{ "uniprot_canonical_ac": "O14581-1", "uniprot_ac": "O14581", "uniprot_id": "OR7AH_HUMAN", "mass": { "chemical_mass": 34013.0, "monoisotopic_mass": 34013.0 }, "refseq": { "ac": "NP_112163", "name": "olfactory receptor 7A17", "summary": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_112163" }, "gene_names": [ { "name": "OR7A17", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O14581", "id": "O14581" }, { "name": "BC85395_4; HTPCRX19", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_112163", "id": "NP_112163" }, { "name": "OR7A17", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_112163", "id": "NP_112163" } ], "protein_names": [ { "name": "Olfactory receptor 7A17", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O14581" }, { "name": "olfactory receptor 7A17", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_112163", "id": "NP_112163" }, { "name": "olfactory receptor OR19-20", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_112163", "id": "NP_112163" } ], "function": [ { "annotation": "Odorant receptor.", "evidence": [ { "database": "UniProtKB", "id": "O14581", "url": "https://www.uniprot.org/uniprot/O14581#function" } ] }, { "annotation": "Olfactory Receptor OR7A17 Expression Correlates with All-Trans Retinoic Acid (ATRA)-Induced Suppression of Proliferation in Human Keratinocyte Cells. Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_112163", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_112163" }, { "database": "PubMed", "id": "34830183", "url": "https://glygen.org/publication/PubMed/34830183" } ] }, { "annotation": "Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq, Jul 2008].", "evidence": [ { "database": "RefSeq", "id": "NP_112163", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_112163" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "rs1234435023", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1234435023" }, { "id": "rs1234435023", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1234435023" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 271, "end_pos": 271, "sequence_org": "S", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (SAT->NAT).", "chr_id": "19", "chr_pos": "14880544", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S271", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1258438645", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1258438645" }, { "id": "rs1258438645", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs1258438645" } ], "glycoeffect": [ "n-glyco-sequon-gain", "o-glyco-site-loss" ], "start_pos": 302, "end_pos": 302, "sequence_org": "K", "sequence_mut": "N", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (KMS->NMS).", "chr_id": "19", "chr_pos": "14880450", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "K302", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs892931007", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs892931007" }, { "id": "rs892931007", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs892931007" } ], "glycoeffect": [ "n-glyco-sequon-loss" ], "start_pos": 5, "end_pos": 5, "sequence_org": "N", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->SDT).", "chr_id": "19", "chr_pos": "14881342", "ref_nt": "C", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N5", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs942267157", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs942267157" }, { "id": "rs942267157", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs942267157#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 7, "end_pos": 7, "sequence_org": "T", "sequence_mut": "K", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NDT->NDK).", "chr_id": "19", "chr_pos": "14881336", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "T7", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "26.13", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000185385", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185385" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "41.27", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000185385", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185385" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "16.41", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000185385", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185385" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "17.43", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000185385", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185385" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "16.94", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000185385", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185385" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "26.53", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000185385", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185385" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "18.62", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000185385", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185385" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "21.77", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000185385", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185385" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "16.63", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000185385", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185385" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "20.62", "present": "ABSENT", "evidence": [ { "database": "Bgee", "id": "ENSG00000185385", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185385" } ] } ], "expression_disease": [ { "significant": "No", "trend": "up", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O14581", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14581" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O14581", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14581" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O14581", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14581" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O14581", "url": "https://www.uniprot.org/uniprot/O14581" } ], "common_name": "Human" } ], "gene": [ { "name": "OR7A17", "url": "https://www.uniprot.org/uniprot/O14581", "locus": { "chromosome": "19", "start_pos": 14878203, "end_pos": 14886132, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000185385", "url": "https://www.ensembl.org/id/ENSG00000185385" } ] } } ], "crossref": [ { "id": "ENSG00000185385", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000185385", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "cd15234", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd15234", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "OR7A17", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=OR7A17", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "26333", "url": "https://www.ncbi.nlm.nih.gov/gene/26333", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "8363", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=8363", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O14581", "url": "https://www.ebi.ac.uk/intact/interactors/id:O14581*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000276", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000276", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR000725", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000725", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR017452", "url": "https://www.ebi.ac.uk/interpro/entry/IPR017452", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:26333", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:26333", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "NX_O14581", "url": "https://www.nextprot.org/entry/NX_O14581", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "KEPEFQL", "url": "https://omabrowser.org/oma/group/KEPEFQL/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "5401587at2759", "url": "http://www.orthodb.org/?query=5401587at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR48001", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48001", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR48001:SF142", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR48001:SF142", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF13853", "url": "http://pfam.xfam.org/family/PF13853", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O14581", "url": "https://pharos.nih.gov/targets/O14581", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O14581", "url": "http://purl.obolibrary.org/obo/PR_O14581", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-9752946", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9752946", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_112163", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_112163", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "O14581", "url": "https://www.uniprot.org/uniprot/O14581", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O14581-1", "url": "https://www.uniprot.org/uniprot/O14581-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MEPENDTGISEFVLLGLSEEPELQPFLFGLFLSMYLVTVLGNLLIILATISDSHLHTPMYFFLSNLSFADICFISTTIPKMLINIQTQSRVITYAGCITQMCFFVLFGGLDSLLLAVMAYDRFVAICHPLHYTVIMNPRLCGLLVLASWMIAALNSLSQSLMVLWLSFCTDLEIPHFFCELNQVIHLACSDTFLNDMGMYFAAGLLAGGPLVGILCSYSKIVSSIRAISSAQGKYKAFSTCASHLSVVSLFCCTGLGVYLTSAATHNSHTSATASVMYTVATPMLNPFIYSLRNKDIKRALKMSFRGKQ", "length": 309, "header": "sp|O14581-1|OR7AH_HUMAN Isoform 1 of Olfactory receptor 7A17 OS=Homo sapiens OX=9606 GN=OR7A17 PE=1 SV=1 CANONICAL=O14581-1" }, "isoforms": [ { "isoform_ac": "O14581-1", "url": "", "sequence": { "sequence": "MEPENDTGISEFVLLGLSEEPELQPFLFGLFLSMYLVTVLGNLLIILATISDSHLHTPMYFFLSNLSFADICFISTTIPKMLINIQTQSRVITYAGCITQMCFFVLFGGLDSLLLAVMAYDRFVAICHPLHYTVIMNPRLCGLLVLASWMIAALNSLSQSLMVLWLSFCTDLEIPHFFCELNQVIHLACSDTFLNDMGMYFAAGLLAGGPLVGILCSYSKIVSSIRAISSAQGKYKAFSTCASHLSVVSLFCCTGLGVYLTSAATHNSHTSATASVMYTVATPMLNPFIYSLRNKDIKRALKMSFRGKQ", "length": 309, "header": "sp|O14581-1|OR7AH_HUMAN Isoform 1 of Olfactory receptor 7A17 OS=Homo sapiens OX=9606 GN=OR7A17 PE=1 SV=1 CANONICAL=O14581-1" }, "locus": { "chromosome": "19", "start_pos": 14881355, "end_pos": 14880429, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000642123.1", "url": "https://www.ensembl.org/id/ENST00000642123.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000493071.1", "url": "https://www.ensembl.org/id/ENSP00000493071.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "predicted", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 5, "start_aa": "Asn", "end_pos": 5, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn5", "evidence": [ { "id": "O14581", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14581#ptm_processing" } ] } ], "phosphorylation": [], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_predicted" ], "publication": [ { "title": "The human olfactory receptor gene family.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2004", "authors": "Malnic B, Godfrey PA, Buck LB", "evidence": [ { "database": "UniProtKB", "id": "O14581", "url": "https://www.uniprot.org/uniprot/O14581" } ], "reference": [ { "type": "PubMed", "id": "14983052", "url": "https://glygen.org/publication/PubMed/14983052" } ] }, { "title": "Profiling of olfactory receptor gene expression in whole human olfactory mucosa.", "journal": "PloS one", "date": "2014", "authors": "Verbeurgt C, Wilkin F, Tarabichi M, Gregoire F, Dumont JE, Chatelain P", "evidence": [ { "database": "Reactome", "id": "R-HSA-9752946", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9752946" } ], "reference": [ { "type": "PubMed", "id": "24800820", "url": "https://glygen.org/publication/PubMed/24800820" } ] }, { "title": "The human olfactory transcriptome.", "journal": "BMC genomics", "date": "2016", "authors": "Olender T, Keydar I, Pinto JM, Tatarskyy P, Alkelai A, Chien MS, Fishilevich S, Restrepo D, Matsunami H, Gilad Y, Lancet D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9752946", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9752946" } ], "reference": [ { "type": "PubMed", "id": "27515280", "url": "https://glygen.org/publication/PubMed/27515280" } ] }, { "title": "Structural instability and divergence from conserved residues underlie intracellular retention of mammalian odorant receptors.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2020", "authors": "Ikegami K, de March CA, Nagai MH, Ghosh S, Do M, Sharma R, Bruguera ES, Lu YE, Fukutani Y, Vaidehi N, Yohda M, Matsunami H", "evidence": [ { "database": "Reactome", "id": "R-HSA-9752946", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9752946" } ], "reference": [ { "type": "PubMed", "id": "31974307", "url": "https://glygen.org/publication/PubMed/31974307" } ] }, { "title": "Single-cell analysis of olfactory neurogenesis and differentiation in adult humans.", "journal": "Nature neuroscience", "date": "2020", "authors": "Durante MA, Kurtenbach S, Sargi ZB, Harbour JW, Choi R, Kurtenbach S, Goss GM, Matsunami H, Goldstein BJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9752946", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9752946" } ], "reference": [ { "type": "PubMed", "id": "32066986", "url": "https://glygen.org/publication/PubMed/32066986" } ] }, { "title": "Olfactory Receptor OR7A17 Expression Correlates with All-Trans Retinoic Acid (ATRA)-Induced Suppression of Proliferation in Human Keratinocyte Cells.", "journal": "International journal of molecular sciences", "date": "2021", "authors": "Kim H, Park SH, Oh SW, Kwon K, Park SJ, Yu E, Yang S, Park JY, Choi S, Yang S, Han SB, Song M, Cho JY, Lee J", "evidence": [ { "database": "RefSeq", "id": "NP_112163", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_112163" } ], "reference": [ { "type": "PubMed", "id": "34830183", "url": "https://glygen.org/publication/PubMed/34830183" } ] } ], "pathway": [ { "id": "hsa:26333", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:26333", "resource": "KEGG Pathway" }, { "id": "R-HSA-9752946", "name": "Expression and translocation of olfactory receptors", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9752946", "resource": "Reactome", "description": "Expression and translocation of olfactory receptors" } ], "orthologs": [ { "uniprot_canonical_ac": "D4AD59-1", "protein_name": "Olfactory receptor", "gene_name": "Or7a41", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MESGNDTQLSEFFLLGFSEKQPEIQPLIFGLFLSMYLVTVTGNLLIIVAIIVDAHLHTPMYIFLSNLSFVDICFTSTTVPQMLVNIHTQSKVITYAGCITQMYFLLLFSGLDIFLLTVMAYDRYVAICHPLHYMIIMNTRRCGLLILACWIIGVLNSLLHSFLVLRLSFCTNLEIPHFFCELNQVVHQACSDTFINDMVIYITAMLLAVGPLSGILYSYSKIVSSIRAISSAQGKYKAFSTCASHLSVVSLFYCTLLGVYLSSAVTQNSHATATASLMYTVVTPMLNPFIYSLRNKDIKTALKILLGSVTRSRLMDSPS", "length": 319 }, "evidence": [ { "id": "45917027", "url": "http://www.informatics.jax.org/homology/45917027", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "D4AD60-1", "protein_name": "Olfactory receptor", "gene_name": "Or7a35", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MAAGESIFKGHIKHMEPGNDTQLSEFFLLGFSEKQPEIQPLIFGLFLSMYLVTVTGNLLIIMAIIVDAHLHTPMYIFLSNLSFVDICFTSITVPQMLVNIHTQSKVIIYANCITQVYFLLLFSVLDIFLLTVMAYDRYVAICHPLHYMIIMNTRRCGLLILACWIISVINSLLHTFLVLRLSFCTDLEIPHFYCELNQIVHHACSDISLNDMVIYIAALLLVVGPLSGILYSYSKIVSSICAISSVQGKYKAFSTCASHLSVVSLFYCTLLGVYLSSAVTQNAHATAMASLMYTVVTPMLNPFIYSLRNNDMKKALKIVLGRVTRNRSMDLA", "length": 332 }, "evidence": [ { "id": "45935568", "url": "http://www.informatics.jax.org/homology/45935568", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "O76100-1", "protein_name": "Olfactory receptor 7A10", "gene_name": "OR7A10", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MKSWNNTIILEFLLLGISEEPELQAFLFGLFLSMYLVTVLGNLLIILATISDSHLHTPMYFFLSNLSFVDICFVSTTVPKMLVNIQTHNKVITYAGCITQMCFFLLFVGLDNFLLTVMAYDRFVAICHPLHYMVIMNPQLCGLLVLASWIMSVLNSMLQSLMVLPLPFCTHMEIPHFFCEINQVVHLACSDTFLNDIVMYFAVALLGGGPLTGILYSYSKIVSSIRAISSAQGKYKAFSTCASHLSVVSLFYGTCLGVYLSSAATHNSHTGAAASVMYTVVTPMLNPFIYSLRNKHIKGAMKTFFRGKQ", "length": 309 }, "evidence": [ { "id": "45935567", "url": "http://www.informatics.jax.org/homology/45935567", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q15622-1", "protein_name": "Olfactory receptor 7A5", "gene_name": "OR7A5", "tax_id": 9606, "organism": "Homo sapiens", "sequence": { "sequence": "MEPGNDTQISEFLLLGFSQEPGLQPFLFGLFLSMYLVTVLGNLLIILATISDSHLHTPMYFFLSNLSFADICVTSTTIPKMLMNIQTQNKVITYIACLMQMYFFILFAGFENFLLSVMAYDRFVAICHPLHYMVIMNPHLCGLLVLASWTMSALYSLLQILMVVRLSFCTALEIPHFFCELNQVIQLACSDSFLNHMVIYFTVALLGGGPLTGILYSYSKIISSIHAISSAQGKYKAFSTCASHLSVVSLFYGAILGVYLSSAATRNSHSSATASVMYTVVTPMLNPFIYSLRNKDIKRALGIHLLWGTMKGQFFKKCP", "length": 319 }, "evidence": [ { "id": "45917027", "url": "http://www.informatics.jax.org/homology/45917027", "database": "MGI" }, { "id": "45935567", "url": "http://www.informatics.jax.org/homology/45935567", "database": "MGI" } ], "common_name": "Human" }, { "uniprot_canonical_ac": "Q8VGU6-1", "protein_name": "Olfactory receptor family 7 subfamily A member 35", "gene_name": "Or7a35", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MEPGNDTQLSEFFLLELSENQPQIQPLIFGLFLSMYLVTVTGNLLIIMAITADSHLHTPMYIFLSNLSFVDICFTSTTVPQMLVTIHTQSKAITYANCITQVYFLLLFSVLDIFLLTVMAYDHYVAICHPLHYMIIMNTRRCGLMILACWIIGVINSLLHTFLALRLSFCTDLEIPHFYCELNQVVHHACSDISLNDMVIYIAAMLLVVGPLSGILYSYSKIVSSICAISSVQGKYKAFSTCASHLSVVSLFYCTLLGVYLSSAVTQNAQATALASLMYTVVTPMLNPFIYSLRNNDMKKALKIVLGRVTRNRLTDLPS", "length": 319 }, "evidence": [ { "id": "45935568", "url": "http://www.informatics.jax.org/homology/45935568", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q8VGU7-1", "protein_name": "Olfactory receptor", "gene_name": "Or7a41", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "METGNDTQLSEFFLLGFSENQPQIQPVIFGLFLFMYILTFTGNLLIIMAIIVDSHLHTPMYLFLSNLSFVDICFTSTTVPQMLVNIHTQSKAITYAGCIIQMYFLLLFSGLDIFLLTVMAYDRYVAICHPLHYMIIMSTRRCGLMILACWIIGVINSLLHTFLVLRLSFCTNLEIPHFFCELNQVVHQACSDTFLNDMVIYITAMLLAVGPFSGILYSYSRIVSSICAISSVQGKYKAFSTCASHLSVVSLFYCTLLGVYLSSAVTQNSHATATASLMYTVVTPMLNPFIYSLRNKDIKTALKILLGSVTRSRSMDSPS", "length": 319 }, "evidence": [ { "id": "45917027", "url": "http://www.informatics.jax.org/homology/45917027", "database": "MGI" } ], "common_name": "Mouse" }, { "uniprot_canonical_ac": "Q9JHB2-1", "protein_name": "Olfactory receptor 7A40", "gene_name": "Or7a40", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MELKNDTQISKFILLGISEDPLWQPFLFGLFLFMYLVTLLGNLLIIIATITDSHLHTPMYFFLSNLSFADICFTSASIPKMLVNIQTKNKVITYEGCISQVFFFILFGVLDNFLLAVMAYDRYVAICHPLHYMVIMNCRLCGFLVLGSWVTTALNSLLQSSMALRLSFCTDLKIPHFVCELNQLVLLACNDTFPNDMVMYFAAILLGGGPLAGILYSYSKIVSSIRAISSSQGKYKAFSTCASHLSVVSLFYSTLLGVYLSSSFTQNSHSTARASVMYSVVTPMLNPFIYSLRNKDLMGALRRLLRRKS", "length": 309 }, "evidence": [ { "id": "45935567", "url": "http://www.informatics.jax.org/homology/45935567", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Molecular Function", "total": 2, "go_terms": [ { "name": "G protein-coupled receptor activity", "id": "GO:0004930", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004930", "evidence": [ { "database": "UniProtKB", "id": "O14581", "url": "https://www.uniprot.org/uniprot/O14581" } ], "pmid": "" }, { "name": "olfactory receptor activity", "id": "GO:0004984", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0004984", "evidence": [ { "database": "UniProtKB", "id": "O14581", "url": "https://www.uniprot.org/uniprot/O14581" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 1, "go_terms": [ { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "O14581", "url": "https://www.uniprot.org/uniprot/O14581" } ], "pmid": "" } ] }, { "name": "Biological Process", "total": 1, "go_terms": [ { "name": "signal transduction", "id": "GO:0007165", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007165", "evidence": [ { "database": "UniProtKB", "id": "O14581", "url": "https://www.uniprot.org/uniprot/O14581" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 5, "end_pos": 7, "annotation": "n_glycosylation_sequon" }, { "start_pos": 65, "end_pos": 67, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [ 5 ], "o_linked_sites": [], "snv_sites": [ 5, 7, 271, 302 ], "glycation_sites": [], "phosphorylation_sites": [], "sequon_annotation_sites": [ { "start_pos": 5, "end_pos": 7 }, { "start_pos": 65, "end_pos": 67 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 4 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 6 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }