "database": "Reactome", "id": "R-HSA-392170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-392170" } ], "reference": [ { "type": "PubMed", "id": "11196645", "url": "https://glygen.org/publication/PubMed/11196645" } ] }, { "title": "Membrane blebbing during apoptosis results from caspase-mediated activation of ROCK I.", "journal": "Nature cell biology", "date": "2001", "authors": "Coleman ML, Sahai EA, Yeo M, Bosch M, Dewar A, Olson MF", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "11283606", "url": "https://glygen.org/publication/PubMed/11283606" } ] }, { "title": "Arachidonic acid-induced Ca2+ sensitization of smooth muscle contraction through activation of Rho-kinase.", "journal": "Pflugers Archiv : European journal of physiology", "date": "2001", "authors": "Araki S, Ito M, Kureishi Y, Feng J, Machida H, Isaka N, Amano M, Kaibuchi K, Hartshorne DJ, Nakano T", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "11294240", "url": "https://glygen.org/publication/PubMed/11294240" } ] }, { "title": "G(z) signaling: emerging divergence from G(i) signaling.", "journal": "Oncogene", "date": "2001", "authors": "Ho MK, Wong YH", "evidence": [ { "database": "Reactome", "id": "R-HSA-418597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418597" } ], "reference": [ { "type": "PubMed", "id": "11313909", "url": "https://glygen.org/publication/PubMed/11313909" } ] }, { "title": "RGS-containing RhoGEFs: the missing link between transforming G proteins and Rho?", "journal": "Oncogene", "date": "2001", "authors": "Fukuhara S, Chikumi H, Gutkind JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "11313914", "url": "https://glygen.org/publication/PubMed/11313914" } ] }, { "title": "Plasma membrane estrogen receptors are coupled to endothelial nitric-oxide synthase through Galpha(i).", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Wyckoff MH, Chambliss KL, Mineo C, Yuhanna IS, Mendelsohn ME, Mumby SM, Shaul PW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "11369763", "url": "https://glygen.org/publication/PubMed/11369763" } ] }, { "title": "Wnt signaling and heterotrimeric G-proteins: strange bedfellows or a classic romance?", "journal": "Biochemical and biophysical research communications", "date": "2001", "authors": "Malbon CC, Wang H, Moon RT", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "11563835", "url": "https://glygen.org/publication/PubMed/11563835" } ] }, { "title": "PI3-kinase in concert with Src promotes the S-phase entry of oestradiol-stimulated MCF-7 cells.", "journal": "The EMBO journal", "date": "2001", "authors": "Castoria G, Migliaccio A, Bilancio A, Di Domenico M, de Falco A, Lombardi M, Fiorentino R, Varricchio L, Barone MV, Auricchio F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "11689445", "url": "https://glygen.org/publication/PubMed/11689445" } ] }, { "title": "G Protein beta gamma subunits act on the catalytic domain to stimulate Bruton's agammaglobulinemia tyrosine kinase.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Lowry WE, Huang XY", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964315", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964315" } ], "reference": [ { "type": "PubMed", "id": "11698416", "url": "https://glygen.org/publication/PubMed/11698416" } ] }, { "title": "Identification of a region in G protein gamma subunits conserved across species but hypervariable among subunit isoforms.", "journal": "Protein Sci.", "date": "2001", "authors": "Cook L A, Schey K L, Cleator J H, Wilcox M D, Dingus J, Hildebrandt J D", "evidence": [ { "database": "UniProtKB", "id": "O14610", "url": "https://www.uniprot.org/uniprot/O14610" } ], "reference": [ { "type": "PubMed", "id": "11714923", "url": "https://glygen.org/publication/PubMed/11714923" } ] }, { "title": "Competing modes of self-association in the regulatory domains of Bruton's tyrosine kinase: intramolecular contact versus asymmetric homodimerization.", "journal": "Protein science : a publication of the Protein Society", "date": "2002", "authors": "Laederach A, Cradic KW, Brazin KN, Zamoon J, Fulton DB, Huang XY, Andreotti AH", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "11742120", "url": "https://glygen.org/publication/PubMed/11742120" } ] }, { "title": "A unique fold of phospholipase C-beta mediates dimerization and interaction with G alpha q.", "journal": "Nature structural biology", "date": "2002", "authors": "Singer AU, Waldo GL, Harden TK, Sondek J", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "11753430", "url": "https://glygen.org/publication/PubMed/11753430" } ] }, { "title": "Estrogen action via the G protein-coupled receptor, GPR30: stimulation of adenylyl cyclase and cAMP-mediated attenuation of the epidermal growth factor receptor-to-MAPK signaling axis.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2002", "authors": "Filardo EJ, Quinn JA, Frackelton AR Jr, Bland KI", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634597" } ], "reference": [ { "type": "PubMed", "id": "11773440", "url": "https://glygen.org/publication/PubMed/11773440" } ] }, { "title": "ERs associate with and regulate the production of caveolin: implications for signaling and cellular actions.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2002", "authors": "Razandi M, Oh P, Pedram A, Schnitzer J, Levin ER", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "11773442", "url": "https://glygen.org/publication/PubMed/11773442" } ] }, { "title": "Linkage of rapid estrogen action to MAPK activation by ERalpha-Shc association and Shc pathway activation.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2002", "authors": "Song RX, McPherson RA, Adam L, Bao Y, Shupnik M, Kumar R, Santen RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "11773443", "url": "https://glygen.org/publication/PubMed/11773443" } ] }, { "title": "Mu and Delta opioid receptors activate the same G proteins in human neuroblastoma SH-SY5Y cells.", "journal": "British journal of pharmacology", "date": "2002", "authors": "Alt A, Clark MJ, Woods JH, Traynor JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-202040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202040" } ], "reference": [ { "type": "PubMed", "id": "11786497", "url": "https://glygen.org/publication/PubMed/11786497" } ] }, { "title": "CD44 anchors the assembly of matrilysin/MMP-7 with heparin-binding epidermal growth factor precursor and ErbB4 and regulates female reproductive organ remodeling.", "journal": "Genes & development", "date": "2002", "authors": "Yu WH, Woessner JF Jr, McNeish JD, Stamenkovic I", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "11825873", "url": "https://glygen.org/publication/PubMed/11825873" } ] }, { "title": "The amino acid sequence of human glucagon.", "journal": "FEBS letters", "date": "1972", "authors": "Thomsen J, Kristiansen K, Brunfeldt K, Sundby F", "evidence": [ { "database": "Reactome", "id": "R-HSA-420092", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-420092" } ], "reference": [ { "type": "PubMed", "id": "11946536", "url": "https://glygen.org/publication/PubMed/11946536" } ] }, { "title": "S111N mutation in the helical domain of human Gs(alpha) reduces its GDP/GTP exchange rate.", "journal": "Journal of cellular biochemistry", "date": "2002", "authors": "Brito M, Guzman L, Romo X, Soto X, Hinrichs MV, Olate J", "evidence": [ { "database": "Reactome", "id": "R-HSA-432040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432040" } ], "reference": [ { "type": "PubMed", "id": "11968001", "url": "https://glygen.org/publication/PubMed/11968001" } ] }, { "title": "ERbeta has nongenomic action in caveolae.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2002", "authors": "Chambliss KL, Yuhanna IS, Anderson RG, Mendelsohn ME, Shaul PW", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "11981029", "url": "https://glygen.org/publication/PubMed/11981029" } ] }, { "title": "The Wnt/calcium pathway activates NF-AT and promotes ventral cell fate in Xenopus embryos.", "journal": "Nature", "date": "2002", "authors": "Saneyoshi T, Kume S, Amasaki Y, Mikoshiba K", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "12015605", "url": "https://glygen.org/publication/PubMed/12015605" } ] }, { "title": "In vitro folding, functional characterization, and disulfide pattern of the extracellular domain of human GLP-1 receptor.", "journal": "Biophysical chemistry", "date": "2002", "authors": "Bazarsuren A, Grauschopf U, Wozny M, Reusch D, Hoffmann E, Schaefer W, Panzner S, Rudolph R", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "12034449", "url": "https://glygen.org/publication/PubMed/12034449" } ] }, { "title": "Selective inhibition of heterotrimeric Gs signaling. Targeting the receptor-G protein interface using a peptide minigene encoding the Galpha(s) carboxyl terminus.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Feldman DS, Zamah AM, Pierce KL, Miller WE, Kelly F, Rapacciuolo A, Rockman HA, Koch WJ, Luttrell LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "12036966", "url": "https://glygen.org/publication/PubMed/12036966" } ] }, { "title": "Adaptor protein Shc is an isoform-specific direct activator of the tyrosine kinase c-Src.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Sato K, Nagao T, Kakumoto M, Kimoto M, Otsuki T, Iwasaki T, Tokmakov AA, Owada K, Fukami Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "12048194", "url": "https://glygen.org/publication/PubMed/12048194" } ] }, { "title": "Mechanism of Galpha i-mediated inhibition of type V adenylyl cyclase.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Dessauer CW, Chen-Goodspeed M, Chen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "12058044", "url": "https://glygen.org/publication/PubMed/12058044" } ] }, { "title": "Wnt5a signaling directly affects cell motility and invasion of metastatic melanoma.", "journal": "Cancer cell", "date": "2002", "authors": "Weeraratna AT, Jiang Y, Hostetter G, Rosenblatt K, Duray P, Bittner M, Trent JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "12086864", "url": "https://glygen.org/publication/PubMed/12086864" } ] }, { "title": "Guanine nucleotide exchange factors for Rho GTPases: turning on the switch.", "journal": "Genes & development", "date": "2002", "authors": "Schmidt A, Hall A", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "12101119", "url": "https://glygen.org/publication/PubMed/12101119" } ] }, { "title": "Similarities and differences in the coupling of human beta1- and beta2-adrenoceptors to Gs(alpha) splice variants.", "journal": "Biochemical pharmacology", "date": "2002", "authors": "Wenzel-Seifert K, Liu HY, Seifert R", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "12106601", "url": "https://glygen.org/publication/PubMed/12106601" } ] }, { "title": "Regulators of G-protein signalling as new central nervous system drug targets.", "journal": "Nature reviews. Drug discovery", "date": "2002", "authors": "Neubig RR, Siderovski DP", "evidence": [ { "database": "Reactome", "id": "R-HSA-418597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418597" } ], "reference": [ { "type": "PubMed", "id": "12120503", "url": "https://glygen.org/publication/PubMed/12120503" } ] }, { "title": "Plexin-B1 directly interacts with PDZ-RhoGEF/LARG to regulate RhoA and growth cone morphology.", "journal": "Neuron", "date": "2002", "authors": "Swiercz JM, Kuner R, Behrens J, Offermanns S", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "12123608", "url": "https://glygen.org/publication/PubMed/12123608" } ] }, { "title": "Multiple phosphoinositide 3-kinase-dependent steps in activation of protein kinase B.", "journal": "Molecular and cellular biology", "date": "2002", "authors": "Scheid MP, Marignani PA, Woodgett JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-392451", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-392451" } ], "reference": [ { "type": "PubMed", "id": "12167717", "url": "https://glygen.org/publication/PubMed/12167717" } ] }, { "title": "The pharmacology of cilostazol.", "journal": "Diabetes, obesity & metabolism", "date": "2002", "authors": "Schror K", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "12180353", "url": "https://glygen.org/publication/PubMed/12180353" } ] }, { "title": "Protein kinase A translocation and insulin secretion in pancreatic beta-cells: studies with adenylate cyclase toxin from Bordetella pertussis.", "journal": "The Biochemical journal", "date": "2002", "authors": "Gao Z, Young RA, Trucco MM, Greene SR, Hewlett EL, Matschinsky FM, Wolf BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "12180908", "url": "https://glygen.org/publication/PubMed/12180908" } ] }, { "title": "The role of putative phosphorylation sites in the targeting and shuttling of the aquaporin-2 water channel.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "van Balkom BW, Savelkoul PJ, Markovich D, Hofman E, Nielsen S, van der Sluijs P, Deen PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-432040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432040" } ], "reference": [ { "type": "PubMed", "id": "12194985", "url": "https://glygen.org/publication/PubMed/12194985" } ] }, { "title": "Distinct nongenomic signal transduction pathways controlled by 17beta-estradiol regulate DNA synthesis and cyclin D(1) gene transcription in HepG2 cells.", "journal": "Molecular biology of the cell", "date": "2002", "authors": "Marino M, Acconcia F, Bresciani F, Weisz A, Trentalance A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "12388769", "url": "https://glygen.org/publication/PubMed/12388769" } ] }, { "title": "Piccolo, a Ca2+ sensor in pancreatic beta-cells. Involvement of cAMP-GEFII.Rim2. Piccolo complex in cAMP-dependent exocytosis.", "journal": "The Journal of biological chemistry", "date": "2002", "authors": "Fujimoto K, Shibasaki T, Yokoi N, Kashima Y, Matsumoto M, Sasaki T, Tajima N, Iwanaga T, Seino S", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "12401793", "url": "https://glygen.org/publication/PubMed/12401793" } ] }, { "title": "Glucagon-like peptide-1 mobilizes intracellular Ca2+ and stimulates mitochondrial ATP synthesis in pancreatic MIN6 beta-cells.", "journal": "The Biochemical journal", "date": "2003", "authors": "Tsuboi T, da Silva Xavier G, Holz GG, Jouaville LS, Thomas AP, Rutter GA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "12410638", "url": "https://glygen.org/publication/PubMed/12410638" } ] }, { "title": "Proximal events in signaling by plasma membrane estrogen receptors.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Razandi M, Pedram A, Park ST, Levin ER", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "12421825", "url": "https://glygen.org/publication/PubMed/12421825" } ] }, { "title": "Src kinase mediates phosphatidylinositol 3-kinase/Akt-dependent rapid endothelial nitric-oxide synthase activation by estrogen.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Haynes MP, Li L, Sinha D, Russell KS, Hisamoto K, Baron R, Collinge M, Sessa WC, Bender JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "12431978", "url": "https://glygen.org/publication/PubMed/12431978" } ] }, { "title": "Galpha(12/13) mediates alpha(1)-adrenergic receptor-induced cardiac hypertrophy.", "journal": "Circulation research", "date": "2002", "authors": "Maruyama Y, Nishida M, Sugimoto Y, Tanabe S, Turner JH, Kozasa T, Wada T, Nagao T, Kurose H", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "12433842", "url": "https://glygen.org/publication/PubMed/12433842" } ] }, { "title": "The unique ligand-binding pocket for the human prostacyclin receptor. Site-directed mutagenesis and molecular modeling.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Stitham J, Stojanovic A, Merenick BL, O'Hara KA, Hwa J", "evidence": [ { "database": "Reactome", "id": "R-HSA-392851", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-392851" } ], "reference": [ { "type": "PubMed", "id": "12446735", "url": "https://glygen.org/publication/PubMed/12446735" } ] }, { "title": "Signaling of rat Frizzled-2 through phosphodiesterase and cyclic GMP.", "journal": "Science (New York, N.Y.)", "date": "2002", "authors": "Ahumada A, Slusarski DC, Liu X, Moon RT, Malbon CC, Wang HY", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "12471263", "url": "https://glygen.org/publication/PubMed/12471263" } ] }, { "title": "The multiple actions of GLP-1 on the process of glucose-stimulated insulin secretion.", "journal": "Diabetes", "date": "2002", "authors": "MacDonald PE, El-Kholy W, Riedel MJ, Salapatek AM, Light PE, Wheeler MB", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "12475787", "url": "https://glygen.org/publication/PubMed/12475787" } ] }, { "title": "The TAK1-NLK mitogen-activated protein kinase cascade functions in the Wnt-5a/Ca(2+) pathway to antagonize Wnt/beta-catenin signaling.", "journal": "Molecular and cellular biology", "date": "2003", "authors": "Ishitani T, Kishida S, Hyodo-Miura J, Ueno N, Yasuda J, Waterman M, Shibuya H, Moon RT, Ninomiya-Tsuji J, Matsumoto K", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "12482967", "url": "https://glygen.org/publication/PubMed/12482967" } ] }, { "title": "Epac-selective cAMP analog 8-pCPT-2'-O-Me-cAMP as a stimulus for Ca2+-induced Ca2+ release and exocytosis in pancreatic beta-cells.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Kang G, Joseph JW, Chepurny OG, Monaco M, Wheeler MB, Bos JL, Schwede F, Genieser HG, Holz GG", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "12496249", "url": "https://glygen.org/publication/PubMed/12496249" } ] }, { "title": "Roles of G beta gamma in membrane recruitment and activation of p110 gamma/p101 phosphoinositide 3-kinase gamma.", "journal": "The Journal of cell biology", "date": "2003", "authors": "Brock C, Schaefer M, Reusch HP, Czupalla C, Michalke M, Spicher K, Schultz G, Nurnberg B", "evidence": [ { "database": "Reactome", "id": "R-HSA-392451", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-392451" } ], "reference": [ { "type": "PubMed", "id": "12507995", "url": "https://glygen.org/publication/PubMed/12507995" } ] }, { "title": "Nongenomic actions of steroid hormones.", "journal": "Nature reviews. Molecular cell biology", "date": "2003", "authors": "Losel R, Wehling M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "12511868", "url": "https://glygen.org/publication/PubMed/12511868" } ] }, { "title": "Galpha 12 activates Rho GTPase through tyrosine-phosphorylated leukemia-associated RhoGEF.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2003", "authors": "Suzuki N, Nakamura S, Mano H, Kozasa T", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "12515866", "url": "https://glygen.org/publication/PubMed/12515866" } ] }, { "title": "Regulation of lymphoid enhancer factor 1/T-cell factor by mitogen-activated protein kinase-related Nemo-like kinase-dependent phosphorylation in Wnt/beta-catenin signaling.", "journal": "Molecular and cellular biology", "date": "2003", "authors": "Ishitani T, Ninomiya-Tsuji J, Matsumoto K", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "12556497", "url": "https://glygen.org/publication/PubMed/12556497" } ] }, { "title": "Inactivation of the human P2Y12 receptor by thiol reagents requires interaction with both extracellular cysteine residues, Cys17 and Cys270.", "journal": "Blood", "date": "2003", "authors": "Ding Z, Kim S, Dorsam RT, Jin J, Kunapuli SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-392170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-392170" } ], "reference": [ { "type": "PubMed", "id": "12560222", "url": "https://glygen.org/publication/PubMed/12560222" } ] }, { "title": "Identification of a structural determinant necessary for the localization and function of estrogen receptor alpha at the plasma membrane.", "journal": "Molecular and cellular biology", "date": "2003", "authors": "Razandi M, Alton G, Pedram A, Ghonshani S, Webb P, Levin ER", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "12588983", "url": "https://glygen.org/publication/PubMed/12588983" } ] }, { "title": "Plasma membrane localization and function of the estrogen receptor alpha variant (ER46) in human endothelial cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2003", "authors": "Li L, Haynes MP, Bender JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "12682286", "url": "https://glygen.org/publication/PubMed/12682286" } ] }, { "title": "Activation of Gbetagamma signaling downstream of Wnt-11/Xfz7 regulates Cdc42 activity during Xenopus gastrulation.", "journal": "Developmental biology", "date": "2003", "authors": "Penzo-Mendez A, Umbhauer M, Djiane A, Boucaut JC, Riou JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "12729560", "url": "https://glygen.org/publication/PubMed/12729560" } ] }, { "title": "Distribution of aquaporin water channels AQP1 and AQP5 in the ductal system of the human pancreas.", "journal": "Gut", "date": "2003", "authors": "Burghardt B, Elkaer ML, Kwon TH, Racz GZ, Varga G, Steward MC, Nielsen S", "evidence": [ { "database": "Reactome", "id": "R-HSA-432040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432040" } ], "reference": [ { "type": "PubMed", "id": "12801959", "url": "https://glygen.org/publication/PubMed/12801959" } ] }, { "title": "Biphasic estradiol-induced AKT phosphorylation is modulated by PTEN via MAP kinase in HepG2 cells.", "journal": "Molecular biology of the cell", "date": "2003", "authors": "Marino M, Acconcia F, Trentalance A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "12808053", "url": "https://glygen.org/publication/PubMed/12808053" } ] }, { "title": "Characterization of the 5-HT6 receptor coupled to Ca2+ signaling using an enabling chimeric G-protein.", "journal": "European journal of pharmacology", "date": "2003", "authors": "Zhang JY, Nawoschik S, Kowal D, Smith D, Spangler T, Ochalski R, Schechter L, Dunlop J", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "12860470", "url": "https://glygen.org/publication/PubMed/12860470" } ] }, { "title": "Sphingosine kinase transmits estrogen signaling in human breast cancer cells.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2003", "authors": "Sukocheva OA, Wang L, Albanese N, Pitson SM, Vadas MA, Xia P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "12881510", "url": "https://glygen.org/publication/PubMed/12881510" } ] }, { "title": "Directional sensing requires G beta gamma-mediated PAK1 and PIX alpha-dependent activation of Cdc42.", "journal": "Cell", "date": "2003", "authors": "Li Z, Hannigan M, Mo Z, Liu B, Lu W, Wu Y, Smrcka AV, Wu G, Li L, Liu M, Huang CK, Wu D", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964616", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964616" } ], "reference": [ { "type": "PubMed", "id": "12887923", "url": "https://glygen.org/publication/PubMed/12887923" } ] }, { "title": "Identification of an IQGAP1/AKAP79 complex in beta-cells.", "journal": "Journal of cellular biochemistry", "date": "2003", "authors": "Nauert JB, Rigas JD, Lester LB", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "12938160", "url": "https://glygen.org/publication/PubMed/12938160" } ] }, { "title": "Transcriptional regulation by calcium, calcineurin, and NFAT.", "journal": "Genes & development", "date": "2003", "authors": "Hogan PG, Chen L, Nardone J, Rao A", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "12975316", "url": "https://glygen.org/publication/PubMed/12975316" } ] }, { "title": "Molecular cloning and expression of an adenosine A2b receptor from human brain.", "journal": "Biochemical and biophysical research communications", "date": "1992", "authors": "Pierce KD, Furlong TJ, Selbie LA, Shine J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9660821", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9660821" } ], "reference": [ { "type": "PubMed", "id": "1325798", "url": "https://glygen.org/publication/PubMed/1325798" } ] }, { "title": "Molecular cloning and expression of a pituitary-specific receptor for growth hormone-releasing hormone.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "1992", "authors": "Mayo KE", "evidence": [ { "database": "Reactome", "id": "R-HSA-420092", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-420092" } ], "reference": [ { "type": "PubMed", "id": "1333056", "url": "https://glygen.org/publication/PubMed/1333056" } ] }, { "title": "Gz-mediated hormonal inhibition of cyclic AMP accumulation.", "journal": "Science (New York, N.Y.)", "date": "1992", "authors": "Wong YH, Conklin BR, Bourne HR", "evidence": [ { "database": "Reactome", "id": "R-HSA-418597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418597" } ], "reference": [ { "type": "PubMed", "id": "1347957", "url": "https://glygen.org/publication/PubMed/1347957" } ] }, { "title": "Fractionation and characterization of a cyclic adenine ribonucleotide formed by tissue particles.", "journal": "The Journal of biological chemistry", "date": "1958", "authors": "SUTHERLAND EW, RALL TW", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "13549488", "url": "https://glygen.org/publication/PubMed/13549488" } ] }, { "title": "Type VIII adenylyl cyclase in rat beta cells: coincidence signal detector/generator for glucose and GLP-1.", "journal": "Diabetologia", "date": "2003", "authors": "Delmeire D, Flamez D, Hinke SA, Cali JJ, Pipeleers D, Schuit F", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "13680124", "url": "https://glygen.org/publication/PubMed/13680124" } ] }, { "title": "Appearance of water channels in Xenopus oocytes expressing red cell CHIP28 protein.", "journal": "Science (New York, N.Y.)", "date": "1992", "authors": "Preston GM, Carroll TP, Guggino WB, Agre P", "evidence": [ { "database": "Reactome", "id": "R-HSA-432040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432040" } ], "reference": [ { "type": "PubMed", "id": "1373524", "url": "https://glygen.org/publication/PubMed/1373524" } ] }, { "title": "Inhibition of insulin secretion via distinct signaling pathways in alpha2-adrenoceptor knockout mice.", "journal": "European journal of endocrinology", "date": "2003", "authors": "Peterhoff M, Sieg A, Brede M, Chao CM, Hein L, Ullrich S", "evidence": [ { "database": "Reactome", "id": "R-HSA-400042", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400042" } ], "reference": [ { "type": "PubMed", "id": "14514350", "url": "https://glygen.org/publication/PubMed/14514350" } ] }, { "title": "Aquaporin expression in normal human kidney and in renal disease.", "journal": "Journal of the American Society of Nephrology : JASN", "date": "2003", "authors": "Bedford JJ, Leader JP, Walker RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-432040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432040" } ], "reference": [ { "type": "PubMed", "id": "14514735", "url": "https://glygen.org/publication/PubMed/14514735" } ] }, { "title": "Purification and functional reconstitution of the human P2Y12 receptor.", "journal": "Molecular pharmacology", "date": "2003", "authors": "Bodor ET, Waldo GL, Hooks SB, Corbitt J, Boyer JL, Harden TK", "evidence": [ { "database": "Reactome", "id": "R-HSA-392170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-392170" } ], "reference": [ { "type": "PubMed", "id": "14573771", "url": "https://glygen.org/publication/PubMed/14573771" } ] }, { "title": "Expression of the AQP-1 water channel in normal human tissues: a semiquantitative study using tissue microarray technology.", "journal": "American journal of physiology. Cell physiology", "date": "2004", "authors": "Mobasheri A, Marples D", "evidence": [ { "database": "Reactome", "id": "R-HSA-432040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432040" } ], "reference": [ { "type": "PubMed", "id": "14592814", "url": "https://glygen.org/publication/PubMed/14592814" } ] }, { "title": "Insights into G protein structure, function, and regulation.", "journal": "Endocrine reviews", "date": "2003", "authors": "Cabrera-Vera TM, Vanhauwe J, Thomas TO, Medkova M, Preininger A, Mazzoni MR, Hamm HE", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "14671004", "url": "https://glygen.org/publication/PubMed/14671004" } ] }, { "title": "17beta-estradiol inhibits oxidative stress-induced apoptosis in keratinocytes by promoting Bcl-2 expression.", "journal": "The Journal of investigative dermatology", "date": "2003", "authors": "Kanda N, Watanabe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634597" } ], "reference": [ { "type": "PubMed", "id": "14675202", "url": "https://glygen.org/publication/PubMed/14675202" } ] }, { "title": "Aquaporin-1, nothing but a water channel.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Tsunoda SP, Wiesner B, Lorenz D, Rosenthal W, Pohl P", "evidence": [ { "database": "Reactome", "id": "R-HSA-432040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432040" } ], "reference": [ { "type": "PubMed", "id": "14701836", "url": "https://glygen.org/publication/PubMed/14701836" } ] }, { "title": "Wnt-frizzled signaling to G-protein-coupled effectors.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2004", "authors": "Wang HY, Malbon CC", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "14704854", "url": "https://glygen.org/publication/PubMed/14704854" } ] }, { "title": "Agonist binding and Gq-stimulating activities of the purified human P2Y1 receptor.", "journal": "Molecular pharmacology", "date": "2004", "authors": "Waldo GL, Harden TK", "evidence": [ { "database": "Reactome", "id": "R-HSA-418592", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418592" } ], "reference": [ { "type": "PubMed", "id": "14742685", "url": "https://glygen.org/publication/PubMed/14742685" } ] }, { "title": "The role of Shc and insulin-like growth factor 1 receptor in mediating the translocation of estrogen receptor alpha to the plasma membrane.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Song RX, Barnes CJ, Zhang Z, Bao Y, Kumar R, Santen RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "14764897", "url": "https://glygen.org/publication/PubMed/14764897" } ] }, { "title": "Frizzleds: new members of the superfamily of G-protein-coupled receptors.", "journal": "Frontiers in bioscience : a journal and virtual library", "date": "2004", "authors": "Malbon CC", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "14977528", "url": "https://glygen.org/publication/PubMed/14977528" } ] }, { "title": "Expression of voltage-gated potassium channels in human and rhesus pancreatic islets.", "journal": "Diabetes", "date": "2004", "authors": "Yan L, Figueroa DJ, Austin CP, Liu Y, Bugianesi RM, Slaughter RS, Kaczorowski GJ, Kohler MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "14988243", "url": "https://glygen.org/publication/PubMed/14988243" } ] }, { "title": "S-palmitoylation modulates human estrogen receptor-alpha functions.", "journal": "Biochemical and biophysical research communications", "date": "2004", "authors": "Acconcia F, Ascenzi P, Fabozzi G, Visca P, Marino M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "15033483", "url": "https://glygen.org/publication/PubMed/15033483" } ] }, { "title": "Sphingosine 1-phosphate transactivates the platelet-derived growth factor beta receptor and epidermal growth factor receptor in vascular smooth muscle cells.", "journal": "Circulation research", "date": "2004", "authors": "Tanimoto T, Lungu AO, Berk BC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "15044318", "url": "https://glygen.org/publication/PubMed/15044318" } ] }, { "title": "The G protein-coupled receptor GPR30 mediates c-fos up-regulation by 17beta-estradiol and phytoestrogens in breast cancer cells.", "journal": "The Journal of biological chemistry", "date": "2004", "authors": "Maggiolini M, Vivacqua A, Fasanella G, Recchia AG, Sisci D, Pezzi V, Montanaro D, Musti AM, Picard D, Ando S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "15090535", "url": "https://glygen.org/publication/PubMed/15090535" } ] }, { "title": "Reconstitution of functional water channels in liposomes containing purified red cell CHIP28 protein.", "journal": "Biochemistry", "date": "1992", "authors": "Zeidel ML, Ambudkar SV, Smith BL, Agre P", "evidence": [ { "database": "Reactome", "id": "R-HSA-432040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432040" } ], "reference": [ { "type": "PubMed", "id": "1510932", "url": "https://glygen.org/publication/PubMed/1510932" } ] }, { "title": "Beta-arrestin2, a novel member of the arrestin/beta-arrestin gene family.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Attramadal H, Arriza JL, Aoki C, Dawson TM, Codina J, Kwatra MM, Snyder SH, Caron MG, Lefkowitz RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "1517224", "url": "https://glygen.org/publication/PubMed/1517224" } ] }, { "title": "Plasma membrane estrogen receptors exist and functions as dimers.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2004", "authors": "Razandi M, Pedram A, Merchenthaler I, Greene GL, Levin ER", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "15231873", "url": "https://glygen.org/publication/PubMed/15231873" } ] }, { "title": "17beta-estradiol stimulates the growth of human keratinocytes by inducing cyclin D2 expression.", "journal": "The Journal of investigative dermatology", "date": "2004", "authors": "Kanda N, Watanabe S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634597" } ], "reference": [ { "type": "PubMed", "id": "15245432", "url": "https://glygen.org/publication/PubMed/15245432" } ] }, { "title": "Role of atypical protein kinase C in estradiol-triggered G1/S progression of MCF-7 cells.", "journal": "Molecular and cellular biology", "date": "2004", "authors": "Castoria G, Migliaccio A, Di Domenico M, Lombardi M, de Falco A, Varricchio L, Bilancio A, Barone MV, Auricchio F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "15314172", "url": "https://glygen.org/publication/PubMed/15314172" } ] }, { "title": "Molecular cloning of the receptor for human antidiuretic hormone.", "journal": "Nature", "date": "1992", "authors": "Birnbaumer M, Seibold A, Gilbert S, Ishido M, Barberis C, Antaramian A, Brabet P, Rosenthal W", "evidence": [ { "database": "Reactome", "id": "R-HSA-432040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432040" } ], "reference": [ { "type": "PubMed", "id": "1534149", "url": "https://glygen.org/publication/PubMed/1534149" } ] }, { "title": "Hepatic glucagon receptor binding and glucose-lowering in vivo by peptidyl and non-peptidyl glucagon receptor antagonists.", "journal": "European journal of pharmacology", "date": "2004", "authors": "Dallas-Yang Q, Shen X, Strowski M, Brady E, Saperstein R, Gibson RE, Szalkowski D, Qureshi SA, Candelore MR, Fenyk-Melody JE, Parmee ER, Zhang BB, Jiang G", "evidence": [ { "database": "Reactome", "id": "R-HSA-420092", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-420092" } ], "reference": [ { "type": "PubMed", "id": "15464082", "url": "https://glygen.org/publication/PubMed/15464082" } ] }, { "title": "Nitric Oxide as a Unique Bioactive Signaling Messenger in Physiology and Pathophysiology.", "journal": "Journal of biomedicine & biotechnology", "date": "2004", "authors": "Tuteja N, Chandra M, Tuteja R, Misra MK", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "15467163", "url": "https://glygen.org/publication/PubMed/15467163" } ] }, { "title": "The HeLa cell glucagon-like peptide-2 receptor is coupled to regulation of apoptosis and ERK1/2 activation through divergent signaling pathways.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2005", "authors": "Koehler JA, Yusta B, Drucker DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-420092", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-420092" } ], "reference": [ { "type": "PubMed", "id": "15471943", "url": "https://glygen.org/publication/PubMed/15471943" } ] }, { "title": "PDE6 is an effector for the Wnt/Ca2+/cGMP-signalling pathway in development.", "journal": "Biochemical Society transactions", "date": "2004", "authors": "Wang H, Lee Y, Malbon CC", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "15494017", "url": "https://glygen.org/publication/PubMed/15494017" } ] }, { "title": "Palmitoylation-dependent estrogen receptor alpha membrane localization: regulation by 17beta-estradiol.", "journal": "Molecular biology of the cell", "date": "2005", "authors": "Acconcia F, Ascenzi P, Bocedi A, Spisni E, Tomasi V, Trentalance A, Visca P, Marino M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "15496458", "url": "https://glygen.org/publication/PubMed/15496458" } ] }, { "title": "Identity of an estrogen membrane receptor coupled to a G protein in human breast cancer cells.", "journal": "Endocrinology", "date": "2005", "authors": "Thomas P, Pang Y, Filardo EJ, Dong J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634597" } ], "reference": [ { "type": "PubMed", "id": "15539556", "url": "https://glygen.org/publication/PubMed/15539556" } ] }, { "title": "The biology of cyclic GMP-dependent protein kinases.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Hofmann F", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "15545263", "url": "https://glygen.org/publication/PubMed/15545263" } ] }, { "title": "Glucagon-like peptide-1: regulation of insulin secretion and therapeutic potential.", "journal": "Basic & clinical pharmacology & toxicology", "date": "2004", "authors": "Gromada J, Brock B, Schmitz O, Rorsman P", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "15569269", "url": "https://glygen.org/publication/PubMed/15569269" } ] }, { "title": "Striatin assembles a membrane signaling complex necessary for rapid, nongenomic activation of endothelial NO synthase by estrogen receptor alpha.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2004", "authors": "Lu Q, Pallas DC, Surks HK, Baur WE, Mendelsohn ME, Karas RH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "15569929", "url": "https://glygen.org/publication/PubMed/15569929" } ] }, { "title": "Regulatory interactions between the amino terminus of G-protein betagamma subunits and the catalytic domain of phospholipase Cbeta2.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Bonacci TM, Ghosh M, Malik S, Smrcka AV", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "15611108", "url": "https://glygen.org/publication/PubMed/15611108" } ] }, { "title": "Phosphotyrosine signaling networks in epidermal growth factor receptor overexpressing squamous carcinoma cells.", "journal": "Molecular & cellular proteomics : MCP", "date": "2005", "authors": "Thelemann A, Petti F, Griffin G, Iwata K, Hunt T, Settinari T, Fenyo D, Gibson N, Haley JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "15657067", "url": "https://glygen.org/publication/PubMed/15657067" } ] }, { "title": "Direct cleavage of ROCK II by granzyme B induces target cell membrane blebbing in a caspase-independent manner.", "journal": "The Journal of experimental medicine", "date": "2005", "authors": "Sebbagh M, Hamelin J, Bertoglio J, Solary E, Breard J", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "15699075", "url": "https://glygen.org/publication/PubMed/15699075" } ] }, { "title": "Distribution of AQP2 and AQP3 water channels in human tissue microarrays.", "journal": "Journal of molecular histology", "date": "2005", "authors": "Mobasheri A, Wray S, Marples D", "evidence": [ { "database": "Reactome", "id": "R-HSA-432040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432040" } ], "reference": [ { "type": "PubMed", "id": "15703994", "url": "https://glygen.org/publication/PubMed/15703994" } ] }, { "title": "Integration of the extranuclear and nuclear actions of estrogen.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2005", "authors": "Levin ER", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "15705661", "url": "https://glygen.org/publication/PubMed/15705661" } ] }, { "title": "A transmembrane intracellular estrogen receptor mediates rapid cell signaling.", "journal": "Science (New York, N.Y.)", "date": "2005", "authors": "Revankar CM, Cimino DF, Sklar LA, Arterburn JB, Prossnitz ER", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634597" } ], "reference": [ { "type": "PubMed", "id": "15705806", "url": "https://glygen.org/publication/PubMed/15705806" } ] }, { "title": "Receptors coupled to heterotrimeric G proteins of the G12 family.", "journal": "Trends in pharmacological sciences", "date": "2005", "authors": "Riobo NA, Manning DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "15749160", "url": "https://glygen.org/publication/PubMed/15749160" } ] }, { "title": "Effects of piclamilast, a selective phosphodiesterase-4 inhibitor, on oxidative burst of sputum cells from mild asthmatics and stable COPD patients.", "journal": "Lung", "date": "2004", "authors": "Beeh KM, Beier J, Lerch C, Schulz AK, Buhl R", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "15765929", "url": "https://glygen.org/publication/PubMed/15765929" } ] }, { "title": "Cyclic nucleotide phosphodiesterase-mediated integration of cGMP and cAMP signaling in cells of the cardiovascular system.", "journal": "Frontiers in bioscience : a journal and virtual library", "date": "2005", "authors": "Maurice DH", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "15769620", "url": "https://glygen.org/publication/PubMed/15769620" } ] }, { "title": "Phosducin-like protein acts as a molecular chaperone for G protein betagamma dimer assembly.", "journal": "The EMBO journal", "date": "2005", "authors": "Lukov GL, Hu T, McLaughlin JN, Hamm HE, Willardson BM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6814122", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6814122" } ], "reference": [ { "type": "PubMed", "id": "15889144", "url": "https://glygen.org/publication/PubMed/15889144" } ] }, { "title": "The GAPs, GEFs, and GDIs of heterotrimeric G-protein alpha subunits.", "journal": "International journal of biological sciences", "date": "2005", "authors": "Siderovski DP, Willard FS", "evidence": [ { "database": "Reactome", "id": "R-HSA-418597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418597" } ], "reference": [ { "type": "PubMed", "id": "15951850", "url": "https://glygen.org/publication/PubMed/15951850" } ] }, { "title": "A novel mechanism for the suppression of a voltage-gated potassium channel by glucose-dependent insulinotropic polypeptide: protein kinase A-dependent endocytosis.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Kim SJ, Choi WS, Han JS, Warnock G, Fedida D, McIntosh CH", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "15955806", "url": "https://glygen.org/publication/PubMed/15955806" } ] }, { "title": "Rapid, estrogen receptor-mediated signaling: why is the endothelium so special?", "journal": "Science's STKE : signal transduction knowledge environment", "date": "2005", "authors": "Kim KH, Bender JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "15956360", "url": "https://glygen.org/publication/PubMed/15956360" } ] }, { "title": "Can a GDP-liganded G-protein be active?", "journal": "Molecular pharmacology", "date": "2005", "authors": "Wieland T, Michel MC", "evidence": [ { "database": "Reactome", "id": "R-HSA-392851", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-392851" } ], "reference": [ { "type": "PubMed", "id": "15980156", "url": "https://glygen.org/publication/PubMed/15980156" } ] }, { "title": "The Rap-B-Raf signalling pathway is activated by glucose and glucagon-like peptide-1 in human islet cells.", "journal": "Diabetologia", "date": "2005", "authors": "Trumper J, Ross D, Jahr H, Brendel MD, Goke R, Horsch D", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "15995848", "url": "https://glygen.org/publication/PubMed/15995848" } ] }, { "title": "Protease-activated receptors in hemostasis, thrombosis and vascular biology.", "journal": "Journal of thrombosis and haemostasis : JTH", "date": "2005", "authors": "Coughlin SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-456926", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-456926" } ], "reference": [ { "type": "PubMed", "id": "16102047", "url": "https://glygen.org/publication/PubMed/16102047" } ] }, { "title": "Lack of arginine vasopressin-induced phosphorylation of aquaporin-2 mutant AQP2-R254L explains dominant nephrogenic diabetes insipidus.", "journal": "Journal of the American Society of Nephrology : JASN", "date": "2005", "authors": "de Mattia F, Savelkoul PJ, Kamsteeg EJ, Konings IB, van der Sluijs P, Mallmann R, Oksche A, Deen PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-432040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432040" } ], "reference": [ { "type": "PubMed", "id": "16120822", "url": "https://glygen.org/publication/PubMed/16120822" } ] }, { "title": "Cell signalling diversity of the Gqalpha family of heterotrimeric G proteins.", "journal": "Cellular signalling", "date": "2006", "authors": "Hubbard KB, Hepler JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "16182515", "url": "https://glygen.org/publication/PubMed/16182515" } ] }, { "title": "Coupling interaction between thromboxane A2 receptor and alpha-13 subunit of guanine nucleotide-binding protein.", "journal": "Journal of proteome research", "date": "2005", "authors": "Chou KC", "evidence": [ { "database": "Reactome", "id": "R-HSA-428930", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-428930" } ], "reference": [ { "type": "PubMed", "id": "16212421", "url": "https://glygen.org/publication/PubMed/16212421" } ] }, { "title": "Rho GTPases: biochemistry and biology.", "journal": "Annual review of cell and developmental biology", "date": "2005", "authors": "Jaffe AB, Hall A", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "16212495", "url": "https://glygen.org/publication/PubMed/16212495" } ] }, { "title": "The G protein-coupled receptor GPR30 mediates the proliferative effects induced by 17beta-estradiol and hydroxytamoxifen in endometrial cancer cells.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2006", "authors": "Vivacqua A, Bonofiglio D, Recchia AG, Musti AM, Picard D, Ando S, Maggiolini M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "16239258", "url": "https://glygen.org/publication/PubMed/16239258" } ] }, { "title": "Galphaq binds to p110alpha/p85alpha phosphoinositide 3-kinase and displaces Ras.", "journal": "The Biochemical journal", "date": "2006", "authors": "Ballou LM, Chattopadhyay M, Li Y, Scarlata S, Lin RZ", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "16268778", "url": "https://glygen.org/publication/PubMed/16268778" } ] }, { "title": "S-palmitoylation modulates estrogen receptor alpha localization and functions.", "journal": "Steroids", "date": "2006", "authors": "Marino M, Ascenzi P, Acconcia F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "16274718", "url": "https://glygen.org/publication/PubMed/16274718" } ] }, { "title": "Preferential inhibition of human phosphodiesterase 4 by ibudilast.", "journal": "Life sciences", "date": "2006", "authors": "Huang Z, Liu S, Zhang L, Salem M, Greig GM, Chan CC, Natsumeda Y, Noguchi K", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "16313925", "url": "https://glygen.org/publication/PubMed/16313925" } ] }, { "title": "Snapshot of activated G proteins at the membrane: the Galphaq-GRK2-Gbetagamma complex.", "journal": "Science (New York, N.Y.)", "date": "2005", "authors": "Tesmer VM, Kawano T, Shankaranarayanan A, Kozasa T, Tesmer JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "16339447", "url": "https://glygen.org/publication/PubMed/16339447" } ] }, { "title": "Heterotrimeric G proteins precouple with G protein-coupled receptors in living cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2005", "authors": "Nobles M, Benians A, Tinker A", "evidence": [ { "database": "Reactome", "id": "R-HSA-400042", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400042" } ], "reference": [ { "type": "PubMed", "id": "16352729", "url": "https://glygen.org/publication/PubMed/16352729" } ] }, { "title": "Gialpha and Gbeta subunits both define selectivity of G protein activation by alpha2-adrenergic receptors.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Gibson SK, Gilman AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-400042", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400042" } ], "reference": [ { "type": "PubMed", "id": "16371464", "url": "https://glygen.org/publication/PubMed/16371464" } ] }, { "title": "GPCR-induced dissociation of G-protein subunits in early stage signal transduction.", "journal": "Molecular membrane biology", "date": "2005", "authors": "Leifert WR, Aloia AL, Bucco O, McMurchie EJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-400042", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400042" } ], "reference": [ { "type": "PubMed", "id": "16373322", "url": "https://glygen.org/publication/PubMed/16373322" } ] }, { "title": "Dynamic binding of PKA regulatory subunit RI alpha.", "journal": "Structure (London, England : 1993)", "date": "2006", "authors": "Gullingsrud J, Kim C, Taylor SS, McCammon JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-432040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432040" } ], "reference": [ { "type": "PubMed", "id": "16407073", "url": "https://glygen.org/publication/PubMed/16407073" } ] }, { "title": "Point mutations in the aromatic/arginine region in aquaporin 1 allow passage of urea, glycerol, ammonia, and protons.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Beitz E, Wu B, Holm LM, Schultz JE, Zeuthen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-432040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432040" } ], "reference": [ { "type": "PubMed", "id": "16407156", "url": "https://glygen.org/publication/PubMed/16407156" } ] }, { "title": "Differential activation of G-proteins by mu-opioid receptor agonists.", "journal": "British journal of pharmacology", "date": "2006", "authors": "Saidak Z, Blake-Palmer K, Hay DL, Northup JK, Glass M", "evidence": [ { "database": "Reactome", "id": "R-HSA-202040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202040" } ], "reference": [ { "type": "PubMed", "id": "16415903", "url": "https://glygen.org/publication/PubMed/16415903" } ] }, { "title": "The G12 family of G proteins as a reporter of thromboxane A2 receptor activity.", "journal": "Molecular pharmacology", "date": "2006", "authors": "Zhang L, DiLizio C, Kim D, Smyth EM, Manning DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-428930", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-428930" } ], "reference": [ { "type": "PubMed", "id": "16418336", "url": "https://glygen.org/publication/PubMed/16418336" } ] }, { "title": "Two peptides from the alpha 2A-adrenergic receptor alter receptor G protein coupling by distinct mechanisms.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Dalman HM, Neubig RR", "evidence": [ { "database": "Reactome", "id": "R-HSA-400042", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400042" } ], "reference": [ { "type": "PubMed", "id": "1645720", "url": "https://glygen.org/publication/PubMed/1645720" } ] }, { "title": "Solution structure of the first intracellular loop of prostacyclin receptor and implication of its interaction with the C-terminal segment of G alpha s protein.", "journal": "Biochemistry", "date": "2006", "authors": "Zhang L, Wu J, Ruan KH", "evidence": [ { "database": "Reactome", "id": "R-HSA-392851", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-392851" } ], "reference": [ { "type": "PubMed", "id": "16460020", "url": "https://glygen.org/publication/PubMed/16460020" } ] }, { "title": "Opposing effects of beta-arrestin1 and beta-arrestin2 on activation and degradation of Src induced by protease-activated receptor 1.", "journal": "Cellular signalling", "date": "2006", "authors": "Kuo FT, Lu TL, Fu HW", "evidence": [ { "database": "Reactome", "id": "R-HSA-456926", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-456926" } ], "reference": [ { "type": "PubMed", "id": "16580177", "url": "https://glygen.org/publication/PubMed/16580177" } ] }, { "title": "cAMP sensor Epac as a determinant of ATP-sensitive potassium channel activity in human pancreatic beta cells and rat INS-1 cells.", "journal": "The Journal of physiology", "date": "2006", "authors": "Kang G, Chepurny OG, Malester B, Rindler MJ, Rehmann H, Bos JL, Schwede F, Coetzee WA, Holz GG", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "16613879", "url": "https://glygen.org/publication/PubMed/16613879" } ] }, { "title": "The vertebrate phototransduction cascade: amplification and termination mechanisms.", "journal": "Reviews of physiology, biochemistry and pharmacology", "date": "2005", "authors": "Chen CK", "evidence": [ { "database": "Reactome", "id": "R-HSA-418594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418594" } ], "reference": [ { "type": "PubMed", "id": "16634148", "url": "https://glygen.org/publication/PubMed/16634148" } ] }, { "title": "Estrogen transactivates EGFR via the sphingosine 1-phosphate receptor Edg-3: the role of sphingosine kinase-1.", "journal": "The Journal of cell biology", "date": "2006", "authors": "Sukocheva O, Wadham C, Holmes A, Albanese N, Verrier E, Feng F, Bernal A, Derian CK, Ullrich A, Vadas MA, Xia P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "16636149", "url": "https://glygen.org/publication/PubMed/16636149" } ] }, { "title": "Nature of functional estrogen receptors at the plasma membrane.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2006", "authors": "Pedram A, Razandi M, Levin ER", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "16645038", "url": "https://glygen.org/publication/PubMed/16645038" } ] }, { "title": "G-protein-coupled receptor kinase specificity for beta-arrestin recruitment to the beta2-adrenergic receptor revealed by fluorescence resonance energy transfer.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Violin JD, Ren XR, Lefkowitz RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "16687412", "url": "https://glygen.org/publication/PubMed/16687412" } ] }, { "title": "Role of the chaperonin CCT/TRiC complex in G protein betagamma-dimer assembly.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Wells CA, Dingus J, Hildebrandt JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-6814122", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6814122" } ], "reference": [ { "type": "PubMed", "id": "16702223", "url": "https://glygen.org/publication/PubMed/16702223" } ] }, { "title": "Mechanism of assembly of G protein betagamma subunits by protein kinase CK2-phosphorylated phosducin-like protein and the cytosolic chaperonin complex.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Lukov GL, Baker CM, Ludtke PJ, Hu T, Carter MD, Hackett RA, Thulin CD, Willardson BM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6814122", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6814122" } ], "reference": [ { "type": "PubMed", "id": "16717095", "url": "https://glygen.org/publication/PubMed/16717095" } ] }, { "title": "Molecular cloning of a functional thrombin receptor reveals a novel proteolytic mechanism of receptor activation.", "journal": "Cell", "date": "1991", "authors": "Vu TK, Hung DT, Wheaton VI, Coughlin SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-456926", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-456926" } ], "reference": [ { "type": "PubMed", "id": "1672265", "url": "https://glygen.org/publication/PubMed/1672265" } ] }, { "title": "Stable association between G alpha(q) and phospholipase C beta 1 in living cells.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Dowal L, Provitera P, Scarlata S", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "16754659", "url": "https://glygen.org/publication/PubMed/16754659" } ] }, { "title": "17beta-estradiol, genistein, and 4-hydroxytamoxifen induce the proliferation of thyroid cancer cells through the g protein-coupled receptor GPR30.", "journal": "Molecular pharmacology", "date": "2006", "authors": "Vivacqua A, Bonofiglio D, Albanito L, Madeo A, Rago V, Carpino A, Musti AM, Picard D, Ando S, Maggiolini M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "16835357", "url": "https://glygen.org/publication/PubMed/16835357" } ] }, { "title": "Wnt-5a/Ca2+-induced NFAT activity is counteracted by Wnt-5a/Yes-Cdc42-casein kinase 1alpha signaling in human mammary epithelial cells.", "journal": "Molecular and cellular biology", "date": "2006", "authors": "Dejmek J, Safholm A, Kamp Nielsen C, Andersson T, Leandersson K", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "16880514", "url": "https://glygen.org/publication/PubMed/16880514" } ] }, { "title": "Mechanism of the receptor-catalyzed activation of heterotrimeric G proteins.", "journal": "Nature structural & molecular biology", "date": "2006", "authors": "Oldham WM, Van Eps N, Preininger AM, Hubbell WL, Hamm HE", "evidence": [ { "database": "Reactome", "id": "R-HSA-202040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202040" } ], "reference": [ { "type": "PubMed", "id": "16892066", "url": "https://glygen.org/publication/PubMed/16892066" } ] }, { "title": "Suppression of cyclic GMP-dependent protein kinase is essential to the Wnt/cGMP/Ca2+ pathway.", "journal": "The Journal of biological chemistry", "date": "2006", "authors": "Ma L, Wang HY", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "16920709", "url": "https://glygen.org/publication/PubMed/16920709" } ] }, { "title": "Structural basis of function in heterotrimeric G proteins.", "journal": "Quarterly reviews of biophysics", "date": "2006", "authors": "Oldham WM, Hamm HE", "evidence": [ { "database": "Reactome", "id": "R-HSA-418597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418597" } ], "reference": [ { "type": "PubMed", "id": "16923326", "url": "https://glygen.org/publication/PubMed/16923326" } ] }, { "title": "Cell physiology of cAMP sensor Epac.", "journal": "The Journal of physiology", "date": "2006", "authors": "Holz GG, Kang G, Harbeck M, Roe MW, Chepurny OG", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "16973695", "url": "https://glygen.org/publication/PubMed/16973695" } ] }, { "title": "Integration of rapid signaling events with steroid hormone receptor action in breast and prostate cancer.", "journal": "Annual review of physiology", "date": "2007", "authors": "Lange CA, Gioeli D, Hammes SR, Marker PC", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "17037979", "url": "https://glygen.org/publication/PubMed/17037979" } ] }, { "title": "Some G protein heterotrimers physically dissociate in living cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2006", "authors": "Digby GJ, Lober RM, Sethi PR, Lambert NA", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "17095603", "url": "https://glygen.org/publication/PubMed/17095603" } ] }, { "title": "A Role of myosin Vb and Rab11-FIP2 in the aquaporin-2 shuttle.", "journal": "Traffic (Copenhagen, Denmark)", "date": "2007", "authors": "Nedvetsky PI, Stefan E, Frische S, Santamaria K, Wiesner B, Valenti G, Hammer JA 3rd, Nielsen S, Goldenring JR, Rosenthal W, Klussmann E", "evidence": [ { "database": "Reactome", "id": "R-HSA-432040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432040" } ], "reference": [ { "type": "PubMed", "id": "17156409", "url": "https://glygen.org/publication/PubMed/17156409" } ] }, { "title": "Phosphodiesterase 4 inhibitors for the treatment of asthma and COPD.", "journal": "Current medicinal chemistry", "date": "2006", "authors": "Huang Z, Mancini JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "17168849", "url": "https://glygen.org/publication/PubMed/17168849" } ] }, { "title": "Identification of arylsulfonamides as Aquaporin 4 inhibitors.", "journal": "Bioorganic & medicinal chemistry letters", "date": "2007", "authors": "Huber VJ, Tsujita M, Yamazaki M, Sakimura K, Nakada T", "evidence": [ { "database": "Reactome", "id": "R-HSA-432040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432040" } ], "reference": [ { "type": "PubMed", "id": "17178220", "url": "https://glygen.org/publication/PubMed/17178220" } ] }, { "title": "Evidence for association of GABA(B) receptors with Kir3 channels and regulators of G protein signalling (RGS4) proteins.", "journal": "The Journal of physiology", "date": "2007", "authors": "Fowler CE, Aryal P, Suen KF, Slesinger PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1296041", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1296041" } ], "reference": [ { "type": "PubMed", "id": "17185339", "url": "https://glygen.org/publication/PubMed/17185339" } ] }, { "title": "Mechanisms of action of glucagon-like peptide 1 in the pancreas.", "journal": "Pharmacology & therapeutics", "date": "2007", "authors": "Doyle ME, Egan JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "17306374", "url": "https://glygen.org/publication/PubMed/17306374" } ] }, { "title": "Activation of the novel estrogen receptor G protein-coupled receptor 30 (GPR30) at the plasma membrane.", "journal": "Endocrinology", "date": "2007", "authors": "Filardo E, Quinn J, Pang Y, Graeber C, Shaw S, Dong J, Thomas P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634597" } ], "reference": [ { "type": "PubMed", "id": "17379646", "url": "https://glygen.org/publication/PubMed/17379646" } ] }, { "title": "Primary structure and characterization of the precursor to human pituitary adenylate cyclase activating polypeptide.", "journal": "DNA and cell biology", "date": "1992", "authors": "Ohkubo S, Kimura C, Ogi K, Okazaki K, Hosoya M, Onda H, Miyata A, Arimura A, Fujino M", "evidence": [ { "database": "Reactome", "id": "R-HSA-420092", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-420092" } ], "reference": [ { "type": "PubMed", "id": "1739432", "url": "https://glygen.org/publication/PubMed/1739432" } ] }, { "title": "Steroid hormone rapid signaling: the pivotal role of S-palmitoylation.", "journal": "IUBMB life", "date": "2006", "authors": "Marino M, Ascenzi P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "17424910", "url": "https://glygen.org/publication/PubMed/17424910" } ] }, { "title": "The Wnt5A/protein kinase C pathway mediates motility in melanoma cells via the inhibition of metastasis suppressors and initiation of an epithelial to mesenchymal transition.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Dissanayake SK, Wade M, Johnson CE, O'Connell MP, Leotlela PD, French AD, Shah KV, Hewitt KJ, Rosenthal DT, Indig FE, Jiang Y, Nickoloff BJ, Taub DD, Trent JM, Moon RT, Bittner M, Weeraratna AT", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "17426020", "url": "https://glygen.org/publication/PubMed/17426020" } ] }, { "title": "Differential structural properties of GLP-1 and exendin-4 determine their relative affinity for the GLP-1 receptor N-terminal extracellular domain.", "journal": "Biochemistry", "date": "2007", "authors": "Runge S, Schimmer S, Oschmann J, Schiodt CB, Knudsen SM, Jeppesen CB, Madsen K, Lau J, Thogersen H, Rudolph R", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "17444618", "url": "https://glygen.org/publication/PubMed/17444618" } ] }, { "title": "Estrogen signaling via a linear pathway involving insulin-like growth factor I receptor, matrix metalloproteinases, and epidermal growth factor receptor to activate mitogen-activated protein kinase in MCF-7 breast cancer cells.", "journal": "Endocrinology", "date": "2007", "authors": "Song RX, Zhang Z, Chen Y, Bao Y, Santen RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "17525128", "url": "https://glygen.org/publication/PubMed/17525128" } ] }, { "title": "A conserved mechanism for steroid receptor translocation to the plasma membrane.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Pedram A, Razandi M, Sainson RC, Kim JK, Hughes CC, Levin ER", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "17535799", "url": "https://glygen.org/publication/PubMed/17535799" } ] }, { "title": "2-[4-[(5,6-diphenylpyrazin-2-yl)(isopropyl)amino]butoxy]-N-(methylsulfonyl)acetamide (NS-304), an orally available and long-acting prostacyclin receptor agonist prodrug.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "2007", "authors": "Kuwano K, Hashino A, Asaki T, Hamamoto T, Yamada T, Okubo K, Kuwabara K", "evidence": [ { "database": "Reactome", "id": "R-HSA-392851", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-392851" } ], "reference": [ { "type": "PubMed", "id": "17545310", "url": "https://glygen.org/publication/PubMed/17545310" } ] }, { "title": "Mitogen-activated protein kinase p38 regulates the Wnt/cyclic GMP/Ca2+ non-canonical pathway.", "journal": "The Journal of biological chemistry", "date": "2007", "authors": "Ma L, Wang HY", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "17684012", "url": "https://glygen.org/publication/PubMed/17684012" } ] }, { "title": "G-protein-coupled receptors and islet function-implications for treatment of type 2 diabetes.", "journal": "Pharmacology & therapeutics", "date": "2007", "authors": "Winzell MS, Ahren B", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "17900700", "url": "https://glygen.org/publication/PubMed/17900700" } ] }, { "title": "Extranuclear steroid receptors: nature and actions.", "journal": "Endocrine reviews", "date": "2007", "authors": "Hammes SR, Levin ER", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "17916740", "url": "https://glygen.org/publication/PubMed/17916740" } ] }, { "title": "Variant estrogen receptor-c-Src molecular interdependence and c-Src structural requirements for endothelial NO synthase activation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2007", "authors": "Li L, Hisamoto K, Kim KH, Haynes MP, Bauer PM, Sanjay A, Collinge M, Baron R, Sessa WC, Bender JR", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "17921256", "url": "https://glygen.org/publication/PubMed/17921256" } ] }, { "title": "PDE4 inhibitors as potential therapeutic agents in the treatment of COPD-focus on roflumilast.", "journal": "International journal of chronic obstructive pulmonary disease", "date": "2007", "authors": "Boswell-Smith V, Spina D", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "18044684", "url": "https://glygen.org/publication/PubMed/18044684" } ] }, { "title": "Both G i and G o heterotrimeric G proteins are required to exert the full effect of norepinephrine on the beta-cell K ATP channel.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Zhao Y, Fang Q, Straub SG, Sharp GW", "evidence": [ { "database": "Reactome", "id": "R-HSA-400042", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400042" } ], "reference": [ { "type": "PubMed", "id": "18162464", "url": "https://glygen.org/publication/PubMed/18162464" } ] }, { "title": "Role of the cAMP sensor Epac as a determinant of KATP channel ATP sensitivity in human pancreatic beta-cells and rat INS-1 cells.", "journal": "The Journal of physiology", "date": "2008", "authors": "Kang G, Leech CA, Chepurny OG, Coetzee WA, Holz GG", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "18202100", "url": "https://glygen.org/publication/PubMed/18202100" } ] }, { "title": "Mechanism of selectivity in aquaporins and aquaglyceroporins.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Hub JS, de Groot BL", "evidence": [ { "database": "Reactome", "id": "R-HSA-432040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432040" } ], "reference": [ { "type": "PubMed", "id": "18202181", "url": "https://glygen.org/publication/PubMed/18202181" } ] }, { "title": "Membrane association of estrogen receptor alpha and beta influences 17beta-estradiol-mediated cancer cell proliferation.", "journal": "Steroids", "date": "2008", "authors": "Marino M, Ascenzi P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "18206197", "url": "https://glygen.org/publication/PubMed/18206197" } ] }, { "title": "Cloning and expression of cDNA for a human thromboxane A2 receptor.", "journal": "Nature", "date": "1991", "authors": "Hirata M, Hayashi Y, Ushikubi F, Yokota Y, Kageyama R, Nakanishi S, Narumiya S", "evidence": [ { "database": "Reactome", "id": "R-HSA-428930", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-428930" } ], "reference": [ { "type": "PubMed", "id": "1825698", "url": "https://glygen.org/publication/PubMed/1825698" } ] }, { "title": "Crystal structure of the ligand-bound glucagon-like peptide-1 receptor extracellular domain.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Runge S, Thogersen H, Madsen K, Lau J, Rudolph R", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "18287102", "url": "https://glygen.org/publication/PubMed/18287102" } ] }, { "title": "Thromboxane A2: physiology/pathophysiology, cellular signal transduction and pharmacology.", "journal": "Pharmacology & therapeutics", "date": "2008", "authors": "Nakahata N", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "18374420", "url": "https://glygen.org/publication/PubMed/18374420" } ] }, { "title": "Design and synthesis of conformationally constrained glucagon-like peptide-1 derivatives with increased plasma stability and prolonged in vivo activity.", "journal": "Journal of medicinal chemistry", "date": "2008", "authors": "Miranda LP, Winters KA, Gegg CV, Patel A, Aral J, Long J, Zhang J, Diamond S, Guido M, Stanislaus S, Ma M, Li H, Rose MJ, Poppe L, Veniant MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "18412318", "url": "https://glygen.org/publication/PubMed/18412318" } ] }, { "title": "Structural diversity in the RGS domain and its interaction with heterotrimeric G protein alpha-subunits.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Soundararajan M, Willard FS, Kimple AJ, Turnbull AP, Ball LJ, Schoch GA, Gileadi C, Fedorov OY, Dowler EF, Higman VA, Hutsell SQ, Sundstrom M, Doyle DA, Siderovski DP", "evidence": [ { "database": "Reactome", "id": "R-HSA-418597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418597" } ], "reference": [ { "type": "PubMed", "id": "18434541", "url": "https://glygen.org/publication/PubMed/18434541" } ] }, { "title": "Signal transducing membrane complexes of photoreceptor outer segments.", "journal": "Vision research", "date": "2008", "authors": "Wensel TG", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "18456304", "url": "https://glygen.org/publication/PubMed/18456304" } ] }, { "title": "G protein betagamma subunits: central mediators of G protein-coupled receptor signaling.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2008", "authors": "Smrcka AV", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "18488142", "url": "https://glygen.org/publication/PubMed/18488142" } ] }, { "title": "Functional interactions of recombinant alpha 2 adrenergic receptor subtypes and G proteins in reconstituted phospholipid vesicles.", "journal": "Biochemistry", "date": "1991", "authors": "Kurose H, Regan JW, Caron MG, Lefkowitz RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-400042", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400042" } ], "reference": [ { "type": "PubMed", "id": "1849000", "url": "https://glygen.org/publication/PubMed/1849000" } ] }, { "title": "Novel variants in human Aquaporin-4 reduce cellular water permeability.", "journal": "Human molecular genetics", "date": "2008", "authors": "Sorani MD, Zador Z, Hurowitz E, Yan D, Giacomini KM, Manley GT", "evidence": [ { "database": "Reactome", "id": "R-HSA-432040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432040" } ], "reference": [ { "type": "PubMed", "id": "18511455", "url": "https://glygen.org/publication/PubMed/18511455" } ] }, { "title": "The G protein coupled to the thromboxane A2 receptor in human platelets is a member of the novel Gq family.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Shenker A, Goldsmith P, Unson CG, Spiegel AM", "evidence": [ { "database": "Reactome", "id": "R-HSA-428930", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-428930" } ], "reference": [ { "type": "PubMed", "id": "1851174", "url": "https://glygen.org/publication/PubMed/1851174" } ] }, { "title": "Galphaq binds two effectors separately in cells: evidence for predetermined signaling pathways.", "journal": "Biophysical journal", "date": "2008", "authors": "Golebiewska U, Scarlata S", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "18515384", "url": "https://glygen.org/publication/PubMed/18515384" } ] }, { "title": "G protein-coupled receptor 30 localizes to the endoplasmic reticulum and is not activated by estradiol.", "journal": "Endocrinology", "date": "2008", "authors": "Otto C, Rohde-Schulz B, Schwarz G, Fuchs I, Klewer M, Brittain D, Langer G, Bader B, Prelle K, Nubbemeyer R, Fritzemeier KH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634597" } ], "reference": [ { "type": "PubMed", "id": "18566127", "url": "https://glygen.org/publication/PubMed/18566127" } ] }, { "title": "Dissociation of heterotrimeric g proteins in cells.", "journal": "Science signaling", "date": "2008", "authors": "Lambert NA", "evidence": [ { "database": "Reactome", "id": "R-HSA-456926", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-456926" } ], "reference": [ { "type": "PubMed", "id": "18577758", "url": "https://glygen.org/publication/PubMed/18577758" } ] }, { "title": "Regulation of estrogen rapid signaling through arginine methylation by PRMT1.", "journal": "Molecular cell", "date": "2008", "authors": "Le Romancer M, Treilleux I, Leconte N, Robin-Lespinasse Y, Sentis S, Bouchekioua-Bouzaghou K, Goddard S, Gobert-Gosse S, Corbo L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "18657504", "url": "https://glygen.org/publication/PubMed/18657504" } ] }, { "title": "Compartmentalization of aquaporins in the human intestine.", "journal": "International journal of environmental research and public health", "date": "2008", "authors": "Cohly HH, Isokpehi R, Rajnarayanan RV", "evidence": [ { "database": "Reactome", "id": "R-HSA-432040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432040" } ], "reference": [ { "type": "PubMed", "id": "18678926", "url": "https://glygen.org/publication/PubMed/18678926" } ] }, { "title": "beta-Arrestin1 interacts with the G-protein subunits beta1gamma2 and promotes beta1gamma2-dependent Akt signalling for NF-kappaB activation.", "journal": "The Biochemical journal", "date": "2009", "authors": "Yang M, He RL, Benovic JL, Ye RD", "evidence": [ { "database": "RefSeq", "id": "NP_001185683", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001185683" } ], "reference": [ { "type": "PubMed", "id": "18729826", "url": "https://glygen.org/publication/PubMed/18729826" } ] }, { "title": "Assembly of high order G alpha q-effector complexes with RGS proteins.", "journal": "The Journal of biological chemistry", "date": "2008", "authors": "Shankaranarayanan A, Thal DM, Tesmer VM, Roman DL, Neubig RR, Kozasa T, Tesmer JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "18936096", "url": "https://glygen.org/publication/PubMed/18936096" } ] }, { "title": "G alpha 16, a G protein alpha subunit specifically expressed in hematopoietic cells.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1991", "authors": "Amatruda TT 3rd, Steele DA, Slepak VZ, Simon MI", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "1905813", "url": "https://glygen.org/publication/PubMed/1905813" } ] }, { "title": "The efficacy and safety of cilomilast in COPD.", "journal": "Drugs", "date": "2008", "authors": "Rennard S, Knobil K, Rabe KF, Morris A, Schachter N, Locantore N, Canonica WG, Zhu Y, Barnhart F", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "19105585", "url": "https://glygen.org/publication/PubMed/19105585" } ] }, { "title": "Estrogen signals via an extra-nuclear pathway involving IGF-1R and EGFR in tamoxifen-sensitive and -resistant breast cancer cells.", "journal": "Steroids", "date": "2009", "authors": "Santen RJ, Fan P, Zhang Z, Bao Y, Song RX, Yue W", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "19138696", "url": "https://glygen.org/publication/PubMed/19138696" } ] }, { "title": "Role of multiple phosphorylation sites in the COOH-terminal tail of aquaporin-2 for water transport: evidence against channel gating.", "journal": "American journal of physiology. Renal physiology", "date": "2009", "authors": "Moeller HB, MacAulay N, Knepper MA, Fenton RA", "evidence": [ { "database": "Reactome", "id": "R-HSA-432040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432040" } ], "reference": [ { "type": "PubMed", "id": "19144687", "url": "https://glygen.org/publication/PubMed/19144687" } ] }, { "title": "Distribution of the AQP4 water channel in normal human tissues: protein and tissue microarrays reveal expression in several new anatomical locations, including the prostate gland and seminal vesicles.", "journal": "Channels (Austin, Tex.)", "date": "2007", "authors": "Mobasheri A, Marples D, Young IS, Floyd RV, Moskaluk CA, Frigeri A", "evidence": [ { "database": "Reactome", "id": "R-HSA-432040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432040" } ], "reference": [ { "type": "PubMed", "id": "19170255", "url": "https://glygen.org/publication/PubMed/19170255" } ] }, { "title": "Wnt5A activates the calpain-mediated cleavage of filamin A.", "journal": "The Journal of investigative dermatology", "date": "2009", "authors": "O'Connell MP, Fiori JL, Baugher KM, Indig FE, French AD, Camilli TC, Frank BP, Earley R, Hoek KS, Hasskamp JH, Elias EG, Taub DD, Bernier M, Weeraratna AT", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "19177143", "url": "https://glygen.org/publication/PubMed/19177143" } ] }, { "title": "Regulation and physiological functions of G12/13-mediated signaling pathways.", "journal": "Neuro-Signals", "date": "2009", "authors": "Suzuki N, Hajicek N, Kozasa T", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "19212140", "url": "https://glygen.org/publication/PubMed/19212140" } ] }, { "title": "The c-terminus of GRK3 indicates rapid dissociation of G protein heterotrimers.", "journal": "Cellular signalling", "date": "2009", "authors": "Hollins B, Kuravi S, Digby GJ, Lambert NA", "evidence": [ { "database": "Reactome", "id": "R-HSA-400042", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400042" } ], "reference": [ { "type": "PubMed", "id": "19258039", "url": "https://glygen.org/publication/PubMed/19258039" } ] }, { "title": "Glutamate binding and conformational flexibility of ligand-binding domains are critical early determinants of efficient kainate receptor biogenesis.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Gill MB, Vivithanaporn P, Swanson GT", "evidence": [ { "database": "Reactome", "id": "R-HSA-500657", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-500657" } ], "reference": [ { "type": "PubMed", "id": "19342380", "url": "https://glygen.org/publication/PubMed/19342380" } ] }, { "title": "Coordinate regulation of estrogen-mediated fibronectin matrix assembly and epidermal growth factor receptor transactivation by the G protein-coupled receptor, GPR30.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2009", "authors": "Quinn JA, Graeber CT, Frackelton AR Jr, Kim M, Schwarzbauer JE, Filardo EJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634597" } ], "reference": [ { "type": "PubMed", "id": "19342448", "url": "https://glygen.org/publication/PubMed/19342448" } ] }, { "title": "Role of molecular chaperones in G protein beta5/regulator of G protein signaling dimer assembly and G protein betagamma dimer specificity.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Howlett AC, Gray AJ, Hunter JM, Willardson BM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6814122", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6814122" } ], "reference": [ { "type": "PubMed", "id": "19376773", "url": "https://glygen.org/publication/PubMed/19376773" } ] }, { "title": "Crystal structure of human aquaporin 4 at 1.8 A and its mechanism of conductance.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2009", "authors": "Ho JD, Yeh R, Sandstrom A, Chorny I, Harries WE, Robbins RA, Miercke LJ, Stroud RM", "evidence": [ { "database": "Reactome", "id": "R-HSA-432040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432040" } ], "reference": [ { "type": "PubMed", "id": "19383790", "url": "https://glygen.org/publication/PubMed/19383790" } ] }, { "title": "Phosphorylation of Gz in human platelets. Selectivity and site of modification.", "journal": "The Journal of biological chemistry", "date": "1991", "authors": "Lounsbury KM, Casey PJ, Brass LF, Manning DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-418597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418597" } ], "reference": [ { "type": "PubMed", "id": "1939224", "url": "https://glygen.org/publication/PubMed/1939224" } ] }, { "title": "Proximal events in Wnt signal transduction.", "journal": "Nature reviews. Molecular cell biology", "date": "2009", "authors": "Angers S, Moon RT", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "19536106", "url": "https://glygen.org/publication/PubMed/19536106" } ] }, { "title": "Concerted action of two cation filters in the aquaporin water channel.", "journal": "The EMBO journal", "date": "2009", "authors": "Wu B, Steinbronn C, Alsterfjord M, Zeuthen T, Beitz E", "evidence": [ { "database": "Reactome", "id": "R-HSA-432040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432040" } ], "reference": [ { "type": "PubMed", "id": "19574955", "url": "https://glygen.org/publication/PubMed/19574955" } ] }, { "title": "SCH 530348: a novel oral thrombin receptor antagonist.", "journal": "Future cardiology", "date": "2009", "authors": "Bonaca MP, Morrow DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-456926", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-456926" } ], "reference": [ { "type": "PubMed", "id": "19715408", "url": "https://glygen.org/publication/PubMed/19715408" } ] }, { "title": "Estradiol-mediated ERK phosphorylation and apoptosis in vascular smooth muscle cells requires GPR 30.", "journal": "American journal of physiology. Cell physiology", "date": "2009", "authors": "Ding Q, Gros R, Limbird LE, Chorazyczewski J, Feldman RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634597" } ], "reference": [ { "type": "PubMed", "id": "19741198", "url": "https://glygen.org/publication/PubMed/19741198" } ] }, { "title": "NFAT proteins: emerging roles in cancer progression.", "journal": "Nature reviews. Cancer", "date": "2009", "authors": "Mancini M, Toker A", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "19851316", "url": "https://glygen.org/publication/PubMed/19851316" } ] }, { "title": "Functional characterization of N-terminally GFP-tagged GLP-1 receptor.", "journal": "Journal of biomedicine & biotechnology", "date": "2009", "authors": "Bavec A, Licar A", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "19859570", "url": "https://glygen.org/publication/PubMed/19859570" } ] }, { "title": "Crystal structure of glucagon-like peptide-1 in complex with the extracellular domain of the glucagon-like peptide-1 receptor.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Underwood CR, Garibay P, Knudsen LB, Hastrup S, Peters GH, Rudolph R, Reedtz-Runge S", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "19861722", "url": "https://glygen.org/publication/PubMed/19861722" } ] }, { "title": "AN-2728, a PDE4 inhibitor for the potential topical treatment of psoriasis and atopic dermatitis.", "journal": "Current opinion in investigational drugs (London, England : 2000)", "date": "2009", "authors": "Nazarian R, Weinberg JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "19876791", "url": "https://glygen.org/publication/PubMed/19876791" } ] }, { "title": "Cell proliferation regulated by estradiol receptor: Therapeutic implications.", "journal": "Steroids", "date": "2010", "authors": "Castoria G, Migliaccio A, Giovannelli P, Auricchio F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "19879889", "url": "https://glygen.org/publication/PubMed/19879889" } ] }, { "title": "Ibudilast: a review of its pharmacology, efficacy and safety in respiratory and neurological disease.", "journal": "Expert opinion on pharmacotherapy", "date": "2009", "authors": "Rolan P, Hutchinson M, Johnson K", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "19929708", "url": "https://glygen.org/publication/PubMed/19929708" } ] }, { "title": "Conserved estrogen binding and signaling functions of the G protein-coupled estrogen receptor 1 (GPER) in mammals and fish.", "journal": "Steroids", "date": "2010", "authors": "Thomas P, Alyea R, Pang Y, Peyton C, Dong J, Berg AH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634597" } ], "reference": [ { "type": "PubMed", "id": "19931550", "url": "https://glygen.org/publication/PubMed/19931550" } ] }, { "title": "cGMP-phosphodiesterase 6, transducin and Wnt5a/Frizzled-2-signaling control cGMP and Ca(2+) homeostasis in melanoma cells.", "journal": "Cellular and molecular life sciences : CMLS", "date": "2010", "authors": "Bazhin AV, Tambor V, Dikov B, Philippov PP, Schadendorf D, Eichmuller SB", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "19946729", "url": "https://glygen.org/publication/PubMed/19946729" } ] }, { "title": "Atypical functional properties of GluK3-containing kainate receptors.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2009", "authors": "Perrais D, Coussen F, Mulle C", "evidence": [ { "database": "Reactome", "id": "R-HSA-500657", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-500657" } ], "reference": [ { "type": "PubMed", "id": "20007474", "url": "https://glygen.org/publication/PubMed/20007474" } ] }, { "title": "The preclinical pharmacology of roflumilast--a selective, oral phosphodiesterase 4 inhibitor in development for chronic obstructive pulmonary disease.", "journal": "Pulmonary pharmacology & therapeutics", "date": "2010", "authors": "Hatzelmann A, Morcillo EJ, Lungarella G, Adnot S, Sanjar S, Beume R, Schudt C, Tenor H", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "20381629", "url": "https://glygen.org/publication/PubMed/20381629" } ] }, { "title": "Heat shock protein 27 is required for sex steroid receptor trafficking to and functioning at the plasma membrane.", "journal": "Molecular and cellular biology", "date": "2010", "authors": "Razandi M, Pedram A, Levin ER", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "20439495", "url": "https://glygen.org/publication/PubMed/20439495" } ] }, { "title": "Gbeta5 recruits R7 RGS proteins to GIRK channels to regulate the timing of neuronal inhibitory signaling.", "journal": "Nature neuroscience", "date": "2010", "authors": "Xie K, Allen KL, Kourrich S, Colon-Saez J, Thomas MJ, Wickman K, Martemyanov KA", "evidence": [ { "database": "Reactome", "id": "R-HSA-1296041", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1296041" } ], "reference": [ { "type": "PubMed", "id": "20453851", "url": "https://glygen.org/publication/PubMed/20453851" } ] }, { "title": "The effect of epidermal growth factor receptor variant III on glioma cell migration by stimulating ERK phosphorylation through the focal adhesion kinase signaling pathway.", "journal": "Archives of biochemistry and biophysics", "date": "2010", "authors": "Liu M, Yang Y, Wang C, Sun L, Mei C, Yao W, Liu Y, Shi Y, Qiu S, Fan J, Cai X, Zha X", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "20650261", "url": "https://glygen.org/publication/PubMed/20650261" } ] }, { "title": "GABAB-GIRK2-mediated signaling in Down syndrome.", "journal": "Advances in pharmacology (San Diego, Calif.)", "date": "2010", "authors": "Cramer NP, Best TK, Stoffel M, Siarey RJ, Galdzicki Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-1296041", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1296041" } ], "reference": [ { "type": "PubMed", "id": "20655490", "url": "https://glygen.org/publication/PubMed/20655490" } ] }, { "title": "Mechanism of action and clinical development of platelet thrombin receptor antagonists.", "journal": "Expert review of cardiovascular therapy", "date": "2010", "authors": "Ueno M, Ferreiro JL, Angiolillo DJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-456926", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-456926" } ], "reference": [ { "type": "PubMed", "id": "20670195", "url": "https://glygen.org/publication/PubMed/20670195" } ] }, { "title": "Minireview: Extranuclear steroid receptors: roles in modulation of cell functions.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2011", "authors": "Levin ER", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "20861220", "url": "https://glygen.org/publication/PubMed/20861220" } ] }, { "title": "Ibudilast, a mixed PDE3/4 inhibitor, causes a selective and nitric oxide/cGMP-independent relaxation of the intracranial vertebrobasilar artery.", "journal": "European journal of pharmacology", "date": "2011", "authors": "Yamazaki T, Anraku T, Matsuzawa S", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "21036126", "url": "https://glygen.org/publication/PubMed/21036126" } ] }, { "title": "Homodimerization of Nemo-like kinase is essential for activation and nuclear localization.", "journal": "Molecular biology of the cell", "date": "2011", "authors": "Ishitani S, Inaba K, Matsumoto K, Ishitani T", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "21118996", "url": "https://glygen.org/publication/PubMed/21118996" } ] }, { "title": "Interaction of angio-associated migratory cell protein with the TPalpha and TPbeta isoforms of the human thromboxane A(2) receptor.", "journal": "Cellular signalling", "date": "2011", "authors": "Reid HM, Wikstrom K, Kavanagh DJ, Mulvaney EP, Kinsella BT", "evidence": [ { "database": "Reactome", "id": "R-HSA-428930", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-428930" } ], "reference": [ { "type": "PubMed", "id": "21172430", "url": "https://glygen.org/publication/PubMed/21172430" } ] }, { "title": "beta-Arrestin: a protein that regulates beta-adrenergic receptor function.", "journal": "Science (New York, N.Y.)", "date": "1990", "authors": "Lohse MJ, Benovic JL, Codina J, Caron MG, Lefkowitz RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "2163110", "url": "https://glygen.org/publication/PubMed/2163110" } ] }, { "title": "Cracking the estrogen receptor's posttranslational code in breast tumors.", "journal": "Endocrine reviews", "date": "2011", "authors": "Le Romancer M, Poulard C, Cohen P, Sentis S, Renoir JM, Corbo L", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "21680538", "url": "https://glygen.org/publication/PubMed/21680538" } ] }, { "title": "The G-protein-coupled estrogen receptor GPER in health and disease.", "journal": "Nature reviews. Endocrinology", "date": "2011", "authors": "Prossnitz ER, Barton M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634597" } ], "reference": [ { "type": "PubMed", "id": "21844907", "url": "https://glygen.org/publication/PubMed/21844907" } ] }, { "title": "Roles for oestrogen receptor beta in adult brain function.", "journal": "Journal of neuroendocrinology", "date": "2012", "authors": "Handa RJ, Ogawa S, Wang JM, Herbison AE", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "21851428", "url": "https://glygen.org/publication/PubMed/21851428" } ] }, { "title": "Wnt/Ca2+ signaling pathway: a brief overview.", "journal": "Acta biochimica et biophysica Sinica", "date": "2011", "authors": "De A", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "21903638", "url": "https://glygen.org/publication/PubMed/21903638" } ] }, { "title": "Minireview: Recent advances in extranuclear steroid receptor actions.", "journal": "Endocrinology", "date": "2011", "authors": "Hammes SR, Levin ER", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "22028449", "url": "https://glygen.org/publication/PubMed/22028449" } ] }, { "title": "DHHC-7 and -21 are palmitoylacyltransferases for sex steroid receptors.", "journal": "Molecular biology of the cell", "date": "2012", "authors": "Pedram A, Razandi M, Deschenes RJ, Levin ER", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "22031296", "url": "https://glygen.org/publication/PubMed/22031296" } ] }, { "title": "Tyrosine phosphorylation of estradiol receptor by Src regulates its hormone-dependent nuclear export and cell cycle progression in breast cancer cells.", "journal": "Oncogene", "date": "2012", "authors": "Castoria G, Giovannelli P, Lombardi M, De Rosa C, Giraldi T, de Falco A, Barone MV, Abbondanza C, Migliaccio A, Auricchio F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "22266855", "url": "https://glygen.org/publication/PubMed/22266855" } ] }, { "title": "Palmitoylation regulates 17beta-estradiol-induced estrogen receptor-alpha degradation and transcriptional activity.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "2012", "authors": "La Rosa P, Pesiri V, Leclercq G, Marino M, Acconcia F", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "22446104", "url": "https://glygen.org/publication/PubMed/22446104" } ] }, { "title": "Binding and activity of the prostacyclin receptor (IP) agonists, treprostinil and iloprost, at human prostanoid receptors: treprostinil is a potent DP1 and EP2 agonist.", "journal": "Biochemical pharmacology", "date": "2012", "authors": "Whittle BJ, Silverstein AM, Mottola DM, Clapp LH", "evidence": [ { "database": "Reactome", "id": "R-HSA-392851", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-392851" } ], "reference": [ { "type": "PubMed", "id": "22480736", "url": "https://glygen.org/publication/PubMed/22480736" } ] }, { "title": "Minireview: G protein-coupled estrogen receptor-1, GPER-1: its mechanism of action and role in female reproductive cancer, renal and vascular physiology.", "journal": "Endocrinology", "date": "2012", "authors": "Filardo EJ, Thomas P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634597" } ], "reference": [ { "type": "PubMed", "id": "22495674", "url": "https://glygen.org/publication/PubMed/22495674" } ] }, { "title": "Activation of p115-RhoGEF requires direct association of Galpha13 and the Dbl homology domain.", "journal": "The Journal of biological chemistry", "date": "2012", "authors": "Chen Z, Guo L, Hadas J, Gutowski S, Sprang SR, Sternweis PC", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "22661716", "url": "https://glygen.org/publication/PubMed/22661716" } ] }, { "title": "TAK1, more than just innate immunity.", "journal": "IUBMB life", "date": "2012", "authors": "Dai L, Aye Thu C, Liu XY, Xi J, Cheung PC", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "22941947", "url": "https://glygen.org/publication/PubMed/22941947" } ] }, { "title": "The complex world of WNT receptor signalling.", "journal": "Nature reviews. Molecular cell biology", "date": "2012", "authors": "Niehrs C", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "23151663", "url": "https://glygen.org/publication/PubMed/23151663" } ] }, { "title": "The way Wnt works: components and mechanism.", "journal": "Growth factors (Chur, Switzerland)", "date": "2013", "authors": "Saito-Diaz K, Chen TW, Wang X, Thorne CA, Wallace HA, Page-McCaw A, Lee E", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "23256519", "url": "https://glygen.org/publication/PubMed/23256519" } ] }, { "title": "miR-92b controls glioma proliferation and invasion through regulating Wnt/beta-catenin signaling via Nemo-like kinase.", "journal": "Neuro-oncology", "date": "2013", "authors": "Wang K, Wang X, Zou J, Zhang A, Wan Y, Pu P, Song Z, Qian C, Chen Y, Yang S, Wang Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "23416699", "url": "https://glygen.org/publication/PubMed/23416699" } ] }, { "title": "Structural studies on the regulation of Ca2+/calmodulin dependent protein kinase II.", "journal": "Current opinion in structural biology", "date": "2013", "authors": "Stratton MM, Chao LH, Schulman H, Kuriyan J", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "23632248", "url": "https://glygen.org/publication/PubMed/23632248" } ] }, { "title": "Phosducin-like protein 1 is essential for G-protein assembly and signaling in retinal rod photoreceptors.", "journal": "The Journal of neuroscience : the official journal of the Society for Neuroscience", "date": "2013", "authors": "Lai CW, Kolesnikov AV, Frederick JM, Blake DR, Jiang L, Stewart JS, Chen CK, Barrow JR, Baehr W, Kefalov VJ, Willardson BM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6814122", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6814122" } ], "reference": [ { "type": "PubMed", "id": "23637185", "url": "https://glygen.org/publication/PubMed/23637185" } ] }, { "title": "Nemo-like kinase (NLK) inhibits the progression of NSCLC via negatively modulating WNT signaling pathway.", "journal": "Journal of cellular biochemistry", "date": "2014", "authors": "Lv L, Wan C, Chen B, Li M, Liu Y, Ni T, Yang Y, Liu Y, Cong X, Mao G, Xue Q", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "23904219", "url": "https://glygen.org/publication/PubMed/23904219" } ] }, { "title": "Estradiol and tamoxifen induce cell migration through GPR30 and activation of focal adhesion kinase (FAK) in endometrial cancers with low or without nuclear estrogen receptor alpha (ERalpha).", "journal": "PloS one", "date": "2013", "authors": "Tsai CL, Wu HM, Lin CY, Lin YJ, Chao A, Wang TH, Hsueh S, Lai CH, Wang HS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "24039841", "url": "https://glygen.org/publication/PubMed/24039841" } ] }, { "title": "Pharmacology of the bipyridines: amrinone and milrinone.", "journal": "Circulation", "date": "1986", "authors": "Alousi AA, Johnson DC", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "2417744", "url": "https://glygen.org/publication/PubMed/2417744" } ] }, { "title": "Impact of interleukin-6 in hematological malignancies.", "journal": "Transfusion medicine and hemotherapy : offizielles Organ der Deutschen Gesellschaft fur Transfusionsmedizin und Immunhamatologie", "date": "2013", "authors": "Burger R", "evidence": [ { "database": "Reactome", "id": "R-HSA-9660821", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9660821" } ], "reference": [ { "type": "PubMed", "id": "24273487", "url": "https://glygen.org/publication/PubMed/24273487" } ] }, { "title": "Stress-related hormone norepinephrine induces interleukin-6 expression in GES-1 cells.", "journal": "Brazilian journal of medical and biological research = Revista brasileira de pesquisas medicas e biologicas", "date": "2014", "authors": "Yang R, Lin Q, Gao HB, Zhang P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9660821", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9660821" } ], "reference": [ { "type": "PubMed", "id": "24519125", "url": "https://glygen.org/publication/PubMed/24519125" } ] }, { "title": "Estrogen biology: new insights into GPER function and clinical opportunities.", "journal": "Molecular and cellular endocrinology", "date": "2014", "authors": "Prossnitz ER, Barton M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "24530924", "url": "https://glygen.org/publication/PubMed/24530924" } ] }, { "title": "Advances in targeting cyclic nucleotide phosphodiesterases.", "journal": "Nature reviews. Drug discovery", "date": "2014", "authors": "Maurice DH, Ke H, Ahmad F, Wang Y, Chung J, Manganiello VC", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "24687066", "url": "https://glygen.org/publication/PubMed/24687066" } ] }, { "title": "Functional and ligand binding studies suggest heterogeneity of platelet prostacyclin receptors.", "journal": "British journal of pharmacology", "date": "1989", "authors": "Armstrong RA, Lawrence RA, Jones RL, Wilson NH, Collier A", "evidence": [ { "database": "Reactome", "id": "R-HSA-392851", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-392851" } ], "reference": [ { "type": "PubMed", "id": "2474350", "url": "https://glygen.org/publication/PubMed/2474350" } ] }, { "title": "Expression of Gs alpha in Escherichia coli. Purification and properties of two forms of the protein.", "journal": "The Journal of biological chemistry", "date": "1989", "authors": "Graziano MP, Freissmuth M, Gilman AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "2491850", "url": "https://glygen.org/publication/PubMed/2491850" } ] }, { "title": "G protein-coupled receptor 30 (GPR30) forms a plasma membrane complex with membrane-associated guanylate kinases (MAGUKs) and protein kinase A-anchoring protein 5 (AKAP5) that constitutively inhibits cAMP production.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Broselid S, Berg KA, Chavera TA, Kahn R, Clarke WP, Olde B, Leeb-Lundberg LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634597" } ], "reference": [ { "type": "PubMed", "id": "24962572", "url": "https://glygen.org/publication/PubMed/24962572" } ] }, { "title": "Alpha transducin is present in blue-, green-, and red-sensitive cone photoreceptors in the human retina.", "journal": "Neuron", "date": "1989", "authors": "Lerea CL, Bunt-Milam AH, Hurley JB", "evidence": [ { "database": "Reactome", "id": "R-HSA-418594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418594" } ], "reference": [ { "type": "PubMed", "id": "2534964", "url": "https://glygen.org/publication/PubMed/2534964" } ] }, { "title": "Ripasudil: first global approval.", "journal": "Drugs", "date": "2014", "authors": "Garnock-Jones KP", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "25414122", "url": "https://glygen.org/publication/PubMed/25414122" } ] }, { "title": "Pharmacology of positive inotropic phosphodiesterase III inhibitors.", "journal": "European heart journal", "date": "1989", "authors": "Honerjager P", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "2553411", "url": "https://glygen.org/publication/PubMed/2553411" } ] }, { "title": "Multiple signaling pathways of histamine H2 receptors. Identification of an H2 receptor-dependent Ca2+ mobilization pathway in human HL-60 promyelocytic leukemia cells.", "journal": "The Journal of biological chemistry", "date": "1989", "authors": "Mitsuhashi M, Mitsuhashi T, Payan DG", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "2553705", "url": "https://glygen.org/publication/PubMed/2553705" } ] }, { "title": "Extranuclear steroid receptors are essential for steroid hormone actions.", "journal": "Annual review of medicine", "date": "2015", "authors": "Levin ER", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "25587652", "url": "https://glygen.org/publication/PubMed/25587652" } ] }, { "title": "Retinal cone photoreceptors require phosducin-like protein 1 for G protein complex assembly and signaling.", "journal": "PloS one", "date": "2015", "authors": "Tracy CM, Kolesnikov AV, Blake DR, Chen CK, Baehr W, Kefalov VJ, Willardson BM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6814122", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6814122" } ], "reference": [ { "type": "PubMed", "id": "25659125", "url": "https://glygen.org/publication/PubMed/25659125" } ] }, { "title": "Structures of the Gbeta-CCT and PhLP1-Gbeta-CCT complexes reveal a mechanism for G-protein beta-subunit folding and Gbetagamma dimer assembly.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2015", "authors": "Plimpton RL, Cuellar J, Lai CW, Aoba T, Makaju A, Franklin S, Mathis AD, Prince JT, Carrascosa JL, Valpuesta JM, Willardson BM", "evidence": [ { "database": "Reactome", "id": "R-HSA-6814122", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6814122" } ], "reference": [ { "type": "PubMed", "id": "25675501", "url": "https://glygen.org/publication/PubMed/25675501" } ] }, { "title": "The G-protein coupled estrogen receptor, GPER: The inside and inside-out story.", "journal": "Molecular and cellular endocrinology", "date": "2015", "authors": "Gaudet HM, Cheng SB, Christensen EM, Filardo EJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634597" } ], "reference": [ { "type": "PubMed", "id": "26190834", "url": "https://glygen.org/publication/PubMed/26190834" } ] }, { "title": "Discovery of the Once-Weekly Glucagon-Like Peptide-1 (GLP-1) Analogue Semaglutide.", "journal": "Journal of medicinal chemistry", "date": "2015", "authors": "Lau J, Bloch P, Schaffer L, Pettersson I, Spetzler J, Kofoed J, Madsen K, Knudsen LB, McGuire J, Steensgaard DB, Strauss HM, Gram DX, Knudsen SM, Nielsen FS, Thygesen P, Reedtz-Runge S, Kruse T", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "26308095", "url": "https://glygen.org/publication/PubMed/26308095" } ] }, { "title": "Pentoxifylline for intermittent claudication.", "journal": "The Cochrane database of systematic reviews", "date": "2015", "authors": "Salhiyyah K, Forster R, Senanayake E, Abdel-Hadi M, Booth A, Michaels JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "26417854", "url": "https://glygen.org/publication/PubMed/26417854" } ] }, { "title": "K-Ras Promotes Tumorigenicity through Suppression of Non-canonical Wnt Signaling.", "journal": "Cell", "date": "2015", "authors": "Wang MT, Holderfield M, Galeas J, Delrosario R, To MD, Balmain A, McCormick F", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "26590425", "url": "https://glygen.org/publication/PubMed/26590425" } ] }, { "title": "Estrogen Enhances Linkage in the Vascular Endothelial Calmodulin Network via a Feedforward Mechanism at the G Protein-coupled Estrogen Receptor 1.", "journal": "The Journal of biological chemistry", "date": "2016", "authors": "Tran QK, Firkins R, Giles J, Francis S, Matnishian V, Tran P, VerMeer M, Jasurda J, Burgard MA, Gebert-Oberle B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634597" } ], "reference": [ { "type": "PubMed", "id": "26987903", "url": "https://glygen.org/publication/PubMed/26987903" } ] }, { "title": "Discovery of the ROCK inhibitor netarsudil for the treatment of open-angle glaucoma.", "journal": "Bioorganic & medicinal chemistry letters", "date": "2016", "authors": "Sturdivant JM, Royalty SM, Lin CW, Moore LA, Yingling JD, Laethem CL, Sherman B, Heintzelman GR, Kopczynski CC, deLong MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "27072905", "url": "https://glygen.org/publication/PubMed/27072905" } ] }, { "title": "Rapid steroid hormone actions via membrane receptors.", "journal": "Biochimica et biophysica acta", "date": "2016", "authors": "Schwartz N, Verma A, Bivens CB, Schwartz Z, Boyan BD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "27288742", "url": "https://glygen.org/publication/PubMed/27288742" } ] }, { "title": "Emerging roles for the novel estrogen-sensing receptor GPER1 in the CNS.", "journal": "Neuropharmacology", "date": "2017", "authors": "Alexander A, Irving AJ, Harvey J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634597" } ], "reference": [ { "type": "PubMed", "id": "27392633", "url": "https://glygen.org/publication/PubMed/27392633" } ] }, { "title": "Nucleotide sequence for a cDNA encoding the alpha subunit of retinal transducin (GNAT1) isolated from the human eye.", "journal": "Nucleic acids research", "date": "1989", "authors": "Van Dop C, Medynski DC, Apone LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-418594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418594" } ], "reference": [ { "type": "PubMed", "id": "2748346", "url": "https://glygen.org/publication/PubMed/2748346" } ] }, { "title": "Hall of Fame among Pro-inflammatory Cytokines: Interleukin-6 Gene and Its Transcriptional Regulation Mechanisms.", "journal": "Frontiers in immunology", "date": "2016", "authors": "Luo Y, Zheng SG", "evidence": [ { "database": "Reactome", "id": "R-HSA-9660821", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9660821" } ], "reference": [ { "type": "PubMed", "id": "28066415", "url": "https://glygen.org/publication/PubMed/28066415" } ] }, { "title": "Identification of the lesion in the stimulatory GTP-binding protein of the uncoupled S49 lymphoma.", "journal": "FEBS letters", "date": "1987", "authors": "Rall T, Harris BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-420092", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-420092" } ], "reference": [ { "type": "PubMed", "id": "2826231", "url": "https://glygen.org/publication/PubMed/2826231" } ] }, { "title": "Presence of three distinct molecular species of Gi protein alpha subunit. Structure of rat cDNAs and human genomic DNAs.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Itoh H, Toyama R, Kozasa T, Tsukamoto T, Matsuoka M, Kaziro Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-418594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418594" } ], "reference": [ { "type": "PubMed", "id": "2834384", "url": "https://glygen.org/publication/PubMed/2834384" } ] }, { "title": "Purification and characterization of membrane-bound phospholipase C specific for phosphoinositides from human platelets.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Banno Y, Yada Y, Nozawa Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "2841328", "url": "https://glygen.org/publication/PubMed/2841328" } ] }, { "title": "G protein-coupled estrogen receptor 1 (GPER1)/GPR30 increases ERK1/2 activity through PDZ motif-dependent and -independent mechanisms.", "journal": "The Journal of biological chemistry", "date": "2017", "authors": "Gonzalez de Valdivia E, Broselid S, Kahn R, Olde B, Leeb-Lundberg LMF", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634597" } ], "reference": [ { "type": "PubMed", "id": "28450397", "url": "https://glygen.org/publication/PubMed/28450397" } ] }, { "title": "G-protein-coupled receptor signaling through Gpr176, Gz, and RGS16 tunes time in the center of the circadian clock [Review].", "journal": "Endocrine journal", "date": "2017", "authors": "Goto K, Doi M, Wang T, Kunisue S, Murai I, Okamura H", "evidence": [ { "database": "Reactome", "id": "R-HSA-418597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418597" } ], "reference": [ { "type": "PubMed", "id": "28502923", "url": "https://glygen.org/publication/PubMed/28502923" } ] }, { "title": "Membrane and Nuclear Estrogen Receptor Alpha Actions: From Tissue Specificity to Medical Implications.", "journal": "Physiological reviews", "date": "2017", "authors": "Arnal JF, Lenfant F, Metivier R, Flouriot G, Henrion D, Adlanmerini M, Fontaine C, Gourdy P, Chambon P, Katzenellenbogen B, Katzenellenbogen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "28539435", "url": "https://glygen.org/publication/PubMed/28539435" } ] }, { "title": "A role for G-protein coupled estrogen receptor (GPER) in estrogen-induced carcinogenesis: Dysregulated glandular homeostasis, survival and metastasis.", "journal": "The Journal of steroid biochemistry and molecular biology", "date": "2018", "authors": "Filardo EJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634597" } ], "reference": [ { "type": "PubMed", "id": "28595943", "url": "https://glygen.org/publication/PubMed/28595943" } ] }, { "title": "Beta-adrenergic receptor kinase: identification of a novel protein kinase that phosphorylates the agonist-occupied form of the receptor.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1986", "authors": "Benovic JL, Strasser RH, Caron MG, Lefkowitz RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "2871555", "url": "https://glygen.org/publication/PubMed/2871555" } ] }, { "title": "Effect and safety of roflumilast for chronic obstructive pulmonary disease in Chinese patients.", "journal": "Medicine", "date": "2018", "authors": "Liu DY, Wang ZG, Gao Y, Zhang HM, Zhang YX, Wang XJ, Peng D", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "29443750", "url": "https://glygen.org/publication/PubMed/29443750" } ] }, { "title": "Use of cilomilast-loaded phosphatiosomes to suppress neutrophilic inflammation for attenuating acute lung injury: the effect of nanovesicular surface charge.", "journal": "Journal of nanobiotechnology", "date": "2018", "authors": "Liu FC, Yu HP, Lin CY, Elzoghby AO, Hwang TL, Fang JY", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "29602314", "url": "https://glygen.org/publication/PubMed/29602314" } ] }, { "title": "Proline-Rich Protein Tyrosine Kinase 2 in Inflammation and Cancer.", "journal": "Cancers", "date": "2018", "authors": "Zhu X, Bao Y, Guo Y, Yang W", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "29738483", "url": "https://glygen.org/publication/PubMed/29738483" } ] }, { "title": "The human vasopressin gene is linked to the oxytocin gene and is selectively expressed in a cultured lung cancer cell line.", "journal": "The Journal of biological chemistry", "date": "1985", "authors": "Sausville E, Carney D, Battey J", "evidence": [ { "database": "Reactome", "id": "R-HSA-432040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432040" } ], "reference": [ { "type": "PubMed", "id": "2991279", "url": "https://glygen.org/publication/PubMed/2991279" } ] }, { "title": "Rho Kinase Inhibitors as a Novel Treatment for Glaucoma and Ocular Hypertension.", "journal": "Ophthalmology", "date": "2018", "authors": "Tanna AP, Johnson M", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "30007591", "url": "https://glygen.org/publication/PubMed/30007591" } ] }, { "title": "Identification, purification, and partial characterization of a novel Mr 28,000 integral membrane protein from erythrocytes and renal tubules.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Denker BM, Smith BL, Kuhajda FP, Agre P", "evidence": [ { "database": "Reactome", "id": "R-HSA-432040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432040" } ], "reference": [ { "type": "PubMed", "id": "3049610", "url": "https://glygen.org/publication/PubMed/3049610" } ] }, { "title": "IL-12/IL-23p40 identified as a downstream target of apremilast in ex vivo models of arthritis.", "journal": "Therapeutic advances in musculoskeletal disease", "date": "2019", "authors": "Kragstrup TW, Adams M, Lomholt S, Nielsen MA, Heftdal LD, Schafer P, Deleuran B", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "30833991", "url": "https://glygen.org/publication/PubMed/30833991" } ] }, { "title": "The influence of bound GDP on the kinetics of guanine nucleotide binding to G proteins.", "journal": "The Journal of biological chemistry", "date": "1986", "authors": "Ferguson KM, Higashijima T, Smigel MD, Gilman AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "3086311", "url": "https://glygen.org/publication/PubMed/3086311" } ] }, { "title": "The role of Gs in activation of adenylate cyclase.", "journal": "Biochemical Society transactions", "date": "1987", "authors": "Martin BR, Farndale RW, Wong SK", "evidence": [ { "database": "Reactome", "id": "R-HSA-432040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432040" } ], "reference": [ { "type": "PubMed", "id": "3104109", "url": "https://glygen.org/publication/PubMed/3104109" } ] }, { "title": "Isolation and characterization of the human Gs alpha gene.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1988", "authors": "Kozasa T, Itoh H, Tsukamoto T, Kaziro Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "3127824", "url": "https://glygen.org/publication/PubMed/3127824" } ] }, { "title": "Crisaborole 2% ointment for the treatment of intertriginous, anogenital, and facial psoriasis: A double-blind, randomized, vehicle-controlled trial.", "journal": "Journal of the American Academy of Dermatology", "date": "2020", "authors": "Hashim PW, Chima M, Kim HJ, Bares J, Yao CJ, Singer G, Chen T, Genece J, Baum D, Kimmel GW, Nia JK, Gagliotti M, Lebwohl MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "31279028", "url": "https://glygen.org/publication/PubMed/31279028" } ] }, { "title": "Effect of the inhaled PDE4 inhibitor CHF6001 on biomarkers of inflammation in COPD.", "journal": "Respiratory research", "date": "2019", "authors": "Singh D, Beeh KM, Colgan B, Kornmann O, Leaker B, Watz H, Lucci G, Geraci S, Emirova A, Govoni M, Nandeuil MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "31399091", "url": "https://glygen.org/publication/PubMed/31399091" } ] }, { "title": "Subunit dissociation is the mechanism for hormonal activation of the Gs protein in native membranes.", "journal": "The Journal of biological chemistry", "date": "1988", "authors": "Ransnas LA, Insel PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-392851", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-392851" } ], "reference": [ { "type": "PubMed", "id": "3141418", "url": "https://glygen.org/publication/PubMed/3141418" } ] }, { "title": "Comprehensive multi-omics analysis identified core molecular processes in esophageal cancer and revealed GNGT2 as a potential prognostic marker.", "journal": "World journal of gastroenterology", "date": "2019", "authors": "Liu GM, Ji X, Lu TC, Duan LW, Jia WY, Liu Y, Sun ML, Luo YG", "evidence": [ { "database": "RefSeq", "id": "NP_001185683", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001185683" } ], "reference": [ { "type": "PubMed", "id": "31908393", "url": "https://glygen.org/publication/PubMed/31908393" } ] }, { "title": "Simple assessment of quality of life and lower limb functional capacity during cilostazol treatment - results of the SHort-tERm cIlostazol eFFicacy and quality of life (SHERIFF) study.", "journal": "VASA. Zeitschrift fur Gefasskrankheiten", "date": "2020", "authors": "Farkas K, Kolossvary E, Jarai Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "31983287", "url": "https://glygen.org/publication/PubMed/31983287" } ] }, { "title": "Inhaled Phosphodiesterase 4 (PDE4) Inhibitors for Inflammatory Respiratory Diseases.", "journal": "Frontiers in pharmacology", "date": "2020", "authors": "Phillips JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "32226383", "url": "https://glygen.org/publication/PubMed/32226383" } ] }, { "title": "Commentary: Phosphodiesterase 4 inhibitors as potential adjunct treatment targeting the cytokine storm in COVID-19.", "journal": "Metabolism: clinical and experimental", "date": "2020", "authors": "Dalamaga M, Karampela I, Mantzoros CS", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "32497535", "url": "https://glygen.org/publication/PubMed/32497535" } ] }, { "title": "Repositioning of pentoxifylline as an immunomodulator and regulator of the renin-angiotensin system in the treatment of COVID-19.", "journal": "Medical hypotheses", "date": "2020", "authors": "Maldonado V, Loza-Mejia MA, Chavez-Alderete J", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "32540603", "url": "https://glygen.org/publication/PubMed/32540603" } ] }, { "title": "COVID-19 patients with psoriasis and psoriatic arthritis on biologic immunosuppressant therapy vs apremilast in North Spain.", "journal": "Dermatologic therapy", "date": "2020", "authors": "Queiro Silva R, Armesto S, Gonzalez Vela C, Naharro Fernandez C, Gonzalez-Gay MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "32618402", "url": "https://glygen.org/publication/PubMed/32618402" } ] }, { "title": "Proteinase-activated receptor 1: A target for repurposing in the treatment of COVID-19?", "journal": "British journal of pharmacology", "date": "2020", "authors": "Sriram K, Insel PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-456926", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-456926" } ], "reference": [ { "type": "PubMed", "id": "32639031", "url": "https://glygen.org/publication/PubMed/32639031" } ] }, { "title": "Hypothesis: Pentoxifylline is a potential cytokine modulator therapeutic in COVID-19 patients.", "journal": "Pharmacology research & perspectives", "date": "2020", "authors": "Hendry BM, Stafford N, Arnold AD, Sangwaiya A, Manglam V, Rosen SD, Arnold J", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "32715661", "url": "https://glygen.org/publication/PubMed/32715661" } ] }, { "title": "Pentoxifylline: A Drug with Antiviral and Anti-Inflammatory Effects to Be Considered in the Treatment of Coronavirus Disease 2019.", "journal": "Medical principles and practice : international journal of the Kuwait University, Health Science Centre", "date": "2021", "authors": "Ghasemnejad-Berenji M, Pashapour S, Sadeghpour S", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "33049737", "url": "https://glygen.org/publication/PubMed/33049737" } ] }, { "title": "Integrated genomics analysis highlights important SNPs and genes implicated in moderate-to-severe asthma based on GWAS and eQTL datasets.", "journal": "BMC pulmonary medicine", "date": "2020", "authors": "Dong Z, Ma Y, Zhou H, Shi L, Ye G, Yang L, Liu P, Zhou L", "evidence": [ { "database": "RefSeq", "id": "NP_001185683", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001185683" } ], "reference": [ { "type": "PubMed", "id": "33066754", "url": "https://glygen.org/publication/PubMed/33066754" } ] }, { "title": "Gbetagamma translocation to the Golgi apparatus activates ARF1 to spatiotemporally regulate G protein-coupled receptor signaling to MAPK.", "journal": "The Journal of biological chemistry", "date": "2021", "authors": "Khater M, Bryant CN, Wu G", "evidence": [ { "database": "RefSeq", "id": "NP_001185683", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001185683" } ], "reference": [ { "type": "PubMed", "id": "34022220", "url": "https://glygen.org/publication/PubMed/34022220" } ] }, { "title": "Structure of the human vasoactive intestinal polypeptide gene.", "journal": "DNA (Mary Ann Liebert, Inc.)", "date": "1985", "authors": "Tsukada T, Horovitch SJ, Montminy MR, Mandel G, Goodman RH", "evidence": [ { "database": "Reactome", "id": "R-HSA-420092", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-420092" } ], "reference": [ { "type": "PubMed", "id": "3899557", "url": "https://glygen.org/publication/PubMed/3899557" } ] }, { "title": "Expression of the vasopressin and oxytocin genes in human hypothalami.", "journal": "FEBS letters", "date": "1985", "authors": "Mohr E, Hillers M, Ivell R, Haulica ID, Richter D", "evidence": [ { "database": "Reactome", "id": "R-HSA-432040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432040" } ], "reference": [ { "type": "PubMed", "id": "4065330", "url": "https://glygen.org/publication/PubMed/4065330" } ] }, { "title": "The new inotropic phosphodiesterase inhibitors.", "journal": "Archives internationales de physiologie et de biochimie", "date": "1984", "authors": "el Allaf D, D'Orio V, Carlier J", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "6085243", "url": "https://glygen.org/publication/PubMed/6085243" } ] }, { "title": "Cloning and sequence analysis of cDNA for the precursor of human growth hormone-releasing factor, somatocrinin.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1983", "authors": "Gubler U, Monahan JJ, Lomedico PT, Bhatt RS, Collier KJ, Hoffman BJ, Bohlen P, Esch F, Ling N, Zeytin F, Brazeau P, Poonian MS, Gage LP", "evidence": [ { "database": "Reactome", "id": "R-HSA-420092", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-420092" } ], "reference": [ { "type": "PubMed", "id": "6192430", "url": "https://glygen.org/publication/PubMed/6192430" } ] }, { "title": "The isolation and sequencing of human gastric inhibitory peptide (GIP).", "journal": "FEBS letters", "date": "1984", "authors": "Moody AJ, Thim L, Valverde I", "evidence": [ { "database": "Reactome", "id": "R-HSA-420092", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-420092" } ], "reference": [ { "type": "PubMed", "id": "6745415", "url": "https://glygen.org/publication/PubMed/6745415" } ] }, { "title": "Aquaporin-3 water channel localization and regulation in rat kidney.", "journal": "The American journal of physiology", "date": "1995", "authors": "Ecelbarger CA, Terris J, Frindt G, Echevarria M, Marples D, Nielsen S, Knepper MA", "evidence": [ { "database": "Reactome", "id": "R-HSA-432040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432040" } ], "reference": [ { "type": "PubMed", "id": "7503232", "url": "https://glygen.org/publication/PubMed/7503232" } ] }, { "title": "Cloning, characterization, and chromosomal mapping of human aquaporin of collecting duct.", "journal": "The Journal of clinical investigation", "date": "1994", "authors": "Sasaki S, Fushimi K, Saito H, Saito F, Uchida S, Ishibashi K, Kuwahara M, Ikeuchi T, Inui K, Nakajima K, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-432040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432040" } ], "reference": [ { "type": "PubMed", "id": "7510718", "url": "https://glygen.org/publication/PubMed/7510718" } ] }, { "title": "Cloning and expression of a cDNA for the human prostanoid IP receptor.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Boie Y, Rushmore TH, Darmon-Goodwin A, Grygorczyk R, Slipetz DM, Metters KM, Abramovitz M", "evidence": [ { "database": "Reactome", "id": "R-HSA-392851", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-392851" } ], "reference": [ { "type": "PubMed", "id": "7512962", "url": "https://glygen.org/publication/PubMed/7512962" } ] }, { "title": "Cloning and expression of a cDNA for the human prostacyclin receptor.", "journal": "FEBS letters", "date": "1994", "authors": "Katsuyama M, Sugimoto Y, Namba T, Irie A, Negishi M, Narumiya S, Ichikawa A", "evidence": [ { "database": "Reactome", "id": "R-HSA-392851", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-392851" } ], "reference": [ { "type": "PubMed", "id": "7514139", "url": "https://glygen.org/publication/PubMed/7514139" } ] }, { "title": "Cloning and expression of AQP3, a water channel from the medullary collecting duct of rat kidney.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Echevarria M, Windhager EE, Tate SS, Frindt G", "evidence": [ { "database": "Reactome", "id": "R-HSA-432040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432040" } ], "reference": [ { "type": "PubMed", "id": "7526388", "url": "https://glygen.org/publication/PubMed/7526388" } ] }, { "title": "Nitric oxide: a physiologic messenger molecule.", "journal": "Annual review of biochemistry", "date": "1994", "authors": "Bredt DS, Snyder SH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "7526779", "url": "https://glygen.org/publication/PubMed/7526779" } ] }, { "title": "Differential activation of Gi and Gs proteins by E- and I-type prostaglandins in membranes from the human erythroleukaemia cell line, HEL.", "journal": "Biochimica et biophysica acta", "date": "1995", "authors": "Schwaner I, Offermanns S, Spicher K, Seifert R, Schultz G", "evidence": [ { "database": "Reactome", "id": "R-HSA-392851", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-392851" } ], "reference": [ { "type": "PubMed", "id": "7532011", "url": "https://glygen.org/publication/PubMed/7532011" } ] }, { "title": "Water channel expression in human ADPKD kidneys.", "journal": "The American journal of physiology", "date": "1995", "authors": "Bachinsky DR, Sabolic I, Emmanouel DS, Jefferson DM, Carone FA, Brown D, Perrone RD", "evidence": [ { "database": "Reactome", "id": "R-HSA-432040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432040" } ], "reference": [ { "type": "PubMed", "id": "7535000", "url": "https://glygen.org/publication/PubMed/7535000" } ] }, { "title": "Immunolocalization of the mercurial-insensitive water channel and glycerol intrinsic protein in epithelial cell plasma membranes.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Frigeri A, Gropper MA, Turck CW, Verkman AS", "evidence": [ { "database": "Reactome", "id": "R-HSA-432040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432040" } ], "reference": [ { "type": "PubMed", "id": "7538665", "url": "https://glygen.org/publication/PubMed/7538665" } ] }, { "title": "Phosphorylation of Gz alpha by protein kinase C blocks interaction with the beta gamma complex.", "journal": "The Journal of biological chemistry", "date": "1995", "authors": "Fields TA, Casey PJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-418597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418597" } ], "reference": [ { "type": "PubMed", "id": "7559455", "url": "https://glygen.org/publication/PubMed/7559455" } ] }, { "title": "Activation of Tsk and Btk tyrosine kinases by G protein beta gamma subunits.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Langhans-Rajasekaran SA, Wan Y, Huang XY", "evidence": [ { "database": "Reactome", "id": "R-HSA-8964315", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964315" } ], "reference": [ { "type": "PubMed", "id": "7567982", "url": "https://glygen.org/publication/PubMed/7567982" } ] }, { "title": "G protein beta gamma subunits stimulate phosphorylation of Shc adapter protein.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1995", "authors": "Touhara K, Hawes BE, van Biesen T, Lefkowitz RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634597" } ], "reference": [ { "type": "PubMed", "id": "7568118", "url": "https://glygen.org/publication/PubMed/7568118" } ] }, { "title": "Molecular cloning, functional expression, and signal transduction of the GIP-receptor cloned from a human insulinoma.", "journal": "FEBS letters", "date": "1995", "authors": "Volz A, Goke R, Lankat-Buttgereit B, Fehmann HC, Bode HP, Goke B", "evidence": [ { "database": "Reactome", "id": "R-HSA-420092", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-420092" } ], "reference": [ { "type": "PubMed", "id": "7589426", "url": "https://glygen.org/publication/PubMed/7589426" } ] }, { "title": "Stimulation of cloned human glucagon-like peptide 1 receptor expressed in HEK 293 cells induces cAMP-dependent activation of calcium-induced calcium release.", "journal": "FEBS letters", "date": "1995", "authors": "Gromada J, Rorsman P, Dissing S, Wulff BS", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "7589461", "url": "https://glygen.org/publication/PubMed/7589461" } ] }, { "title": "Activation of type II adenylyl cyclase by the cloned mu-opioid receptor: coupling to multiple G proteins.", "journal": "Journal of neurochemistry", "date": "1995", "authors": "Chan JS, Chiu TT, Wong YH", "evidence": [ { "database": "Reactome", "id": "R-HSA-418597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418597" } ], "reference": [ { "type": "PubMed", "id": "7595566", "url": "https://glygen.org/publication/PubMed/7595566" } ] }, { "title": "Cloning and characterization of a G protein-activated human phosphoinositide-3 kinase.", "journal": "Science (New York, N.Y.)", "date": "1995", "authors": "Stoyanov B, Volinia S, Hanck T, Rubio I, Loubtchenkov M, Malek D, Stoyanova S, Vanhaesebroeck B, Dhand R, Nurnberg B, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-392451", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-392451" } ], "reference": [ { "type": "PubMed", "id": "7624799", "url": "https://glygen.org/publication/PubMed/7624799" } ] }, { "title": "Direct control of exocytosis by receptor-mediated activation of the heterotrimeric GTPases Gi and G(o) or by the expression of their active G alpha subunits.", "journal": "The EMBO journal", "date": "1995", "authors": "Lang J, Nishimoto I, Okamoto T, Regazzi R, Kiraly C, Weller U, Wollheim CB", "evidence": [ { "database": "Reactome", "id": "R-HSA-400042", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400042" } ], "reference": [ { "type": "PubMed", "id": "7641683", "url": "https://glygen.org/publication/PubMed/7641683" } ] }, { "title": "Receptor-tyrosine-kinase- and G beta gamma-mediated MAP kinase activation by a common signalling pathway.", "journal": "Nature", "date": "1995", "authors": "van Biesen T, Hawes BE, Luttrell DK, Krueger KM, Touhara K, Porfiri E, Sakaue M, Luttrell LM, Lefkowitz RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634597" } ], "reference": [ { "type": "PubMed", "id": "7651538", "url": "https://glygen.org/publication/PubMed/7651538" } ] }, { "title": "CHIP28 water channels are localized in constitutively water-permeable segments of the nephron.", "journal": "The Journal of cell biology", "date": "1993", "authors": "Nielsen S, Smith BL, Christensen EI, Knepper MA, Agre P", "evidence": [ { "database": "Reactome", "id": "R-HSA-432040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432040" } ], "reference": [ { "type": "PubMed", "id": "7678419", "url": "https://glygen.org/publication/PubMed/7678419" } ] }, { "title": "Molecular cloning and expression of a human anterior pituitary receptor for growth hormone-releasing hormone.", "journal": "Molecular endocrinology (Baltimore, Md.)", "date": "1993", "authors": "Gaylinn BD, Harrison JK, Zysk JR, Lyons CE, Lynch KR, Thorner MO", "evidence": [ { "database": "Reactome", "id": "R-HSA-420092", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-420092" } ], "reference": [ { "type": "PubMed", "id": "7680413", "url": "https://glygen.org/publication/PubMed/7680413" } ] }, { "title": "Molecular cloning and expression of a human secretin receptor.", "journal": "Molecular pharmacology", "date": "1995", "authors": "Patel DR, Kong Y, Sreedharan SP", "evidence": [ { "database": "Reactome", "id": "R-HSA-420092", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-420092" } ], "reference": [ { "type": "PubMed", "id": "7700244", "url": "https://glygen.org/publication/PubMed/7700244" } ] }, { "title": "Modulation of insulin-like growth factor I (IGF-I) receptors and membrane-associated IGF-binding proteins in endometrial cancer cells by estradiol.", "journal": "Endocrinology", "date": "1995", "authors": "Kleinman D, Karas M, Roberts CT Jr, LeRoith D, Phillip M, Segev Y, Levy J, Sharoni Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "7750475", "url": "https://glygen.org/publication/PubMed/7750475" } ] }, { "title": "Molecular cloning and functional characterization of a human VIP receptor from SUP-T1 lymphoblasts.", "journal": "Biochemical and biophysical research communications", "date": "1994", "authors": "Svoboda M, Tastenoy M, Van Rampelbergh J, Goossens JF, De Neef P, Waelbroeck M, Robberecht P", "evidence": [ { "database": "Reactome", "id": "R-HSA-420092", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-420092" } ], "reference": [ { "type": "PubMed", "id": "7811244", "url": "https://glygen.org/publication/PubMed/7811244" } ] }, { "title": "Molecular cloning and functional expression of a cDNA encoding a human pituitary adenylate cyclase activating polypeptide receptor.", "journal": "Biochemical and biophysical research communications", "date": "1993", "authors": "Ogi K, Miyamoto Y, Masuda Y, Habata Y, Hosoya M, Ohtaki T, Masuo Y, Onda H, Fujino M", "evidence": [ { "database": "Reactome", "id": "R-HSA-420092", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-420092" } ], "reference": [ { "type": "PubMed", "id": "7902709", "url": "https://glygen.org/publication/PubMed/7902709" } ] }, { "title": "Mechanism of GTP hydrolysis by G-protein alpha subunits.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Kleuss C, Raw AS, Lee E, Sprang SR, Gilman AG", "evidence": [ { "database": "Reactome", "id": "R-HSA-418597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418597" } ], "reference": [ { "type": "PubMed", "id": "7937899", "url": "https://glygen.org/publication/PubMed/7937899" } ] }, { "title": "Multiple regulatory elements in the interleukin-6 gene mediate induction by prostaglandins, cyclic AMP, and lipopolysaccharide.", "journal": "Molecular and cellular biology", "date": "1994", "authors": "Dendorfer U, Oettgen P, Libermann TA", "evidence": [ { "database": "Reactome", "id": "R-HSA-9660821", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9660821" } ], "reference": [ { "type": "PubMed", "id": "8007951", "url": "https://glygen.org/publication/PubMed/8007951" } ] }, { "title": "Human taste cells express the G protein alpha-gustducin and neuron-specific enolase.", "journal": "Brain research. Molecular brain research", "date": "1994", "authors": "Takami S, Getchell TV, McLaughlin SK, Margolskee RF, Getchell ML", "evidence": [ { "database": "Reactome", "id": "R-HSA-418594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418594" } ], "reference": [ { "type": "PubMed", "id": "8015379", "url": "https://glygen.org/publication/PubMed/8015379" } ] }, { "title": "Cloning of a water channel homolog expressed in brain meningeal cells and kidney collecting duct that functions as a stilbene-sensitive glycerol transporter.", "journal": "The Journal of biological chemistry", "date": "1994", "authors": "Ma T, Frigeri A, Hasegawa H, Verkman AS", "evidence": [ { "database": "Reactome", "id": "R-HSA-432040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432040" } ], "reference": [ { "type": "PubMed", "id": "8063828", "url": "https://glygen.org/publication/PubMed/8063828" } ] }, { "title": "Structures of active conformations of Gi alpha 1 and the mechanism of GTP hydrolysis.", "journal": "Science (New York, N.Y.)", "date": "1994", "authors": "Coleman DE, Berghuis AM, Lee E, Linder ME, Gilman AG, Sprang SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-202040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202040" } ], "reference": [ { "type": "PubMed", "id": "8073283", "url": "https://glygen.org/publication/PubMed/8073283" } ] }, { "title": "Coupling of the alpha 2-adrenergic receptor to the inhibitory G-protein Gi and adenylate cyclase in HT29 cells.", "journal": "The Biochemical journal", "date": "1993", "authors": "Remaury A, Larrouy D, Daviaud D, Rouot B, Paris H", "evidence": [ { "database": "Reactome", "id": "R-HSA-400042", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400042" } ], "reference": [ { "type": "PubMed", "id": "8099279", "url": "https://glygen.org/publication/PubMed/8099279" } ] }, { "title": "Tissue and plasma concentrations of amidated and glycine-extended glucagon-like peptide I in humans.", "journal": "Diabetes", "date": "1994", "authors": "Orskov C, Rabenhoj L, Wettergren A, Kofod H, Holst JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "8138058", "url": "https://glygen.org/publication/PubMed/8138058" } ] }, { "title": "Requirement of human renal water channel aquaporin-2 for vasopressin-dependent concentration of urine.", "journal": "Science (New York, N.Y.)", "date": "1994", "authors": "Deen PM, Verdijk MA, Knoers NV, Wieringa B, Monnens LA, van Os CH, van Oost BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-432040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432040" } ], "reference": [ { "type": "PubMed", "id": "8140421", "url": "https://glygen.org/publication/PubMed/8140421" } ] }, { "title": "The human glucagon receptor encoding gene: structure, cDNA sequence and chromosomal localization.", "journal": "Gene", "date": "1994", "authors": "Lok S, Kuijper JL, Jelinek LJ, Kramer JM, Whitmore TE, Sprecher CA, Mathewes S, Grant FJ, Biggs SH, Rosenberg GB, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-420092", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-420092" } ], "reference": [ { "type": "PubMed", "id": "8144028", "url": "https://glygen.org/publication/PubMed/8144028" } ] }, { "title": "Structural determinants for activation of the alpha-subunit of a heterotrimeric G protein.", "journal": "Nature", "date": "1994", "authors": "Lambright DG, Noel JP, Hamm HE, Sigler PB", "evidence": [ { "database": "Reactome", "id": "R-HSA-202040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202040" } ], "reference": [ { "type": "PubMed", "id": "8208289", "url": "https://glygen.org/publication/PubMed/8208289" } ] }, { "title": "Concentration-dependent effects of adrenaline on the profile of insulin secretion from isolated human islets of Langerhans.", "journal": "The Journal of endocrinology", "date": "1993", "authors": "Lacey RJ, Cable HC, James RF, London NJ, Scarpello JH, Morgan NG", "evidence": [ { "database": "Reactome", "id": "R-HSA-400042", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400042" } ], "reference": [ { "type": "PubMed", "id": "8277227", "url": "https://glygen.org/publication/PubMed/8277227" } ] }, { "title": "G proteins of the G12 family are activated via thromboxane A2 and thrombin receptors in human platelets.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1994", "authors": "Offermanns S, Laugwitz KL, Spicher K, Schultz G", "evidence": [ { "database": "Reactome", "id": "R-HSA-456926", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-456926" } ], "reference": [ { "type": "PubMed", "id": "8290554", "url": "https://glygen.org/publication/PubMed/8290554" } ] }, { "title": "Polypeptide variants of beta-arrestin and arrestin3.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Sterne-Marr R, Gurevich VV, Goldsmith P, Bodine RC, Sanders C, Donoso LA, Benovic JL", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "8340388", "url": "https://glygen.org/publication/PubMed/8340388" } ] }, { "title": "Cloning and functional expression of a human neuroendocrine vasoactive intestinal peptide receptor.", "journal": "Biochemical and biophysical research communications", "date": "1993", "authors": "Sreedharan SP, Patel DR, Huang JX, Goetzl EJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-420092", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-420092" } ], "reference": [ { "type": "PubMed", "id": "8390245", "url": "https://glygen.org/publication/PubMed/8390245" } ] }, { "title": "Cloning and functional expression of the human glucagon-like peptide-1 (GLP-1) receptor.", "journal": "Endocrinology", "date": "1993", "authors": "Dillon JS, Tanizawa Y, Wheeler MB, Leng XH, Ligon BB, Rabin DU, Yoo-Warren H, Permutt MA, Boyd AE 3rd", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "8404634", "url": "https://glygen.org/publication/PubMed/8404634" } ] }, { "title": "Cloning and functional expression of the human islet GLP-1 receptor. Demonstration that exendin-4 is an agonist and exendin-(9-39) an antagonist of the receptor.", "journal": "Diabetes", "date": "1993", "authors": "Thorens B, Porret A, Buhler L, Deng SP, Morel P, Widmann C", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "8405712", "url": "https://glygen.org/publication/PubMed/8405712" } ] }, { "title": "Characterization of the gene encoding human cone transducin alpha-subunit (GNAT2).", "journal": "Genomics", "date": "1993", "authors": "Morris TA, Fong SL", "evidence": [ { "database": "Reactome", "id": "R-HSA-418594", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418594" } ], "reference": [ { "type": "PubMed", "id": "8406495", "url": "https://glygen.org/publication/PubMed/8406495" } ] }, { "title": "Phosphorylation and desensitization of human m2 muscarinic cholinergic receptors by two isoforms of the beta-adrenergic receptor kinase.", "journal": "The Journal of biological chemistry", "date": "1993", "authors": "Richardson RM, Kim C, Benovic JL, Hosey MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "8514797", "url": "https://glygen.org/publication/PubMed/8514797" } ] }, { "title": "The structure of the G protein heterotrimer Gi alpha 1 beta 1 gamma 2.", "journal": "Cell", "date": "1995", "authors": "Wall MA, Coleman DE, Lee E, Iniguez-Lluhi JA, Posner BA, Gilman AG, Sprang SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-202040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202040" } ], "reference": [ { "type": "PubMed", "id": "8521505", "url": "https://glygen.org/publication/PubMed/8521505" } ] }, { "title": "Characterization and expression of the human A2a adenosine receptor gene.", "journal": "Journal of neurochemistry", "date": "1996", "authors": "Peterfreund RA, MacCollin M, Gusella J, Fink JS", "evidence": [ { "database": "Reactome", "id": "R-HSA-9660821", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9660821" } ], "reference": [ { "type": "PubMed", "id": "8522976", "url": "https://glygen.org/publication/PubMed/8522976" } ] }, { "title": "Adenosine receptor-induced cyclic AMP generation and inhibition of 5-hydroxytryptamine release in human platelets.", "journal": "British journal of clinical pharmacology", "date": "1995", "authors": "Cooper JA, Hill SJ, Alexander SP, Rubin PC, Horn EH", "evidence": [ { "database": "Reactome", "id": "R-HSA-9660821", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9660821" } ], "reference": [ { "type": "PubMed", "id": "8527267", "url": "https://glygen.org/publication/PubMed/8527267" } ] }, { "title": "The human platelet ADP receptor activates Gi2 proteins.", "journal": "The Biochemical journal", "date": "1995", "authors": "Ohlmann P, Laugwitz KL, Nurnberg B, Spicher K, Schultz G, Cazenave JP, Gachet C", "evidence": [ { "database": "Reactome", "id": "R-HSA-392170", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-392170" } ], "reference": [ { "type": "PubMed", "id": "8554519", "url": "https://glygen.org/publication/PubMed/8554519" } ] }, { "title": "Fibronectin fibrils and growth factors stimulate anchorage-independent growth of a murine mammary carcinoma.", "journal": "Experimental cell research", "date": "1996", "authors": "Saulnier R, Bhardwaj B, Klassen J, Leopold D, Rahimi N, Tremblay E, Mosher D, Elliott B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634597" } ], "reference": [ { "type": "PubMed", "id": "8598224", "url": "https://glygen.org/publication/PubMed/8598224" } ] }, { "title": "The small GTP-binding protein Rho binds to and activates a 160 kDa Ser/Thr protein kinase homologous to myotonic dystrophy kinase.", "journal": "The EMBO journal", "date": "1996", "authors": "Ishizaki T, Maekawa M, Fujisawa K, Okawa K, Iwamatsu A, Fujita A, Watanabe N, Saito Y, Kakizuka A, Morii N, Narumiya S", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "8617235", "url": "https://glygen.org/publication/PubMed/8617235" } ] }, { "title": "Different single receptor domains determine the distinct G protein coupling profiles of members of the vasopressin receptor family.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Liu J, Wess J", "evidence": [ { "database": "Reactome", "id": "R-HSA-432040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432040" } ], "reference": [ { "type": "PubMed", "id": "8621513", "url": "https://glygen.org/publication/PubMed/8621513" } ] }, { "title": "Chimeric mutagenesis of putative G-protein coupling domains of the alpha2A-adrenergic receptor. Localization of two redundant and fully competent gi coupling domains.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Eason MG, Liggett SB", "evidence": [ { "database": "Reactome", "id": "R-HSA-400042", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400042" } ], "reference": [ { "type": "PubMed", "id": "8662784", "url": "https://glygen.org/publication/PubMed/8662784" } ] }, { "title": "Human G(alpha q): cDNA and tissue distribution.", "journal": "Biochimica et biophysica acta", "date": "1996", "authors": "Chen B, Leverette RD, Schwinn DA, Kwatra MM", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "8664309", "url": "https://glygen.org/publication/PubMed/8664309" } ] }, { "title": "Members of the G protein-coupled receptor kinase family that phosphorylate the beta2-adrenergic receptor facilitate sequestration.", "journal": "Biochemistry", "date": "1996", "authors": "Menard L, Ferguson SS, Barak LS, Bertrand L, Premont RT, Colapietro AM, Lefkowitz RJ, Caron MG", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "8672451", "url": "https://glygen.org/publication/PubMed/8672451" } ] }, { "title": "Effect of a dynein inhibitor on vasopressin action in toad urinary bladder.", "journal": "The Journal of physiology", "date": "1996", "authors": "Marples D, Barber B, Taylor A", "evidence": [ { "database": "Reactome", "id": "R-HSA-432040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432040" } ], "reference": [ { "type": "PubMed", "id": "8683474", "url": "https://glygen.org/publication/PubMed/8683474" } ] }, { "title": "Role of c-Src tyrosine kinase in G protein-coupled receptor- and Gbetagamma subunit-mediated activation of mitogen-activated protein kinases.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Luttrell LM, Hawes BE, van Biesen T, Luttrell DK, Lansing TJ, Lefkowitz RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9634597", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634597" } ], "reference": [ { "type": "PubMed", "id": "8702633", "url": "https://glygen.org/publication/PubMed/8702633" } ] }, { "title": "Second messenger cascade specificity and pharmacological selectivity of the human P2Y1-purinoceptor.", "journal": "British journal of pharmacology", "date": "1996", "authors": "Schachter JB, Li Q, Boyer JL, Nicholas RA, Harden TK", "evidence": [ { "database": "Reactome", "id": "R-HSA-418592", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418592" } ], "reference": [ { "type": "PubMed", "id": "8733591", "url": "https://glygen.org/publication/PubMed/8733591" } ] }, { "title": "Expression of alpha 2- and beta-adrenoceptor subtypes in human islets of Langerhans.", "journal": "The Journal of endocrinology", "date": "1996", "authors": "Lacey RJ, Chan SL, Cable HC, James RF, Perrett CW, Scarpello JH, Morgan NG", "evidence": [ { "database": "Reactome", "id": "R-HSA-400042", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400042" } ], "reference": [ { "type": "PubMed", "id": "8778232", "url": "https://glygen.org/publication/PubMed/8778232" } ] }, { "title": "Determination of nitric oxide synthase cofactors: heme, FAD, FMN, and tetrahydrobiopterin.", "journal": "Methods in enzymology", "date": "1996", "authors": "Klatt P, Schmidt K, Werner ER, Mayer B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "8782602", "url": "https://glygen.org/publication/PubMed/8782602" } ] }, { "title": "The p160 RhoA-binding kinase ROK alpha is a member of a kinase family and is involved in the reorganization of the cytoskeleton.", "journal": "Molecular and cellular biology", "date": "1996", "authors": "Leung T, Chen XQ, Manser E, Lim L", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "8816443", "url": "https://glygen.org/publication/PubMed/8816443" } ] }, { "title": "Molecular mechanism underlying glucagon-like peptide 1 induced calcium mobilization from internal stores in insulin-secreting beta TC3 cells.", "journal": "Acta physiologica Scandinavica", "date": "1996", "authors": "Gromada J, Rorsman P", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "8830891", "url": "https://glygen.org/publication/PubMed/8830891" } ] }, { "title": "The human AQP4 gene: definition of the locus encoding two water channel polypeptides in brain.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Lu M, Lee MD, Smith BL, Jung JS, Agre P, Verdijk MA, Merkx G, Rijss JP, Deen PM", "evidence": [ { "database": "Reactome", "id": "R-HSA-432040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432040" } ], "reference": [ { "type": "PubMed", "id": "8855281", "url": "https://glygen.org/publication/PubMed/8855281" } ] }, { "title": "Estradiol stimulates tyrosine phosphorylation of the insulin-like growth factor-1 receptor and insulin receptor substrate-1 in the uterus.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1996", "authors": "Richards RG, DiAugustine RP, Petrusz P, Clark GC, Sebastian J", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "8876252", "url": "https://glygen.org/publication/PubMed/8876252" } ] }, { "title": "p38 mitogen-activated protein kinase phosphorylates cytosolic phospholipase A2 (cPLA2) in thrombin-stimulated platelets. Evidence that proline-directed phosphorylation is not required for mobilization of arachidonic acid by cPLA2.", "journal": "The Journal of biological chemistry", "date": "1996", "authors": "Kramer RM, Roberts EF, Um SL, Borsch-Haubold AG, Watson SP, Fisher MJ, Jakubowski JA", "evidence": [ { "database": "Reactome", "id": "R-HSA-418592", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418592" } ], "reference": [ { "type": "PubMed", "id": "8910365", "url": "https://glygen.org/publication/PubMed/8910365" } ] }, { "title": "Direct evidence for two distinct G proteins coupling with thrombin receptors in human neuroblastoma SH-EP cells.", "journal": "European journal of pharmacology", "date": "1996", "authors": "Ogino Y, Tanaka K, Shimizu N", "evidence": [ { "database": "Reactome", "id": "R-HSA-456926", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-456926" } ], "reference": [ { "type": "PubMed", "id": "8982657", "url": "https://glygen.org/publication/PubMed/8982657" } ] }, { "title": "Mechanisms of inhibition of insulin release.", "journal": "The American journal of physiology", "date": "1996", "authors": "Sharp GW", "evidence": [ { "database": "Reactome", "id": "R-HSA-400042", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400042" } ], "reference": [ { "type": "PubMed", "id": "8997178", "url": "https://glygen.org/publication/PubMed/8997178" } ] }, { "title": "Modulation of embryonic intracellular Ca2+ signaling by Wnt-5A.", "journal": "Developmental biology", "date": "1997", "authors": "Slusarski DC, Yang-Snyder J, Busa WB, Moon RT", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "9073455", "url": "https://glygen.org/publication/PubMed/9073455" } ] }, { "title": "Protease-activated receptor 3 is a second thrombin receptor in humans.", "journal": "Nature", "date": "1997", "authors": "Ishihara H, Connolly AJ, Zeng D, Kahn ML, Zheng YW, Timmons C, Tram T, Coughlin SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-456926", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-456926" } ], "reference": [ { "type": "PubMed", "id": "9087410", "url": "https://glygen.org/publication/PubMed/9087410" } ] }, { "title": "The human thromboxane A2 receptor alpha isoform (TP alpha) functionally couples to the G proteins Gq and G11 in vivo and is activated by the isoprostane 8-epi prostaglandin F2 alpha.", "journal": "The Journal of pharmacology and experimental therapeutics", "date": "1997", "authors": "Kinsella BT, O'Mahony DJ, Fitzgerald GA", "evidence": [ { "database": "Reactome", "id": "R-HSA-428930", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-428930" } ], "reference": [ { "type": "PubMed", "id": "9152406", "url": "https://glygen.org/publication/PubMed/9152406" } ] }, { "title": "Cytoplasmic chaperonin containing TCP-1: structural and functional characterization.", "journal": "Biochemistry", "date": "1997", "authors": "Melki R, Batelier G, Soulie S, Williams RC Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-6814122", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6814122" } ], "reference": [ { "type": "PubMed", "id": "9153422", "url": "https://glygen.org/publication/PubMed/9153422" } ] }, { "title": "Characterization of bovine endothelial nitric oxide synthase as a homodimer with down-regulated uncoupled NADPH oxidase activity: tetrahydrobiopterin binding kinetics and role of haem in dimerization.", "journal": "The Biochemical journal", "date": "1997", "authors": "List BM, Klosch B, Volker C, Gorren AC, Sessa WC, Werner ER, Kukovetz WR, Schmidt K, Mayer B", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "9173876", "url": "https://glygen.org/publication/PubMed/9173876" } ] }, { "title": "Protein kinase A phosphorylation is involved in regulated exocytosis of aquaporin-2 in transfected LLC-PK1 cells.", "journal": "The American journal of physiology", "date": "1997", "authors": "Katsura T, Gustafson CE, Ausiello DA, Brown D", "evidence": [ { "database": "Reactome", "id": "R-HSA-432040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432040" } ], "reference": [ { "type": "PubMed", "id": "9227644", "url": "https://glygen.org/publication/PubMed/9227644" } ] }, { "title": "Anagrelide as a new platelet-lowering agent in essential thrombocythemia: mechanism of actin, efficacy, toxicity, current indications.", "journal": "Seminars in thrombosis and hemostasis", "date": "1997", "authors": "Tefferi A, Silverstein MN, Petitt RM, Mesa RA, Solberg LA Jr", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "9263355", "url": "https://glygen.org/publication/PubMed/9263355" } ] }, { "title": "Gene structure and chromosome localization of the G gamma c subunit of human cone G-protein (GNGT2).", "journal": "Genomics", "date": "1997", "authors": "Ong O C, Hu K, Rong H, Lee R H, Fung B K", "evidence": [ { "database": "UniProtKB", "id": "O14610", "url": "https://www.uniprot.org/uniprot/O14610" } ], "reference": [ { "type": "PubMed", "id": "9286705", "url": "https://glygen.org/publication/PubMed/9286705" } ] }, { "title": "Direct stimulation of Bruton's tyrosine kinase by G(q)-protein alpha-subunit.", "journal": "Nature", "date": "1997", "authors": "Bence K, Ma W, Kozasa T, Huang XY", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "9305846", "url": "https://glygen.org/publication/PubMed/9305846" } ] }, { "title": "Rho GTPases and signaling networks.", "journal": "Genes & development", "date": "1997", "authors": "Van Aelst L, D'Souza-Schorey C", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "9308960", "url": "https://glygen.org/publication/PubMed/9308960" } ] }, { "title": "Mercury-sensitive residues and pore site in AQP3 water channel.", "journal": "Biochemistry", "date": "1997", "authors": "Kuwahara M, Gu Y, Ishibashi K, Marumo F, Sasaki S", "evidence": [ { "database": "Reactome", "id": "R-HSA-432040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432040" } ], "reference": [ { "type": "PubMed", "id": "9369468", "url": "https://glygen.org/publication/PubMed/9369468" } ] }, { "title": "Aquaporins in complex tissues. I. Developmental patterns in respiratory and glandular tissues of rat.", "journal": "The American journal of physiology", "date": "1997", "authors": "King LS, Nielsen S, Agre P", "evidence": [ { "database": "Reactome", "id": "R-HSA-432040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432040" } ], "reference": [ { "type": "PubMed", "id": "9374639", "url": "https://glygen.org/publication/PubMed/9374639" } ] }, { "title": "Aquaporins in complex tissues. II. Subcellular distribution in respiratory and glandular tissues of rat.", "journal": "The American journal of physiology", "date": "1997", "authors": "Nielsen S, King LS, Christensen BM, Agre P", "evidence": [ { "database": "Reactome", "id": "R-HSA-432040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432040" } ], "reference": [ { "type": "PubMed", "id": "9374640", "url": "https://glygen.org/publication/PubMed/9374640" } ] }, { "title": "Interaction of Wnt and a Frizzled homologue triggers G-protein-linked phosphatidylinositol signalling.", "journal": "Nature", "date": "1997", "authors": "Slusarski DC, Corces VG, Moon RT", "evidence": [ { "database": "Reactome", "id": "R-HSA-4086398", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398" } ], "reference": [ { "type": "PubMed", "id": "9389482", "url": "https://glygen.org/publication/PubMed/9389482" } ] }, { "title": "Matrix metalloproteinase-3 releases active heparin-binding EGF-like growth factor by cleavage at a specific juxtamembrane site.", "journal": "The Journal of biological chemistry", "date": "1997", "authors": "Suzuki M, Raab G, Moses MA, Fernandez CA, Klagsbrun M", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "9395517", "url": "https://glygen.org/publication/PubMed/9395517" } ] }, { "title": "Crystal structure of the catalytic domains of adenylyl cyclase in a complex with Gsalpha.GTPgammaS.", "journal": "Science (New York, N.Y.)", "date": "1997", "authors": "Tesmer JJ, Sunahara RK, Gilman AG, Sprang SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "9417641", "url": "https://glygen.org/publication/PubMed/9417641" } ] }, { "title": "Phosphorylation of inositol 1,4,5-trisphosphate receptors by cAMP-dependent protein kinase. Type I, II, and III receptors are differentially susceptible to phosphorylation and are phosphorylated in intact cells.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Wojcikiewicz RJ, Luo SG", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "9488697", "url": "https://glygen.org/publication/PubMed/9488697" } ] }, { "title": "Specific G protein activation and mu-opioid receptor internalization caused by morphine, DAMGO and endomorphin I.", "journal": "European journal of pharmacology", "date": "1998", "authors": "Burford NT, Tolbert LM, Sadee W", "evidence": [ { "database": "Reactome", "id": "R-HSA-202040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202040" } ], "reference": [ { "type": "PubMed", "id": "9544801", "url": "https://glygen.org/publication/PubMed/9544801" } ] }, { "title": "Insulin-like growth factor-1 (IGF-1) receptor-insulin receptor substrate complexes in the uterus. Altered signaling response to estradiol in the IGF-1(m/m) mouse.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Richards RG, Walker MP, Sebastian J, DiAugustine RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "9565625", "url": "https://glygen.org/publication/PubMed/9565625" } ] }, { "title": "Inhibition of cell migration, spreading, and focal adhesions by tumor suppressor PTEN.", "journal": "Science (New York, N.Y.)", "date": "1998", "authors": "Tamura M, Gu J, Matsumoto K, Aota S, Parsons R, Yamada KM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9009391", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391" } ], "reference": [ { "type": "PubMed", "id": "9616126", "url": "https://glygen.org/publication/PubMed/9616126" } ] }, { "title": "Cloning and characterization of human protease-activated receptor 4.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Xu WF, Andersen H, Whitmore TE, Presnell SR, Yee DP, Ching A, Gilbert T, Davie EW, Foster DC", "evidence": [ { "database": "Reactome", "id": "R-HSA-456926", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-456926" } ], "reference": [ { "type": "PubMed", "id": "9618465", "url": "https://glygen.org/publication/PubMed/9618465" } ] }, { "title": "Stimulation of type 1 and type 8 Ca2+/calmodulin-sensitive adenylyl cyclases by the Gs-coupled 5-hydroxytryptamine subtype 5-HT7A receptor.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Baker LP, Nielsen MD, Impey S, Metcalf MA, Poser SW, Chan G, Obrietan K, Hamblin MW, Storm DR", "evidence": [ { "database": "Reactome", "id": "R-HSA-418555", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555" } ], "reference": [ { "type": "PubMed", "id": "9651336", "url": "https://glygen.org/publication/PubMed/9651336" } ] }, { "title": "Inhibition of adenylyl cyclase isoforms V and VI by various Gbetagamma subunits.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "1998", "authors": "Bayewitch ML, Avidor-Reiss T, Levy R, Pfeuffer T, Nevo I, Simonds WF, Vogel Z", "evidence": [ { "database": "Reactome", "id": "R-HSA-400042", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400042" } ], "reference": [ { "type": "PubMed", "id": "9707174", "url": "https://glygen.org/publication/PubMed/9707174" } ] }, { "title": "Molecular basis of V2 vasopressin receptor/Gs coupling selectivity.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Erlenbach I, Wess J", "evidence": [ { "database": "Reactome", "id": "R-HSA-432040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432040" } ], "reference": [ { "type": "PubMed", "id": "9756892", "url": "https://glygen.org/publication/PubMed/9756892" } ] }, { "title": "Subtype-specific stimulation of [35S]GTPgammaS binding by recombinant alpha2-adrenoceptors.", "journal": "European journal of pharmacology", "date": "1998", "authors": "Peltonen JM, Pihlavisto M, Scheinin M", "evidence": [ { "database": "Reactome", "id": "R-HSA-400042", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400042" } ], "reference": [ { "type": "PubMed", "id": "9760042", "url": "https://glygen.org/publication/PubMed/9760042" } ] }, { "title": "Identification of the binding site for Gqalpha on its effector Bruton's tyrosine kinase.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1998", "authors": "Ma YC, Huang XY", "evidence": [ { "database": "Reactome", "id": "R-HSA-416476", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476" } ], "reference": [ { "type": "PubMed", "id": "9770463", "url": "https://glygen.org/publication/PubMed/9770463" } ] }, { "title": "The G protein G alpha12 stimulates Bruton's tyrosine kinase and a rasGAP through a conserved PH/BM domain.", "journal": "Nature", "date": "1998", "authors": "Jiang Y, Ma W, Wan Y, Kozasa T, Hattori S, Huang XY", "evidence": [ { "database": "Reactome", "id": "R-HSA-416482", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482" } ], "reference": [ { "type": "PubMed", "id": "9796816", "url": "https://glygen.org/publication/PubMed/9796816" } ] }, { "title": "Bidirectional water fluxes and specificity for small hydrophilic molecules in aquaporins 0-5.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Meinild AK, Klaerke DA, Zeuthen T", "evidence": [ { "database": "Reactome", "id": "R-HSA-432040", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432040" } ], "reference": [ { "type": "PubMed", "id": "9829975", "url": "https://glygen.org/publication/PubMed/9829975" } ] }, { "title": "Expression of adenylyl cyclase subtypes in pancreatic beta-cells.", "journal": "Biochemical and biophysical research communications", "date": "1999", "authors": "Leech CA, Castonguay MA, Habener JF", "evidence": [ { "database": "Reactome", "id": "R-HSA-381676", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676" } ], "reference": [ { "type": "PubMed", "id": "9920805", "url": "https://glygen.org/publication/PubMed/9920805" } ] }, { "title": "Beta-arrestin-dependent formation of beta2 adrenergic receptor-Src protein kinase complexes.", "journal": "Science (New York, N.Y.)", "date": "1999", "authors": "Luttrell LM, Ferguson SS, Daaka Y, Miller WE, Maudsley S, Della Rocca GJ, Lin F, Kawakatsu H, Owada K, Luttrell DK, Caron MG, Lefkowitz RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-456926", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-456926" } ], "reference": [ { "type": "PubMed", "id": "9924018", "url": "https://glygen.org/publication/PubMed/9924018" } ] }, { "title": "Prototypic G protein-coupled receptor for the intestinotrophic factor glucagon-like peptide 2.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "1999", "authors": "Munroe DG, Gupta AK, Kooshesh F, Vyas TB, Rizkalla G, Wang H, Demchyshyn L, Yang ZJ, Kamboj RK, Chen H, McCallum K, Sumner-Smith M, Drucker DJ, Crivici A", "evidence": [ { "database": "Reactome", "id": "R-HSA-420092", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-420092" } ], "reference": [ { "type": "PubMed", "id": "9990065", "url": "https://glygen.org/publication/PubMed/9990065" } ] } ], "pathway": [ { "id": "hsa:2793", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:2793", "resource": "KEGG Pathway" }, { "id": "R-HSA-1296041", "name": "Activation of G protein gated Potassium channels", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-1296041", "resource": "Reactome", "description": "Activation of G protein gated Potassium channels" }, { "id": "R-HSA-202040", "name": "G-protein activation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-202040", "resource": "Reactome", "description": "G-protein activation" }, { "id": "R-HSA-381676", "name": "Glucagon-like Peptide-1 (GLP1) regulates insulin secretion", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-381676", "resource": "Reactome", "description": "Glucagon-like Peptide-1 (GLP1) regulates insulin secretion" }, { "id": "R-HSA-392170", "name": "ADP signalling through P2Y purinoceptor 12", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-392170", "resource": "Reactome", "description": "ADP signalling through P2Y purinoceptor 12" }, { "id": "R-HSA-392451", "name": "G beta:gamma signalling through PI3Kgamma", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-392451", "resource": "Reactome", "description": "G beta:gamma signalling through PI3Kgamma" }, { "id": "R-HSA-392851", "name": "Prostacyclin signalling through prostacyclin receptor", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-392851", "resource": "Reactome", "description": "Prostacyclin signalling through prostacyclin receptor" }, { "id": "R-HSA-400042", "name": "Adrenaline,noradrenaline inhibits insulin secretion", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-400042", "resource": "Reactome", "description": "Adrenaline,noradrenaline inhibits insulin secretion" }, { "id": "R-HSA-4086398", "name": "Ca2+ pathway", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-4086398", "resource": "Reactome", "description": "Ca2+ pathway" }, { "id": "R-HSA-416476", "name": "G alpha (q) signalling events", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416476", "resource": "Reactome", "description": "G alpha (q) signalling events" }, { "id": "R-HSA-416482", "name": "G alpha (12/13) signalling events", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-416482", "resource": "Reactome", "description": "G alpha (12/13) signalling events" }, { "id": "R-HSA-418217", "name": "G beta:gamma signalling through PLC beta", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418217", "resource": "Reactome", "description": "G beta:gamma signalling through PLC beta" }, { "id": "R-HSA-418555", "name": "G alpha (s) signalling events", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418555", "resource": "Reactome", "description": "G alpha (s) signalling events" }, { "id": "R-HSA-418592", "name": "ADP signalling through P2Y purinoceptor 1", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418592", "resource": "Reactome", "description": "ADP signalling through P2Y purinoceptor 1" }, { "id": "R-HSA-418594", "name": "G alpha (i) signalling events", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418594", "resource": "Reactome", "description": "G alpha (i) signalling events" }, { "id": "R-HSA-418597", "name": "G alpha (z) signalling events", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-418597", "resource": "Reactome", "description": "G alpha (z) signalling events" }, { "id": "R-HSA-420092", "name": "Glucagon-type ligand receptors", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-420092", "resource": "Reactome", "description": "Glucagon-type ligand receptors" }, { "id": "R-HSA-428930", "name": "Thromboxane signalling through TP receptor", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-428930", "resource": "Reactome", "description": "Thromboxane signalling through TP receptor" }, { "id": "R-HSA-432040", "name": "Vasopressin regulates renal water homeostasis via Aquaporins", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-432040", "resource": "Reactome", "description": "Vasopressin regulates renal water homeostasis via Aquaporins" }, { "id": "R-HSA-456926", "name": "Thrombin signalling through proteinase activated receptors (PARs)", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-456926", "resource": "Reactome", "description": "Thrombin signalling through proteinase activated receptors (PARs)" }, { "id": "R-HSA-500657", "name": "Presynaptic function of Kainate receptors", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-500657", "resource": "Reactome", "description": "Presynaptic function of Kainate receptors" }, { "id": "R-HSA-6814122", "name": "Cooperation of PDCL (PhLP1) and TRiC/CCT in G-protein beta folding", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6814122", "resource": "Reactome", "description": "Cooperation of PDCL (PhLP1) and TRiC/CCT in G-protein beta folding" }, { "id": "R-HSA-8964315", "name": "G beta:gamma signalling through BTK", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964315", "resource": "Reactome", "description": "G beta:gamma signalling through BTK" }, { "id": "R-HSA-8964616", "name": "G beta:gamma signalling through CDC42", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-8964616", "resource": "Reactome", "description": "G beta:gamma signalling through CDC42" }, { "id": "R-HSA-9009391", "name": "Extra-nuclear estrogen signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9009391", "resource": "Reactome", "description": "Extra-nuclear estrogen signaling" }, { "id": "R-HSA-9634597", "name": "GPER1 signaling", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9634597", "resource": "Reactome", "description": "GPER1 signaling" }, { "id": "R-HSA-9660821", "name": "ADORA2B mediated anti-inflammatory cytokines production", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9660821", "resource": "Reactome", "description": "ADORA2B mediated anti-inflammatory cytokines production" }, { "id": "R-HSA-997272", "name": "Inhibition of voltage gated Ca2+ channels via Gbeta/gamma subunits", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-997272", "resource": "Reactome", "description": "Inhibition of voltage gated Ca2+ channels via Gbeta/gamma subunits" } ], "orthologs": [ { "uniprot_canonical_ac": "Q61017-1", "protein_name": "Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-T2", "gene_name": "Gngt2", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MAQDLSEKELLRMEVEQLKKEVKNPRDLISKTGKEIKDYVEAQAGTDPLLKGIPEDKNPFKEKGTCVLS", "length": 69 }, "evidence": [ { "id": "45918339", "url": "http://www.informatics.jax.org/homology/45918339", "database": "MGI" }, { "id": "O14610", "url": "https://omabrowser.org/oma/group/O14610/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "G-protein beta-subunit binding", "id": "GO:0031681", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031681", "evidence": [ { "database": "UniProtKB", "id": "O14610", "url": "https://www.uniprot.org/uniprot/O14610" } ], "pmid": "" }, { "name": "GTPase activity", "id": "GO:0003924", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0003924", "evidence": [ { "database": "UniProtKB", "id": "O14610", "url": "https://www.uniprot.org/uniprot/O14610" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "G protein-coupled receptor signaling pathway", "id": "GO:0007186", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007186", "evidence": [ { "database": "UniProtKB", "id": "O14610", "url": "https://www.uniprot.org/uniprot/O14610" } ], "pmid": "" }, { "name": "phototransduction", "id": "GO:0007602", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007602", "evidence": [ { "database": "UniProtKB", "id": "O14610", "url": "https://www.uniprot.org/uniprot/O14610" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "heterotrimeric G-protein complex", "id": "GO:0005834", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005834", "evidence": [ { "database": "UniProtKB", "id": "O14610", "url": "https://www.uniprot.org/uniprot/O14610" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 439 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }