{ "uniprot_canonical_ac": "O14599-1", "uniprot_ac": "O14599", "uniprot_id": "VCY2_HUMAN", "mass": { "chemical_mass": 12063.0, "monoisotopic_mass": 12063.0 }, "refseq": { "ac": "NP_001002761", "name": "testis-specific basic protein Y 2", "summary": "This gene is located in the nonrecombining portion of the Y chromosome, and expressed specifically in testis. The encoded protein interacts with ubiquitin protein ligase E3A and may be involved in male germ cell development and male infertility. Three nearly identical copies of this gene exist on chromosome Y; two copies are part of a palindromic region. This record represents the more telomeric copy within the palindrome. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001002761" }, "gene_names": [ { "name": "BPY2B", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O14599", "id": "O14599" }, { "name": "BPY2C", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O14599", "id": "O14599" }, { "name": "BPY2", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O14599", "id": "O14599" }, { "name": "BPY2A", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O14599", "id": "O14599" }, { "name": "BPY2B", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O14599", "id": "O14599" }, { "name": "BPY2C", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001002761", "id": "NP_001002761" }, { "name": "BPY2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O14599", "id": "O14599" }, { "name": "VCY2A", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O14599", "id": "O14599" }, { "name": "VCY2B", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O14599", "id": "O14599" }, { "name": "VCY2C", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001002761", "id": "NP_001002761" }, { "name": "VCY2C", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O14599", "id": "O14599" }, { "name": "VCY2", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O14599", "id": "O14599" } ], "protein_names": [ { "name": "Testis-specific basic protein Y 2", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O14599" }, { "name": "Basic charge, Y-linked 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O14599" }, { "name": "Variably charged protein Y 2", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O14599" }, { "name": "basic protein on Y chromosome 2; variable charge, Y-linked, 2; basic charge, Y-linked 2; variably charged protein Y 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001002761", "id": "NP_001002761" }, { "name": "testis-specific basic protein Y 2", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001002761", "id": "NP_001002761" } ], "function": [ { "annotation": "The AC006262.5-miR-7855-5p-BPY2C axis facilitates hepatocellular carcinoma proliferation and migration.", "evidence": [ { "database": "RefSeq", "id": "NP_001002761", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001002761" }, { "database": "PubMed", "id": "32956593", "url": "https://glygen.org/publication/PubMed/32956593" } ] }, { "annotation": "This gene is located in the nonrecombining portion of the Y chromosome, and expressed specifically in testis. The encoded protein interacts with ubiquitin protein ligase E3A and may be involved in male germ cell development and male infertility. Three nearly identical copies of this gene exist on chromosome Y; two copies are part of a palindromic region. This record represents the more telomeric copy within the palindrome. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_001002761", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001002761" } ] }, { "annotation": "VCY2 protein interacts with the HECT domain of ubiquitin-protein ligase E3A", "evidence": [ { "database": "RefSeq", "id": "NP_001002761", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001002761" }, { "database": "PubMed", "id": "12207887", "url": "https://glygen.org/publication/PubMed/12207887" } ] }, { "annotation": "VCY2 was weakly expressed at the spermatogonia and immunonegative in spermatocytes and round spermatids in testicular biopsy specimens with maturation arrest or hypospermatogenesis.", "evidence": [ { "database": "RefSeq", "id": "NP_001002761", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001002761" }, { "database": "PubMed", "id": "12724276", "url": "https://glygen.org/publication/PubMed/12724276" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [], "expression_disease": [], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O14599", "url": "https://www.uniprot.org/uniprot/O14599" } ], "common_name": "Human" } ], "gene": [ { "name": "BPY2C", "url": "https://www.uniprot.org/uniprot/O14599", "locus": { "chromosome": "Y", "start_pos": 25030901, "end_pos": 25062548, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000185894", "url": "https://www.ensembl.org/id/ENSG00000185894" } ] } } ], "crossref": [ { "id": "ENSG00000183753", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000183753", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "BPY2", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=BPY2", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "BPY2B", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=BPY2B", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "BPY2C", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=BPY2C", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "442867", "url": "https://www.ncbi.nlm.nih.gov/gene/442867", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "442868", "url": "https://www.ncbi.nlm.nih.gov/gene/442868", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "9083", "url": "https://www.ncbi.nlm.nih.gov/gene/9083", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "13508", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=13508", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "18225", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=18225", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "25449", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=25449", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O14599", "url": "https://www.ebi.ac.uk/intact/interactors/id:O14599*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "hsa:442867", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:442867", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "hsa:442868", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:442868", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "hsa:9083", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:9083", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "400013", "url": "http://www.omim.org/entry/400013", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O14599", "url": "https://www.nextprot.org/entry/NX_O14599", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "O14599", "url": "https://pharos.nih.gov/targets/O14599", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O14599", "url": "http://purl.obolibrary.org/obo/PR_O14599", "database": "PRO", "categories": [ "Protein" ] }, { "id": "NP_001002761", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001002761", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "O14599", "url": "https://www.uniprot.org/uniprot/O14599", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O14599-1", "url": "https://www.uniprot.org/uniprot/O14599-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "R4GMN0", "url": "https://www.uniprot.org/uniprot/R4GMN0", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "R4GMN0-1", "url": "https://www.uniprot.org/uniprot/R4GMN0-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MMTLVPRARTRAGQDHYSHPCPRFSQVLLTEGIMTYCLTKNLSDVNILHRLLKNGNVRNTLLQSKVGLLTYYVKLYPGEVTLLTRPSIQMRLCCITGSVSRPRSQK", "length": 106, "header": "sp|O14599-1|VCY2_HUMAN Isoform 1 of Testis-specific basic protein Y 2 OS=Homo sapiens OX=9606 GN=BPY2C PE=1 SV=2 CANONICAL=O14599-1" }, "isoforms": [ { "isoform_ac": "O14599-1", "url": "", "sequence": { "sequence": "MMTLVPRARTRAGQDHYSHPCPRFSQVLLTEGIMTYCLTKNLSDVNILHRLLKNGNVRNTLLQSKVGLLTYYVKLYPGEVTLLTRPSIQMRLCCITGSVSRPRSQK", "length": 106, "header": "sp|O14599-1|VCY2_HUMAN Isoform 1 of Testis-specific basic protein Y 2 OS=Homo sapiens OX=9606 GN=BPY2C PE=1 SV=2 CANONICAL=O14599-1" }, "locus": { "chromosome": "Y", "start_pos": 22998265, "end_pos": 22992344, "strand": "-", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000382585.2", "url": "https://www.ensembl.org/id/ENST00000382585.2" }, { "database": "Ensembl Peptide", "id": "ENSP00000372028.1", "url": "https://www.ensembl.org/id/ENSP00000372028.1" } ] } }, { "isoform_ac": "R4GMN0-1", "url": "", "sequence": { "sequence": "MMTLVPRARTR", "length": 11, "header": "tr|R4GMN0-1|VCY2_HUMAN Computationally mapped isoform of Testis-specific basic protein Y 2 OS=Homo sapiens OX=9606 GN=BPY2C PE=1 SV=1 CANONICAL=O14599-1" }, "locus": { "chromosome": "Y", "start_pos": 25044023, "end_pos": 25043991, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000602680.1", "url": "https://www.ensembl.org/id/ENST00000602680.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000473549.1", "url": "https://www.ensembl.org/id/ENSP00000473549.1" } ] } } ], "glycosylation": [], "phosphorylation": [], "glycation": [], "keywords": [], "publication": [ { "title": "VCY2 protein interacts with the HECT domain of ubiquitin-protein ligase E3A.", "journal": "Biochem. Biophys. Res. Commun.", "date": "2002", "authors": "Wong EY, Tse JY, Yao KM, Tam PC, Yeung WS", "evidence": [ { "database": "UniProtKB", "id": "O14599", "url": "https://www.uniprot.org/uniprot/O14599" }, { "database": "RefSeq", "id": "NP_001002761", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001002761" } ], "reference": [ { "type": "PubMed", "id": "12207887", "url": "https://glygen.org/publication/PubMed/12207887" } ] }, { "title": "Specific expression of VCY2 in human male germ cells and its involvement in the pathogenesis of male infertility.", "journal": "Biol. Reprod.", "date": "2003", "authors": "Tse JY, Wong EY, Cheung AN, O WS, Tam PC, Yeung WS", "evidence": [ { "database": "UniProtKB", "id": "O14599", "url": "https://www.uniprot.org/uniprot/O14599" }, { "database": "RefSeq", "id": "NP_001002761", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001002761" } ], "reference": [ { "type": "PubMed", "id": "12724276", "url": "https://glygen.org/publication/PubMed/12724276" } ] }, { "title": "Identification and characterization of a VCY2 interacting protein-1; VCY2IP-1, a MAP-like protein.", "journal": "Biol. Reprod.", "date": "2004", "authors": "Wong EY, Tse JY, Yao KM, Lui VC, Tam PC, Yeung WS", "evidence": [ { "database": "UniProtKB", "id": "O14599", "url": "https://www.uniprot.org/uniprot/O14599" } ], "reference": [ { "type": "PubMed", "id": "14627543", "url": "https://glygen.org/publication/PubMed/14627543" } ] }, { "title": "The AC006262.5-miR-7855-5p-BPY2C axis facilitates hepatocellular carcinoma proliferation and migration.", "journal": "Biochemistry and cell biology = Biochimie et biologie cellulaire", "date": "2021-06", "authors": "Chen Fen-Rong, Wang Yan, Cheng Yan, Shi Hai-Tao, Li Hong, Jia Miao, Sha Su-Mei, Dong Lei", "evidence": [ { "database": "RefSeq", "id": "NP_001002761", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_001002761" } ], "reference": [ { "type": "PubMed", "id": "32956593", "url": "https://glygen.org/publication/PubMed/32956593" } ] }, { "title": "Functional coherence of the human Y chromosome.", "journal": "Science", "date": "1997", "authors": "Lahn B T, Page D C", "evidence": [ { "database": "UniProtKB", "id": "O14599", "url": "https://www.uniprot.org/uniprot/O14599" } ], "reference": [ { "type": "PubMed", "id": "9381176", "url": "https://glygen.org/publication/PubMed/9381176" } ] } ], "pathway": [ { "id": "hsa:442867", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:442867", "resource": "KEGG Pathway" }, { "id": "hsa:442868", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:442868", "resource": "KEGG Pathway" }, { "id": "hsa:9083", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:9083", "resource": "KEGG Pathway" } ], "orthologs": [], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 1, "go_terms": [ { "name": "HECT domain binding", "id": "GO:0032399", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032399", "evidence": [ { "database": "UniProtKB", "id": "O14599", "url": "https://www.uniprot.org/uniprot/O14599" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "nucleus", "id": "GO:0005634", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005634", "evidence": [ { "database": "UniProtKB", "id": "O14599", "url": "https://www.uniprot.org/uniprot/O14599" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 2, "go_terms": [ { "name": "spermatogenesis", "id": "GO:0007283", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007283", "evidence": [ { "database": "UniProtKB", "id": "O14599", "url": "https://www.uniprot.org/uniprot/O14599" } ], "pmid": "" }, { "name": "single fertilization", "id": "GO:0007338", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007338", "evidence": [ { "database": "UniProtKB", "id": "O14599", "url": "https://www.uniprot.org/uniprot/O14599" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 41, "end_pos": 43, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 41, "end_pos": 43 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 5 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }