{ "uniprot_canonical_ac": "O14561-1", "uniprot_ac": "O14561", "uniprot_id": "ACPM_HUMAN", "mass": { "chemical_mass": 17417.0, "monoisotopic_mass": 17417.0 }, "refseq": { "ac": "NP_004994", "name": "acyl carrier protein, mitochondrial precursor", "summary": "", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004994" }, "gene_names": [ { "name": "NDUFAB1", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O14561", "id": "O14561" }, { "name": "ACP; ACP1; FASN2A; SDAP", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004994", "id": "NP_004994" }, { "name": "NDUFAB1", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004994", "id": "NP_004994" } ], "protein_names": [ { "name": "Acyl carrier protein, mitochondrial", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O14561" }, { "name": "ACP", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O14561" }, { "name": "CI-SDAP", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O14561" }, { "name": "NADH-ubiquinone oxidoreductase 9.6 kDa subunit", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O14561" }, { "name": "acyl carrier protein, mitochondrial precursor", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004994", "id": "NP_004994" }, { "name": "mitochondrial acyl carrier protein; complex I SDAP subunit; acyl carrier protein, mitochondrial; NADH:ubiquinone oxidoreductase SDAP subunit; CI-SDAP; NADH-ubiquinone oxidoreductase 9.6 kDa subunit; NADH dehydrogenase (ubiquinone) 1, alpha/beta subcomplex, 1, 8kDa", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004994", "id": "NP_004994" } ], "function": [ { "annotation": "Carrier of the growing fatty acid chain in fatty acid biosynthesis (By similarity) (PubMed:27626371). Accessory and non-catalytic subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which functions in the transfer of electrons from NADH to the respiratory chain (PubMed:27626371). Accessory protein, of the core iron-sulfur cluster (ISC) assembly complex, that regulates, in association with LYRM4, the stability and the cysteine desulfurase activity of NFS1 and participates in the [2Fe-2S] clusters assembly on the scaffolding protein ISCU (PubMed:31664822). The core iron-sulfur cluster (ISC) assembly complex is involved in the de novo synthesis of a [2Fe-2S] cluster, the first step of the mitochondrial iron-sulfur protein biogenesis. This process is initiated by the cysteine desulfurase complex (NFS1:LYRM4:NDUFAB1) that produces persulfide which is delivered on the scaffold protein ISCU in a FXN-dependent manner. Then this complex is stabilized by FDX2 which provides reducing equivalents to accomplish the [2Fe-2S] cluster assembly. Finally, the [2Fe-2S] cluster is transferred from ISCU to chaperone proteins, including HSCB, HSPA9 and GLRX5 (By similarity).", "evidence": [ { "database": "UniProtKB", "id": "O14561", "url": "https://www.uniprot.org/uniprot/O14561#function" }, { "database": "UniProtKB", "id": "P52505", "url": "https://www.uniprot.org/uniprot/P52505#function" }, { "database": "PubMed", "id": "27626371", "url": "https://glygen.org/publication/PubMed/27626371" }, { "database": "PubMed", "id": "31664822", "url": "https://glygen.org/publication/PubMed/31664822" }, { "database": "UniProtKB", "id": "Q9H1K1", "url": "https://www.uniprot.org/uniprot/Q9H1K1#function" } ] }, { "annotation": "Carrier of the growing fatty acid chain in fatty acid biosynthesis.", "evidence": [ { "database": "UniProtKB", "id": "H3BNK3", "url": "https://www.uniprot.org/uniprot/H3BNK3#function" }, { "database": "UniProtKB", "id": "RU000722", "url": "https://www.uniprot.org/uniprot/RU000722#function" }, { "database": "UniProtKB", "id": "I3L505", "url": "https://www.uniprot.org/uniprot/I3L505#function" } ] }, { "annotation": "In this work, the structure of the human mitochondrial ACP-ISD11 heterodimer was determined at 2.0 A resolution.", "evidence": [ { "database": "RefSeq", "id": "NP_004994", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004994" }, { "database": "PubMed", "id": "31664822", "url": "https://glygen.org/publication/PubMed/31664822" } ] }, { "annotation": "Substrate Sequestration and Chain Flipping in Human Mitochondrial Acyl Carrier Protein.", "evidence": [ { "database": "RefSeq", "id": "NP_004994", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004994" }, { "database": "PubMed", "id": "38039071", "url": "https://glygen.org/publication/PubMed/38039071" } ] } ], "disease": [], "snv": [], "mutagenesis": [], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "98.57", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000004779", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000004779" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "98.46", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000004779", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000004779" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "96.95", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000004779", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000004779" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "97.4", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000004779", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000004779" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "97.41", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000004779", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000004779" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "97.72", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000004779", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000004779" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "98.92", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000004779", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000004779" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "97.28", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000004779", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000004779" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "96.71", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000004779", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000004779" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "94.85", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000004779", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000004779" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "96.61", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000004779", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000004779" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "96.42", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000004779", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000004779" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "96.84", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000004779", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000004779" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "up", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O14561", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14561" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "No", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O14561", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14561" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O14561", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14561" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "No", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O14561", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14561" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O14561", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14561" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O14561", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14561" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O14561", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14561" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O14561", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14561" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "No", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O14561", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14561" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "up", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O14561", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14561" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O14561", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14561" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O14561", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14561" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O14561", "url": "https://www.uniprot.org/uniprot/O14561" } ], "common_name": "Human" } ], "gene": [ { "name": "NDUFAB1", "url": "https://www.uniprot.org/uniprot/O14561", "locus": { "chromosome": "16", "start_pos": 23581014, "end_pos": 23596316, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000004779", "url": "https://www.ensembl.org/id/ENSG00000004779" } ] } } ], "crossref": [ { "id": "ENSG00000004779", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000004779", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "CHEMBL2363065", "url": "https://www.ebi.ac.uk/chembldb/target/inspect/CHEMBL2363065", "database": "ChEMBL", "categories": [ "Other" ] }, { "id": "NDUFAB1", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=NDUFAB1", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "4706", "url": "https://www.ncbi.nlm.nih.gov/gene/4706", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "7694", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=7694", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O14561", "url": "https://www.ebi.ac.uk/intact/interactors/id:O14561*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR003231", "url": "https://www.ebi.ac.uk/interpro/entry/IPR003231", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR006162", "url": "https://www.ebi.ac.uk/interpro/entry/IPR006162", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR009081", "url": "https://www.ebi.ac.uk/interpro/entry/IPR009081", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036736", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036736", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "603836", "url": "http://www.omim.org/entry/603836", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O14561", "url": "https://www.nextprot.org/entry/NX_O14561", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "O14561", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14561", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "QYCEAPP", "url": "https://omabrowser.org/oma/group/QYCEAPP/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "180066at2759", "url": "http://www.orthodb.org/?query=180066at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR20863", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR20863", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR20863:SF28", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR20863:SF28", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "2DNW", "url": "https://www.rcsb.org/structure/2DNW", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5OOL", "url": "https://www.rcsb.org/structure/5OOL", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5OOM", "url": "https://www.rcsb.org/structure/5OOM", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5XTB", "url": "https://www.rcsb.org/structure/5XTB", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5XTC", "url": "https://www.rcsb.org/structure/5XTC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5XTD", "url": "https://www.rcsb.org/structure/5XTD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5XTH", "url": "https://www.rcsb.org/structure/5XTH", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "5XTI", "url": "https://www.rcsb.org/structure/5XTI", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "6ODD", "url": "https://www.rcsb.org/structure/6ODD", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7A5H", "url": "https://www.rcsb.org/structure/7A5H", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7A5J", "url": "https://www.rcsb.org/structure/7A5J", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7O9K", "url": "https://www.rcsb.org/structure/7O9K", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7O9M", "url": "https://www.rcsb.org/structure/7O9M", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7ODR", "url": "https://www.rcsb.org/structure/7ODR", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7ODS", "url": "https://www.rcsb.org/structure/7ODS", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7ODT", "url": "https://www.rcsb.org/structure/7ODT", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7OF0", "url": "https://www.rcsb.org/structure/7OF0", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7OF2", "url": "https://www.rcsb.org/structure/7OF2", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7OF3", "url": "https://www.rcsb.org/structure/7OF3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7OF5", "url": "https://www.rcsb.org/structure/7OF5", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7OF7", "url": "https://www.rcsb.org/structure/7OF7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7OI6", "url": "https://www.rcsb.org/structure/7OI6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7OI7", "url": "https://www.rcsb.org/structure/7OI7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7OI8", "url": "https://www.rcsb.org/structure/7OI8", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7OI9", "url": "https://www.rcsb.org/structure/7OI9", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7OIC", "url": "https://www.rcsb.org/structure/7OIC", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7OID", "url": "https://www.rcsb.org/structure/7OID", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7OIE", "url": "https://www.rcsb.org/structure/7OIE", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7PD3", "url": "https://www.rcsb.org/structure/7PD3", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7PO4", "url": "https://www.rcsb.org/structure/7PO4", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7QH6", "url": "https://www.rcsb.org/structure/7QH6", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "7QH7", "url": "https://www.rcsb.org/structure/7QH7", "database": "PDB", "categories": [ "3D Structure" ] }, { "id": "PF00550", "url": "http://pfam.xfam.org/family/PF00550", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O14561", "url": "https://pharos.nih.gov/targets/O14561", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O14561", "url": "http://purl.obolibrary.org/obo/PR_O14561", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-389661", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389661", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-611105", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-611105", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-6799198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6799198", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "R-HSA-77289", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-77289", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_004994", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004994", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "H3BNE8", "url": "https://www.uniprot.org/uniprot/H3BNE8", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H3BNE8-1", "url": "https://www.uniprot.org/uniprot/H3BNE8-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H3BNK3", "url": "https://www.uniprot.org/uniprot/H3BNK3", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "H3BNK3-1", "url": "https://www.uniprot.org/uniprot/H3BNK3-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3L505", "url": "https://www.uniprot.org/uniprot/I3L505", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "I3L505-1", "url": "https://www.uniprot.org/uniprot/I3L505-1", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O14561", "url": "https://www.uniprot.org/uniprot/O14561", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O14561-1", "url": "https://www.uniprot.org/uniprot/O14561-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MASRVLSAYVSRLPAAFAPLPRVRMLAVARPLSTALCSAGTQTRLGTLQPALVLAQVPGRVTQLCRQYSDMPPLTLEGIQDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE", "length": 156, "header": "sp|O14561-1|ACPM_HUMAN Isoform 1 of Acyl carrier protein, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFAB1 PE=1 SV=3 CANONICAL=O14561-1" }, "isoforms": [ { "isoform_ac": "H3BNE8-1", "url": "", "sequence": { "sequence": "MASRVLSAYVSRLPAAFAPLPRVRMLAVARPLSTALCSAGTQTRLGTLQPALVLAQHLLPVSRTPGSNSRKQAK", "length": 74, "header": "tr|H3BNE8-1|H3BNE8_HUMAN Computationally mapped isoform of NADH:ubiquinone oxidoreductase subunit AB1 OS=Homo sapiens OX=9606 GN=NDUFAB1 PE=1 SV=1 CANONICAL=O14561-1" }, "locus": { "chromosome": "16", "start_pos": 23596290, "end_pos": 23595585, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000484769.1", "url": "https://www.ensembl.org/id/ENST00000484769.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000454812.1", "url": "https://www.ensembl.org/id/ENSP00000454812.1" } ] } }, { "isoform_ac": "H3BNK3-1", "url": "", "sequence": { "sequence": "XLSAYVSRLPAAFAPLPRVRMLAVARPLSTALCSAGTQTRLGTLQPALVLAQLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE", "length": 111, "header": "tr|H3BNK3-1|ACPM_HUMAN Computationally mapped isoform of Acyl carrier protein, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFAB1 PE=1 SV=1 CANONICAL=O14561-1" }, "locus": { "chromosome": "16", "start_pos": 23596277, "end_pos": 23582286, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000562133.5", "url": "https://www.ensembl.org/id/ENST00000562133.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000454891.1", "url": "https://www.ensembl.org/id/ENSP00000454891.1" } ] } }, { "isoform_ac": "I3L505-1", "url": "", "sequence": { "sequence": "MPPLTLEGIQDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMC", "length": 70, "header": "tr|I3L505-1|ACPM_HUMAN Computationally mapped isoform of Acyl carrier protein, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFAB1 PE=1 SV=1 CANONICAL=O14561-1" }, "locus": { "chromosome": "16", "start_pos": 23587277, "end_pos": 23582335, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000567761.1", "url": "https://www.ensembl.org/id/ENST00000567761.1" }, { "database": "Ensembl Peptide", "id": "ENSP00000461693.1", "url": "https://www.ensembl.org/id/ENSP00000461693.1" } ] } }, { "isoform_ac": "O14561-1", "url": "", "sequence": { "sequence": "MASRVLSAYVSRLPAAFAPLPRVRMLAVARPLSTALCSAGTQTRLGTLQPALVLAQVPGRVTQLCRQYSDMPPLTLEGIQDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE", "length": 156, "header": "sp|O14561-1|ACPM_HUMAN Isoform 1 of Acyl carrier protein, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFAB1 PE=1 SV=3 CANONICAL=O14561-1" }, "locus": { "chromosome": "16", "start_pos": 23596290, "end_pos": 23582287, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000570319.5", "url": "https://www.ensembl.org/id/ENST00000570319.5" }, { "database": "Ensembl Peptide", "id": "ENSP00000458770.1", "url": "https://www.ensembl.org/id/ENSP00000458770.1" } ] } } ], "glycosylation": [ { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "O14561", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14561" }, { "id": "28510447", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/28510447" } ] } ], "phosphorylation": [ { "start_pos": 38, "end_pos": 38, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O14561", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14561" }, { "database": "PubMed", "id": "21930947", "url": "https://glygen.org/publication/PubMed/21930947" } ], "site_lbl": "Ser38" } ], "glycation": [], "keywords": [ "glycoprotein", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Molecular cloning, structural characterization and chromosomal localization of human lipoyltransferase gene.", "journal": "European journal of biochemistry", "date": "1999", "authors": "Fujiwara K, Suzuki M, Okumachi Y, Okamura-Ikeda K, Fujiwara T, Takahashi E, Motokawa Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-389661", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389661" } ], "reference": [ { "type": "PubMed", "id": "10103005", "url": "https://glygen.org/publication/PubMed/10103005" } ] }, { "title": "Defects in mitochondrial beta-oxidation of fatty acids.", "journal": "Current opinion in lipidology", "date": "1999", "authors": "Wood PA", "evidence": [ { "database": "Reactome", "id": "R-HSA-611105", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-611105" } ], "reference": [ { "type": "PubMed", "id": "10327278", "url": "https://glygen.org/publication/PubMed/10327278" } ] }, { "title": "The gene encoding hydroxypyruvate reductase (GRHPR) is mutated in patients with primary hyperoxaluria type II.", "journal": "Human molecular genetics", "date": "1999", "authors": "Cramer SD, Ferree PM, Lin K, Milliner DS, Holmes RP", "evidence": [ { "database": "Reactome", "id": "R-HSA-389661", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389661" } ], "reference": [ { "type": "PubMed", "id": "10484776", "url": "https://glygen.org/publication/PubMed/10484776" } ] }, { "title": "Identification and expression of a cDNA for human hydroxypyruvate/glyoxylate reductase.", "journal": "Biochimica et biophysica acta", "date": "1999", "authors": "Rumsby G, Cregeen DP", "evidence": [ { "database": "Reactome", "id": "R-HSA-389661", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389661" } ], "reference": [ { "type": "PubMed", "id": "10524214", "url": "https://glygen.org/publication/PubMed/10524214" } ] }, { "title": "Identification and characterization of HAOX1, HAOX2, and HAOX3, three human peroxisomal 2-hydroxy acid oxidases.", "journal": "The Journal of biological chemistry", "date": "2000", "authors": "Jones JM, Morrell JC, Gould SJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-389661", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389661" } ], "reference": [ { "type": "PubMed", "id": "10777549", "url": "https://glygen.org/publication/PubMed/10777549" } ] }, { "title": "Identification and expression of a cDNA for human glycolate oxidase.", "journal": "Biochimica et biophysica acta", "date": "2000", "authors": "Williams E, Cregeen D, Rumsby G", "evidence": [ { "database": "Reactome", "id": "R-HSA-389661", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389661" } ], "reference": [ { "type": "PubMed", "id": "10978532", "url": "https://glygen.org/publication/PubMed/10978532" } ] }, { "title": "Mutations in the complex I NDUFS2 gene of patients with cardiomyopathy and encephalomyopathy.", "journal": "Annals of neurology", "date": "2001", "authors": "Loeffen J, Elpeleg O, Smeitink J, Smeets R, Stockler-Ipsiroglu S, Mandel H, Sengers R, Trijbels F, van den Heuvel L", "evidence": [ { "database": "Reactome", "id": "R-HSA-6799198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6799198" } ], "reference": [ { "type": "PubMed", "id": "11220739", "url": "https://glygen.org/publication/PubMed/11220739" } ] }, { "title": "Do mammalian cells synthesize lipoic acid? Identification of a mouse cDNA encoding a lipoic acid synthase located in mitochondria.", "journal": "FEBS letters", "date": "2001", "authors": "Morikawa T, Yasuno R, Wada H", "evidence": [ { "database": "Reactome", "id": "R-HSA-389661", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389661" } ], "reference": [ { "type": "PubMed", "id": "11389890", "url": "https://glygen.org/publication/PubMed/11389890" } ] }, { "title": "Human NADH:ubiquinone oxidoreductase.", "journal": "Journal of bioenergetics and biomembranes", "date": "2001", "authors": "Smeitink J, Sengers R, Trijbels F, van den Heuvel L", "evidence": [ { "database": "Reactome", "id": "R-HSA-611105", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-611105" } ], "reference": [ { "type": "PubMed", "id": "11695836", "url": "https://glygen.org/publication/PubMed/11695836" } ] }, { "title": "BFIT, a unique acyl-CoA thioesterase induced in thermogenic brown adipose tissue: cloning, organization of the human gene and assessment of a potential link to obesity.", "journal": "The Biochemical journal", "date": "2001", "authors": "Adams SH, Chui C, Schilbach SL, Yu XX, Goddard AD, Grimaldi JC, Lee J, Dowd P, Colman S, Lewin DA", "evidence": [ { "database": "Reactome", "id": "R-HSA-77289", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-77289" } ], "reference": [ { "type": "PubMed", "id": "11696000", "url": "https://glygen.org/publication/PubMed/11696000" } ] }, { "title": "The energy-transducing NADH: quinone oxidoreductase, complex I.", "journal": "Molecular aspects of medicine", "date": "2002", "authors": "Yano T", "evidence": [ { "database": "Reactome", "id": "R-HSA-611105", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-611105" } ], "reference": [ { "type": "PubMed", "id": "12231006", "url": "https://glygen.org/publication/PubMed/12231006" } ] }, { "title": "The subunit composition of the human NADH dehydrogenase obtained by rapid one-step immunopurification.", "journal": "J. Biol. Chem.", "date": "2003", "authors": "Murray J, Zhang B, Taylor SW, Oglesbee D, Fahy E, Marusich MF, Ghosh SS, Capaldi RA", "evidence": [ { "database": "UniProtKB", "id": "O14561", "url": "https://www.uniprot.org/uniprot/O14561" } ], "reference": [ { "type": "PubMed", "id": "12611891", "url": "https://glygen.org/publication/PubMed/12611891" } ] }, { "title": "The nuclear encoded subunits of complex I from bovine heart mitochondria.", "journal": "Biochimica et biophysica acta", "date": "2003", "authors": "Hirst J, Carroll J, Fearnley IM, Shannon RJ, Walker JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-611105", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-611105" } ], "reference": [ { "type": "PubMed", "id": "12837546", "url": "https://glygen.org/publication/PubMed/12837546" } ] }, { "title": "Proteomic analysis of the mouse liver mitochondrial inner membrane.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Da Cruz S, Xenarios I, Langridge J, Vilbois F, Parone PA, Martinou JC", "evidence": [ { "database": "Reactome", "id": "R-HSA-389661", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389661" } ], "reference": [ { "type": "PubMed", "id": "12865426", "url": "https://glygen.org/publication/PubMed/12865426" } ] }, { "title": "Cloning, expression, characterization, and interaction of two components of a human mitochondrial fatty acid synthase. Malonyltransferase and acyl carrier protein.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Zhang L, Joshi AK, Smith S", "evidence": [ { "database": "Reactome", "id": "R-HSA-77289", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-77289" } ], "reference": [ { "type": "PubMed", "id": "12882974", "url": "https://glygen.org/publication/PubMed/12882974" } ] }, { "title": "Crystal structure of alanine:glyoxylate aminotransferase and the relationship between genotype and enzymatic phenotype in primary hyperoxaluria type 1.", "journal": "Journal of molecular biology", "date": "2003", "authors": "Zhang X, Roe SM, Hou Y, Bartlam M, Rao Z, Pearl LH, Danpure CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-389661", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389661" } ], "reference": [ { "type": "PubMed", "id": "12899834", "url": "https://glygen.org/publication/PubMed/12899834" } ] }, { "title": "Saturation kinetics of coenzyme Q in NADH and succinate oxidation in beef heart mitochondria.", "journal": "FEBS letters", "date": "1992", "authors": "Estornell E, Fato R, Castelluccio C, Cavazzoni M, Parenti Castelli G, Lenaz G", "evidence": [ { "database": "Reactome", "id": "R-HSA-611105", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-611105" } ], "reference": [ { "type": "PubMed", "id": "1327877", "url": "https://glygen.org/publication/PubMed/1327877" } ] }, { "title": "Hydroxyproline metabolism. II. Enzymatic preparation and properties of Delta 1-pyrroline-3-hydroxy-5-carboxylic acid.", "journal": "The Journal of biological chemistry", "date": "1960", "authors": "ADAMS E, GOLDSTONE A", "evidence": [ { "database": "Reactome", "id": "R-HSA-389661", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389661" } ], "reference": [ { "type": "PubMed", "id": "13681368", "url": "https://glygen.org/publication/PubMed/13681368" } ] }, { "title": "Hydroxyproline metabolism. IV. Enzymatic synthesis of gamma-hydroxyglutamate from Delta 1-pyrroline-3-hydroxy-5-carboxylate.", "journal": "The Journal of biological chemistry", "date": "1960", "authors": "ADAMS E, GOLDSTONE A", "evidence": [ { "database": "Reactome", "id": "R-HSA-389661", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389661" } ], "reference": [ { "type": "PubMed", "id": "13681370", "url": "https://glygen.org/publication/PubMed/13681370" } ] }, { "title": "PURIFICATION OF RAT-LIVER GAMMA-HYDROXYGLUTAMATE TRANSAMINASE AND ITS PROBABLE IDENTITY WITH GLUTAMATE-ASPARTATE TRANSAMINASE.", "journal": "Biochimica et biophysica acta", "date": "1964", "authors": "MAITRA U, DEEKKER E", "evidence": [ { "database": "Reactome", "id": "R-HSA-389661", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389661" } ], "reference": [ { "type": "PubMed", "id": "14170323", "url": "https://glygen.org/publication/PubMed/14170323" } ] }, { "title": "PURIFICATION AND PROPERTIES OF RAT LIVER 2-KETO-4-HYDROXYGLUTARATE ALDOLASE.", "journal": "The Journal of biological chemistry", "date": "1964", "authors": "MAITRA U, DEKKER EE", "evidence": [ { "database": "Reactome", "id": "R-HSA-389661", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389661" } ], "reference": [ { "type": "PubMed", "id": "14193832", "url": "https://glygen.org/publication/PubMed/14193832" } ] }, { "title": "The gross structure of the respiratory complex I: a Lego System.", "journal": "Biochimica et biophysica acta", "date": "2004", "authors": "Friedrich T, Bottcher B", "evidence": [ { "database": "Reactome", "id": "R-HSA-611105", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-611105" } ], "reference": [ { "type": "PubMed", "id": "14741580", "url": "https://glygen.org/publication/PubMed/14741580" } ] }, { "title": "Structural organization of mitochondrial human complex I: role of the ND4 and ND5 mitochondria-encoded subunits and interaction with prohibitin.", "journal": "The Biochemical journal", "date": "2004", "authors": "Bourges I, Ramus C, Mousson de Camaret B, Beugnot R, Remacle C, Cardol P, Hofhaus G, Issartel JP", "evidence": [ { "database": "Reactome", "id": "R-HSA-611105", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-611105" } ], "reference": [ { "type": "PubMed", "id": "15250827", "url": "https://glygen.org/publication/PubMed/15250827" } ] }, { "title": "Glycine N-methyltransferases: a comparison of the crystal structures and kinetic properties of recombinant human, mouse and rat enzymes.", "journal": "Proteins", "date": "2004", "authors": "Pakhomova S, Luka Z, Grohmann S, Wagner C, Newcomer ME", "evidence": [ { "database": "Reactome", "id": "R-HSA-389661", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389661" } ], "reference": [ { "type": "PubMed", "id": "15340920", "url": "https://glygen.org/publication/PubMed/15340920" } ] }, { "title": "Identification of fatty acid oxidation disorder patients with lowered acyl-CoA thioesterase activity in human skin fibroblasts.", "journal": "European journal of clinical investigation", "date": "2005", "authors": "Hunt MC, Ruiter J, Mooyer P, van Roermond CW, Ofman R, Ijlst L, Wanders RJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-77289", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-77289" } ], "reference": [ { "type": "PubMed", "id": "15638818", "url": "https://glygen.org/publication/PubMed/15638818" } ] }, { "title": "Overexpression of human alanine:glyoxylate aminotransferase in Escherichia coli: renaturation from guanidine-HCl and affinity for pyridoxal phosphate co-factor.", "journal": "Protein expression and purification", "date": "2005", "authors": "Coulter-Mackie MB, Lian Q, Wong SG", "evidence": [ { "database": "Reactome", "id": "R-HSA-389661", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389661" } ], "reference": [ { "type": "PubMed", "id": "15802217", "url": "https://glygen.org/publication/PubMed/15802217" } ] }, { "title": "The primary structure of the flavoprotein D-aspartate oxidase from beef kidney.", "journal": "The Journal of biological chemistry", "date": "1992", "authors": "Negri A, Ceciliani F, Tedeschi G, Simonic T, Ronchi S", "evidence": [ { "database": "Reactome", "id": "R-HSA-389661", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389661" } ], "reference": [ { "type": "PubMed", "id": "1601857", "url": "https://glygen.org/publication/PubMed/1601857" } ] }, { "title": "The Saccharomyces cerevisiae COQ10 gene encodes a START domain protein required for function of coenzyme Q in respiration.", "journal": "The Journal of biological chemistry", "date": "2005", "authors": "Barros MH, Johnson A, Gin P, Marbois BN, Clarke CF, Tzagoloff A", "evidence": [ { "database": "Reactome", "id": "R-HSA-611105", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-611105" } ], "reference": [ { "type": "PubMed", "id": "16230336", "url": "https://glygen.org/publication/PubMed/16230336" } ] }, { "title": "A functional variant in the transcriptional regulatory region of gene LOC344967 cosegregates with disease phenotype in familial nasopharyngeal carcinoma.", "journal": "Cancer research", "date": "2006", "authors": "Jiang RC, Qin HD, Zeng MS, Huang W, Feng BJ, Zhang F, Chen HK, Jia WH, Chen LZ, Feng QS, Zhang RH, Yu XJ, Zheng MZ, Zeng YX", "evidence": [ { "database": "Reactome", "id": "R-HSA-77289", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-77289" } ], "reference": [ { "type": "PubMed", "id": "16423998", "url": "https://glygen.org/publication/PubMed/16423998" } ] }, { "title": "Characterization of human D-amino acid oxidase.", "journal": "FEBS letters", "date": "2006", "authors": "Molla G, Sacchi S, Bernasconi M, Pilone MS, Fukui K, Polegioni L", "evidence": [ { "database": "Reactome", "id": "R-HSA-389661", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389661" } ], "reference": [ { "type": "PubMed", "id": "16616139", "url": "https://glygen.org/publication/PubMed/16616139" } ] }, { "title": "Crystal structure of human thioesterase superfamily member 2.", "journal": "Biochemical and biophysical research communications", "date": "2006", "authors": "Cheng Z, Song F, Shan X, Wei Z, Wang Y, Dunaway-Mariano D, Gong W", "evidence": [ { "database": "Reactome", "id": "R-HSA-77289", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-77289" } ], "reference": [ { "type": "PubMed", "id": "16934754", "url": "https://glygen.org/publication/PubMed/16934754" } ] }, { "title": "Analysis of the mouse and human acyl-CoA thioesterase (ACOT) gene clusters shows that convergent, functional evolution results in a reduced number of human peroxisomal ACOTs.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2006", "authors": "Hunt MC, Rautanen A, Westin MA, Svensson LT, Alexson SE", "evidence": [ { "database": "Reactome", "id": "R-HSA-77289", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-77289" } ], "reference": [ { "type": "PubMed", "id": "16940157", "url": "https://glygen.org/publication/PubMed/16940157" } ] }, { "title": "Identification of mutations associated with peroxisome-to-mitochondrion mistargeting of alanine/glyoxylate aminotransferase in primary hyperoxaluria type 1.", "journal": "The Journal of cell biology", "date": "1990", "authors": "Purdue PE, Takada Y, Danpure CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-389661", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389661" } ], "reference": [ { "type": "PubMed", "id": "1703535", "url": "https://glygen.org/publication/PubMed/1703535" } ] }, { "title": "Crystal structure of human D-amino acid oxidase: context-dependent variability of the backbone conformation of the VAAGL hydrophobic stretch located at the si-face of the flavin ring.", "journal": "Protein science : a publication of the Protein Society", "date": "2006", "authors": "Kawazoe T, Tsuge H, Pilone MS, Fukui K", "evidence": [ { "database": "Reactome", "id": "R-HSA-389661", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389661" } ], "reference": [ { "type": "PubMed", "id": "17088322", "url": "https://glygen.org/publication/PubMed/17088322" } ] }, { "title": "Purification and characterization of recombinant human liver glycolate oxidase.", "journal": "Archives of biochemistry and biophysics", "date": "2007", "authors": "Vignaud C, Pietrancosta N, Williams EL, Rumsby G, Lederer F", "evidence": [ { "database": "Reactome", "id": "R-HSA-389661", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389661" } ], "reference": [ { "type": "PubMed", "id": "17669354", "url": "https://glygen.org/publication/PubMed/17669354" } ] }, { "title": "Evidence for 26 distinct acyl-coenzyme A synthetase genes in the human genome.", "journal": "Journal of lipid research", "date": "2007", "authors": "Watkins PA, Maiguel D, Jia Z, Pevsner J", "evidence": [ { "database": "Reactome", "id": "R-HSA-77289", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-77289" } ], "reference": [ { "type": "PubMed", "id": "17762044", "url": "https://glygen.org/publication/PubMed/17762044" } ] }, { "title": "Acyl-CoA-binding protein (ACBP) localizes to the endoplasmic reticulum and Golgi in a ligand-dependent manner in mammalian cells.", "journal": "The Biochemical journal", "date": "2008", "authors": "Hansen JS, Faergeman NJ, Kragelund BB, Knudsen J", "evidence": [ { "database": "Reactome", "id": "R-HSA-77289", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-77289" } ], "reference": [ { "type": "PubMed", "id": "17953517", "url": "https://glygen.org/publication/PubMed/17953517" } ] }, { "title": "Active site and loop 4 movements within human glycolate oxidase: implications for substrate specificity and drug design.", "journal": "Biochemistry", "date": "2008", "authors": "Murray MS, Holmes RP, Lowther WT", "evidence": [ { "database": "Reactome", "id": "R-HSA-389661", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389661" } ], "reference": [ { "type": "PubMed", "id": "18215067", "url": "https://glygen.org/publication/PubMed/18215067" } ] }, { "title": "Characterization of an acyl-coenzyme A binding protein predominantly expressed in human primitive progenitor cells.", "journal": "Journal of lipid research", "date": "2008", "authors": "Soupene E, Serikov V, Kuypers FA", "evidence": [ { "database": "Reactome", "id": "R-HSA-77289", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-77289" } ], "reference": [ { "type": "PubMed", "id": "18268358", "url": "https://glygen.org/publication/PubMed/18268358" } ] }, { "title": "Possible molecular mechanisms of the protonmotive function of cytochrome systems.", "journal": "Journal of theoretical biology", "date": "1976", "authors": "Mitchell P", "evidence": [ { "database": "Reactome", "id": "R-HSA-611105", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-611105" } ], "reference": [ { "type": "PubMed", "id": "186667", "url": "https://glygen.org/publication/PubMed/186667" } ] }, { "title": "The mechanisms of human hotdog-fold thioesterase 2 (hTHEM2) substrate recognition and catalysis illuminated by a structure and function based analysis.", "journal": "Biochemistry", "date": "2009", "authors": "Cao J, Xu H, Zhao H, Gong W, Dunaway-Mariano D", "evidence": [ { "database": "Reactome", "id": "R-HSA-77289", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-77289" } ], "reference": [ { "type": "PubMed", "id": "19170545", "url": "https://glygen.org/publication/PubMed/19170545" } ] }, { "title": "Pxmp2 is a channel-forming protein in Mammalian peroxisomal membrane.", "journal": "PloS one", "date": "2009", "authors": "Rokka A, Antonenkov VD, Soininen R, Immonen HL, Pirila PL, Bergmann U, Sormunen RT, Weckstrom M, Benz R, Hiltunen JK", "evidence": [ { "database": "Reactome", "id": "R-HSA-389661", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389661" } ], "reference": [ { "type": "PubMed", "id": "19352492", "url": "https://glygen.org/publication/PubMed/19352492" } ] }, { "title": "Lipoic acid synthesis and attachment in yeast mitochondria.", "journal": "The Journal of biological chemistry", "date": "2009", "authors": "Schonauer MS, Kastaniotis AJ, Kursu VA, Hiltunen JK, Dieckmann CL", "evidence": [ { "database": "Reactome", "id": "R-HSA-389661", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389661" } ], "reference": [ { "type": "PubMed", "id": "19570983", "url": "https://glygen.org/publication/PubMed/19570983" } ] }, { "title": "Human ind1, an iron-sulfur cluster assembly factor for respiratory complex I.", "journal": "Molecular and cellular biology", "date": "2009", "authors": "Sheftel AD, Stehling O, Pierik AJ, Netz DJ, Kerscher S, Elsasser HP, Wittig I, Balk J, Brandt U, Lill R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6799198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6799198" } ], "reference": [ { "type": "PubMed", "id": "19752196", "url": "https://glygen.org/publication/PubMed/19752196" } ] }, { "title": "Global profiling of protease cleavage sites by chemoselective labeling of protein N-termini.", "journal": "Proc. Natl. Acad. Sci. U.S.A.", "date": "2009", "authors": "Xu Guoqiang, Shin Sung Bin Y, Jaffrey Samie R", "evidence": [ { "database": "UniProtKB", "id": "O14561", "url": "https://www.uniprot.org/uniprot/O14561" } ], "reference": [ { "type": "PubMed", "id": "19892738", "url": "https://glygen.org/publication/PubMed/19892738" } ] }, { "title": "Human alanine-glyoxylate aminotransferase 2 lowers asymmetric dimethylarginine and protects from inhibition of nitric oxide production.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Rodionov RN, Murry DJ, Vaulman SF, Stevens JW, Lentz SR", "evidence": [ { "database": "Reactome", "id": "R-HSA-389661", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389661" } ], "reference": [ { "type": "PubMed", "id": "20018850", "url": "https://glygen.org/publication/PubMed/20018850" } ] }, { "title": "PC-TP/StARD2: Of membranes and metabolism.", "journal": "Trends in endocrinology and metabolism: TEM", "date": "2010", "authors": "Kang HW, Wei J, Cohen DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-77289", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-77289" } ], "reference": [ { "type": "PubMed", "id": "20338778", "url": "https://glygen.org/publication/PubMed/20338778" } ] }, { "title": "MidA is a putative methyltransferase that is required for mitochondrial complex I function.", "journal": "Journal of cell science", "date": "2010", "authors": "Carilla-Latorre S, Gallardo ME, Annesley SJ, Calvo-Garrido J, Grana O, Accari SL, Smith PK, Valencia A, Garesse R, Fisher PR, Escalante R", "evidence": [ { "database": "Reactome", "id": "R-HSA-6799198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6799198" } ], "reference": [ { "type": "PubMed", "id": "20406883", "url": "https://glygen.org/publication/PubMed/20406883" } ] }, { "title": "Functional and structural properties of mammalian acyl-coenzyme A thioesterases.", "journal": "Progress in lipid research", "date": "2010", "authors": "Kirkby B, Roman N, Kobe B, Kellie S, Forwood JK", "evidence": [ { "database": "Reactome", "id": "R-HSA-77289", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-77289" } ], "reference": [ { "type": "PubMed", "id": "20470824", "url": "https://glygen.org/publication/PubMed/20470824" } ] }, { "title": "Assembly factors of human mitochondrial complex I and their defects in disease.", "journal": "IUBMB life", "date": "2010", "authors": "Mckenzie M, Ryan MT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6799198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6799198" } ], "reference": [ { "type": "PubMed", "id": "20552642", "url": "https://glygen.org/publication/PubMed/20552642" } ] }, { "title": "Thiolactomycin inhibits D-aspartate oxidase: a novel approach to probing the active site environment.", "journal": "Biochimie", "date": "2010", "authors": "Katane M, Saitoh Y, Hanai T, Sekine M, Furuchi T, Koyama N, Nakagome I, Tomoda H, Hirono S, Homma H", "evidence": [ { "database": "Reactome", "id": "R-HSA-389661", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389661" } ], "reference": [ { "type": "PubMed", "id": "20603179", "url": "https://glygen.org/publication/PubMed/20603179" } ] }, { "title": "Identification and characterization of new long chain acyl-CoA dehydrogenases.", "journal": "Molecular genetics and metabolism", "date": "2011", "authors": "He M, Pei Z, Mohsen AW, Watkins P, Murdoch G, Van Veldhoven PP, Ensenauer R, Vockley J", "evidence": [ { "database": "Reactome", "id": "R-HSA-77289", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-77289" } ], "reference": [ { "type": "PubMed", "id": "21237683", "url": "https://glygen.org/publication/PubMed/21237683" } ] }, { "title": "Purification, characterization and inhibition of D-3-aminoisobutyrate aminotransferase from the rat liver.", "journal": "European journal of biochemistry", "date": "1990", "authors": "Tamaki N, Kaneko M, Mizota C, Kikugawa M, Fujimoto S", "evidence": [ { "database": "Reactome", "id": "R-HSA-389661", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389661" } ], "reference": [ { "type": "PubMed", "id": "2158891", "url": "https://glygen.org/publication/PubMed/2158891" } ] }, { "title": "Understanding mitochondrial complex I assembly in health and disease.", "journal": "Biochimica et biophysica acta", "date": "2012", "authors": "Mimaki M, Wang X, McKenzie M, Thorburn DR, Ryan MT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6799198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6799198" } ], "reference": [ { "type": "PubMed", "id": "21924235", "url": "https://glygen.org/publication/PubMed/21924235" } ] }, { "title": "Remote control of regioselectivity in acyl-acyl carrier protein-desaturases.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2011-10-04", "authors": "Guy Jodie E, Whittle Edward, Moche Martin, Lengqvist Johan, Lindqvist Ylva, Shanklin John", "evidence": [ { "database": "iPTMnet", "id": "O14561", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14561" } ], "reference": [ { "type": "PubMed", "id": "21930947", "url": "https://glygen.org/publication/PubMed/21930947" } ] }, { "title": "Structural and biochemical studies of human 4-hydroxy-2-oxoglutarate aldolase: implications for hydroxyproline metabolism in primary hyperoxaluria.", "journal": "PloS one", "date": "2011", "authors": "Riedel TJ, Johnson LC, Knight J, Hantgan RR, Holmes RP, Lowther WT", "evidence": [ { "database": "Reactome", "id": "R-HSA-389661", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389661" } ], "reference": [ { "type": "PubMed", "id": "21998747", "url": "https://glygen.org/publication/PubMed/21998747" } ] }, { "title": "Lipoic acid synthetase deficiency causes neonatal-onset epilepsy, defective mitochondrial energy metabolism, and glycine elevation.", "journal": "American journal of human genetics", "date": "2011", "authors": "Mayr JA, Zimmermann FA, Fauth C, Bergheim C, Meierhofer D, Radmayr D, Zschocke J, Koch J, Sperl W", "evidence": [ { "database": "Reactome", "id": "R-HSA-389661", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389661" } ], "reference": [ { "type": "PubMed", "id": "22152680", "url": "https://glygen.org/publication/PubMed/22152680" } ] }, { "title": "The emerging role of acyl-CoA thioesterases and acyltransferases in regulating peroxisomal lipid metabolism.", "journal": "Biochimica et biophysica acta", "date": "2012", "authors": "Hunt MC, Siponen MI, Alexson SE", "evidence": [ { "database": "Reactome", "id": "R-HSA-77289", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-77289" } ], "reference": [ { "type": "PubMed", "id": "22465940", "url": "https://glygen.org/publication/PubMed/22465940" } ] }, { "title": "The three-dimensional structural basis of type II hyperprolinemia.", "journal": "Journal of molecular biology", "date": "2012", "authors": "Srivastava D, Singh RK, Moxley MA, Henzl MT, Becker DF, Tanner JJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-389661", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389661" } ], "reference": [ { "type": "PubMed", "id": "22516612", "url": "https://glygen.org/publication/PubMed/22516612" } ] }, { "title": "Acyl coenzyme A thioesterase Them5/Acot15 is involved in cardiolipin remodeling and fatty liver development.", "journal": "Molecular and cellular biology", "date": "2012", "authors": "Zhuravleva E, Gut H, Hynx D, Marcellin D, Bleck CK, Genoud C, Cron P, Keusch JJ, Dummler B, Esposti MD, Hemmings BA", "evidence": [ { "database": "Reactome", "id": "R-HSA-77289", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-77289" } ], "reference": [ { "type": "PubMed", "id": "22586271", "url": "https://glygen.org/publication/PubMed/22586271" } ] }, { "title": "Correlation of structure and function in the human hotdog-fold enzyme hTHEM4.", "journal": "Biochemistry", "date": "2012", "authors": "Zhao H, Lim K, Choudry A, Latham JA, Pathak MC, Dominguez D, Luo L, Herzberg O, Dunaway-Mariano D", "evidence": [ { "database": "Reactome", "id": "R-HSA-77289", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-77289" } ], "reference": [ { "type": "PubMed", "id": "22871024", "url": "https://glygen.org/publication/PubMed/22871024" } ] }, { "title": "The radical-binding lipocalin A1M binds to a Complex I subunit and protects mitochondrial structure and function.", "journal": "Antioxid. Redox Signal.", "date": "2013", "authors": "Olsson Magnus G, Rosenl\u00f6f Lena W, Kotarsky Heike, Olofsson Tor, Leanderson Tomas, M\u00f6rgelin Matthias, Fellman Vineta, \u00c5kerstr\u00f6m Bo", "evidence": [ { "database": "UniProtKB", "id": "O14561", "url": "https://www.uniprot.org/uniprot/O14561" } ], "reference": [ { "type": "PubMed", "id": "23157686", "url": "https://glygen.org/publication/PubMed/23157686" } ] }, { "title": "A conserved START domain coenzyme Q-binding polypeptide is required for efficient Q biosynthesis, respiratory electron transport, and antioxidant function in Saccharomyces cerevisiae.", "journal": "Biochimica et biophysica acta", "date": "2013", "authors": "Allan CM, Hill S, Morvaridi S, Saiki R, Johnson JS, Liau WS, Hirano K, Kawashima T, Ji Z, Loo JA, Shepherd JN, Clarke CF", "evidence": [ { "database": "Reactome", "id": "R-HSA-611105", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-611105" } ], "reference": [ { "type": "PubMed", "id": "23270816", "url": "https://glygen.org/publication/PubMed/23270816" } ] }, { "title": "NUBPL mutations in patients with complex I deficiency and a distinct MRI pattern.", "journal": "Neurology", "date": "2013", "authors": "Kevelam SH, Rodenburg RJ, Wolf NI, Ferreira P, Lunsing RJ, Nijtmans LG, Mitchell A, Arroyo HA, Rating D, Vanderver A, van Berkel CG, Abbink TE, Heutink P, van der Knaap MS", "evidence": [ { "database": "Reactome", "id": "R-HSA-6799198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6799198" } ], "reference": [ { "type": "PubMed", "id": "23553477", "url": "https://glygen.org/publication/PubMed/23553477" } ] }, { "title": "Molecular chaperone TRAP1 regulates a metabolic switch between mitochondrial respiration and aerobic glycolysis.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2013", "authors": "Yoshida S, Tsutsumi S, Muhlebach G, Sourbier C, Lee MJ, Lee S, Vartholomaiou E, Tatokoro M, Beebe K, Miyajima N, Mohney RP, Chen Y, Hasumi H, Xu W, Fukushima H, Nakamura K, Koga F, Kihara K, Trepel J, Picard D, Neckers L", "evidence": [ { "database": "Reactome", "id": "R-HSA-611105", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-611105" } ], "reference": [ { "type": "PubMed", "id": "23564345", "url": "https://glygen.org/publication/PubMed/23564345" } ] }, { "title": "Human peroxisomal L-alanine: glyoxylate aminotransferase. Evolutionary loss of a mitochondrial targeting signal by point mutation of the initiation codon.", "journal": "The Biochemical journal", "date": "1990", "authors": "Takada Y, Kaneko N, Esumi H, Purdue PE, Danpure CJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-389661", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389661" } ], "reference": [ { "type": "PubMed", "id": "2363689", "url": "https://glygen.org/publication/PubMed/2363689" } ] }, { "title": "New players on the metabolic stage: How do you like Them Acots?", "journal": "Adipocyte", "date": "2013", "authors": "Cohen DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-77289", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-77289" } ], "reference": [ { "type": "PubMed", "id": "23700546", "url": "https://glygen.org/publication/PubMed/23700546" } ] }, { "title": "The mitochondrial chaperone TRAP1 promotes neoplastic growth by inhibiting succinate dehydrogenase.", "journal": "Cell metabolism", "date": "2013", "authors": "Sciacovelli M, Guzzo G, Morello V, Frezza C, Zheng L, Nannini N, Calabrese F, Laudiero G, Esposito F, Landriscina M, Defilippi P, Bernardi P, Rasola A", "evidence": [ { "database": "Reactome", "id": "R-HSA-611105", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-611105" } ], "reference": [ { "type": "PubMed", "id": "23747254", "url": "https://glygen.org/publication/PubMed/23747254" } ] }, { "title": "Phosphatidylcholine transfer protein interacts with thioesterase superfamily member 2 to attenuate insulin signaling.", "journal": "Science signaling", "date": "2013", "authors": "Ersoy BA, Tarun A, D'Aquino K, Hancer NJ, Ukomadu C, White MF, Michel T, Manning BD, Cohen DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-77289", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-77289" } ], "reference": [ { "type": "PubMed", "id": "23901139", "url": "https://glygen.org/publication/PubMed/23901139" } ] }, { "title": "Protonmotive redox mechanism of the cytochrome b-c1 complex in the respiratory chain: protonmotive ubiquinone cycle.", "journal": "FEBS letters", "date": "1975", "authors": "Mitchell P", "evidence": [ { "database": "Reactome", "id": "R-HSA-611105", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-611105" } ], "reference": [ { "type": "PubMed", "id": "239860", "url": "https://glygen.org/publication/PubMed/239860" } ] }, { "title": "Acyl-CoA binding protein and epidermal barrier function.", "journal": "Biochimica et biophysica acta", "date": "2014", "authors": "Bloksgaard M, Neess D, Faergeman NJ, Mandrup S", "evidence": [ { "database": "Reactome", "id": "R-HSA-77289", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-77289" } ], "reference": [ { "type": "PubMed", "id": "24080521", "url": "https://glygen.org/publication/PubMed/24080521" } ] }, { "title": "Assembly factors for the membrane arm of human complex I.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2013", "authors": "Andrews B, Carroll J, Ding S, Fearnley IM, Walker JE", "evidence": [ { "database": "Reactome", "id": "R-HSA-6799198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6799198" } ], "reference": [ { "type": "PubMed", "id": "24191001", "url": "https://glygen.org/publication/PubMed/24191001" } ] }, { "title": "Mutations in the lipoyltransferase LIPT1 gene cause a fatal disease associated with a specific lipoylation defect of the 2-ketoacid dehydrogenase complexes.", "journal": "Human molecular genetics", "date": "2014", "authors": "Tort F, Ferrer-Cortes X, Thio M, Navarro-Sastre A, Matalonga L, Quintana E, Bujan N, Arias A, Garcia-Villoria J, Acquaviva C, Vianey-Saban C, Artuch R, Garcia-Cazorla A, Briones P, Ribes A", "evidence": [ { "database": "Reactome", "id": "R-HSA-389661", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389661" } ], "reference": [ { "type": "PubMed", "id": "24256811", "url": "https://glygen.org/publication/PubMed/24256811" } ] }, { "title": "Mutations in human lipoyltransferase gene LIPT1 cause a Leigh disease with secondary deficiency for pyruvate and alpha-ketoglutarate dehydrogenase.", "journal": "Orphanet journal of rare diseases", "date": "2013", "authors": "Soreze Y, Boutron A, Habarou F, Barnerias C, Nonnenmacher L, Delpech H, Mamoune A, Chretien D, Hubert L, Bole-Feysot C, Nitschke P, Correia I, Sardet C, Boddaert N, Hamel Y, Delahodde A, Ottolenghi C, de Lonlay P", "evidence": [ { "database": "Reactome", "id": "R-HSA-389661", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389661" } ], "reference": [ { "type": "PubMed", "id": "24341803", "url": "https://glygen.org/publication/PubMed/24341803" } ] }, { "title": "Thioesterase superfamily member 2 (Them2) and phosphatidylcholine transfer protein (PC-TP) interact to promote fatty acid oxidation and control glucose utilization.", "journal": "Molecular and cellular biology", "date": "2014", "authors": "Kawano Y, Ersoy BA, Li Y, Nishiumi S, Yoshida M, Cohen DE", "evidence": [ { "database": "Reactome", "id": "R-HSA-77289", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-77289" } ], "reference": [ { "type": "PubMed", "id": "24732803", "url": "https://glygen.org/publication/PubMed/24732803" } ] }, { "title": "Structural basis for regulation of the human acetyl-CoA thioesterase 12 and interactions with the steroidogenic acute regulatory protein-related lipid transfer (START) domain.", "journal": "The Journal of biological chemistry", "date": "2014", "authors": "Swarbrick CM, Roman N, Cowieson N, Patterson EI, Nanson J, Siponen MI, Berglund H, Lehtio L, Forwood JK", "evidence": [ { "database": "Reactome", "id": "R-HSA-77289", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-77289" } ], "reference": [ { "type": "PubMed", "id": "25002576", "url": "https://glygen.org/publication/PubMed/25002576" } ] }, { "title": "Inhibition of succinate dehydrogenase by the mitochondrial chaperone TRAP1 has anti-oxidant and anti-apoptotic effects on tumor cells.", "journal": "Oncotarget", "date": "2014", "authors": "Guzzo G, Sciacovelli M, Bernardi P, Rasola A", "evidence": [ { "database": "Reactome", "id": "R-HSA-611105", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-611105" } ], "reference": [ { "type": "PubMed", "id": "25564869", "url": "https://glygen.org/publication/PubMed/25564869" } ] }, { "title": "Proline dehydrogenase 2 (PRODH2) is a hydroxyproline dehydrogenase (HYPDH) and molecular target for treating primary hyperoxaluria.", "journal": "The Biochemical journal", "date": "2015", "authors": "Summitt CB, Johnson LC, Jonsson TJ, Parsonage D, Holmes RP, Lowther WT", "evidence": [ { "database": "Reactome", "id": "R-HSA-389661", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389661" } ], "reference": [ { "type": "PubMed", "id": "25697095", "url": "https://glygen.org/publication/PubMed/25697095" } ] }, { "title": "Characterization of the enzymatic and structural properties of human D-aspartate oxidase and comparison with those of the rat and mouse enzymes.", "journal": "Biological & pharmaceutical bulletin", "date": "2015", "authors": "Katane M, Kawata T, Nakayama K, Saitoh Y, Kaneko Y, Matsuda S, Saitoh Y, Miyamoto T, Sekine M, Homma H", "evidence": [ { "database": "Reactome", "id": "R-HSA-389661", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389661" } ], "reference": [ { "type": "PubMed", "id": "25747990", "url": "https://glygen.org/publication/PubMed/25747990" } ] }, { "title": "Ligand binding to the ACBD6 protein regulates the acyl-CoA transferase reactions in membranes.", "journal": "Journal of lipid research", "date": "2015", "authors": "Soupene E, Kuypers FA", "evidence": [ { "database": "Reactome", "id": "R-HSA-77289", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-77289" } ], "reference": [ { "type": "PubMed", "id": "26290611", "url": "https://glygen.org/publication/PubMed/26290611" } ] }, { "title": "Metabolic Interplay between Peroxisomes and Other Subcellular Organelles Including Mitochondria and the Endoplasmic Reticulum.", "journal": "Frontiers in cell and developmental biology", "date": "2015", "authors": "Wanders RJ, Waterham HR, Ferdinandusse S", "evidence": [ { "database": "Reactome", "id": "R-HSA-389661", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389661" } ], "reference": [ { "type": "PubMed", "id": "26858947", "url": "https://glygen.org/publication/PubMed/26858947" } ] }, { "title": "Mitochondrial protein interaction mapping identifies regulators of respiratory chain function.", "journal": "Mol. Cell", "date": "2016", "authors": "Floyd Brendan J, Wilkerson Emily M, Veling Mike T, Minogue Catie E, Xia Chuanwu, Beebe Emily T, Wrobel Russell L, Cho Holly, Kremer Laura S, Alston Charlotte L, Gromek Katarzyna A, Dolan Brendan K, Ulbrich Arne, Stefely Jonathan A, Bohl Sarah L, Werner Kelly M, Jochem Adam, Westphall Michael S, Rensvold Jarred W, Taylor Robert W, Prokisch Holger, Kim Jung-Ja P, Coon Joshua J, Pagliarini David J", "evidence": [ { "database": "UniProtKB", "id": "O14561", "url": "https://www.uniprot.org/uniprot/O14561" } ], "reference": [ { "type": "PubMed", "id": "27499296", "url": "https://glygen.org/publication/PubMed/27499296" } ] }, { "title": "Accessory subunits are integral for assembly and function of human mitochondrial complex I.", "journal": "Nature", "date": "2016", "authors": "Stroud DA, Surgenor EE, Formosa LE, Reljic B, Frazier AE, Dibley MG, Osellame LD, Stait T, Beilharz TH, Thorburn DR, Salim A, Ryan MT", "evidence": [ { "database": "UniProtKB", "id": "O14561", "url": "https://www.uniprot.org/uniprot/O14561" } ], "reference": [ { "type": "PubMed", "id": "27626371", "url": "https://glygen.org/publication/PubMed/27626371" } ] }, { "title": "Synthesis of a Highly Azide-Reactive and Thermosensitive Biofunctional Reagent for Efficient Enrichment and Large-Scale Identification of O-GlcNAc Proteins by Mass Spectrometry.", "journal": "Analytical chemistry", "date": "2017", "authors": "Zhang W, Liu T, Dong H, Bai H, Tian F, Shi Z, Chen M, Wang J, Qin W, Qian X", "evidence": [ { "database": "O-GlcNAc Database", "id": "O14561", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14561" } ], "reference": [ { "type": "PubMed", "id": "28510447", "url": "https://glygen.org/publication/PubMed/28510447" } ] }, { "title": "Structures of the human mitochondrial ribosome in native states of assembly.", "journal": "Nat. Struct. Mol. Biol.", "date": "2017", "authors": "Brown A, Rathore S, Kimanius D, Aibara S, Bai XC, Rorbach J, Amunts A, Ramakrishnan V", "evidence": [ { "database": "UniProtKB", "id": "O14561", "url": "https://www.uniprot.org/uniprot/O14561" } ], "reference": [ { "type": "PubMed", "id": "28892042", "url": "https://glygen.org/publication/PubMed/28892042" } ] }, { "title": "MIEF1 microprotein regulates mitochondrial translation.", "journal": "Biochemistry", "date": "2018", "authors": "Rathore A, Chu Q, Tan D, Martinez TF, Donaldson CJ, Diedrich JK, Yates JR 3rd, Saghatelian A", "evidence": [ { "database": "UniProtKB", "id": "O14561", "url": "https://www.uniprot.org/uniprot/O14561" } ], "reference": [ { "type": "PubMed", "id": "30215512", "url": "https://glygen.org/publication/PubMed/30215512" } ] }, { "title": "Structure of the Human ACP-ISD11 Heterodimer.", "journal": "Biochemistry", "date": "2019", "authors": "Herrera MG, Noguera ME, Sewell KE, Agudelo Suarez WA, Capece L, Klinke S, Santos J", "evidence": [ { "database": "UniProtKB", "id": "O14561", "url": "https://www.uniprot.org/uniprot/O14561" }, { "database": "RefSeq", "id": "NP_004994", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004994" } ], "reference": [ { "type": "PubMed", "id": "31664822", "url": "https://glygen.org/publication/PubMed/31664822" } ] }, { "title": "Dissecting the Roles of Mitochondrial Complex I Intermediate Assembly Complex Factors in the Biogenesis of Complex I.", "journal": "Cell reports", "date": "2020", "authors": "Formosa LE, Muellner-Wong L, Reljic B, Sharpe AJ, Jackson TD, Beilharz TH, Stojanovski D, Lazarou M, Stroud DA, Ryan MT", "evidence": [ { "database": "Reactome", "id": "R-HSA-6799198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6799198" } ], "reference": [ { "type": "PubMed", "id": "32320651", "url": "https://glygen.org/publication/PubMed/32320651" } ] }, { "title": "Further studies on the activity and subcellular distribution of alanine:glyoxylate aminotransferase in the livers of patients with primary hyperoxaluria type 1.", "journal": "Clinical science (London, England : 1979)", "date": "1988", "authors": "Danpure CJ, Jennings PR", "evidence": [ { "database": "Reactome", "id": "R-HSA-389661", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389661" } ], "reference": [ { "type": "PubMed", "id": "3416563", "url": "https://glygen.org/publication/PubMed/3416563" } ] }, { "title": "Substrate Sequestration and Chain Flipping in Human Mitochondrial Acyl Carrier Protein.", "journal": "Biochemistry", "date": "2023-12-19", "authors": "Suo Yixing, Chen Aochiu, La Clair James J, Burkart Michael D", "evidence": [ { "database": "RefSeq", "id": "NP_004994", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_004994" } ], "reference": [ { "type": "PubMed", "id": "38039071", "url": "https://glygen.org/publication/PubMed/38039071" } ] }, { "title": "Studies on the mechanims of oxidative phosphorylation. IX. Effect of cytochrome c on energy-linked processes.", "journal": "The Journal of biological chemistry", "date": "1966", "authors": "MacLennan DH, Lenaz G, Szarkowska L", "evidence": [ { "database": "Reactome", "id": "R-HSA-611105", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-611105" } ], "reference": [ { "type": "PubMed", "id": "4288886", "url": "https://glygen.org/publication/PubMed/4288886" } ] }, { "title": "The oxoacyl-coenzyme A thiolases of animal tissues.", "journal": "The Biochemical journal", "date": "1973", "authors": "Middleton B", "evidence": [ { "database": "Reactome", "id": "R-HSA-77289", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-77289" } ], "reference": [ { "type": "PubMed", "id": "4721607", "url": "https://glygen.org/publication/PubMed/4721607" } ] }, { "title": "Genetic evidence for a common enzyme catalyzing the second step in the degradation of proline and hydroxyproline.", "journal": "The Journal of clinical investigation", "date": "1979", "authors": "Valle D, Goodman SI, Harris SC, Phang JM", "evidence": [ { "database": "Reactome", "id": "R-HSA-389661", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389661" } ], "reference": [ { "type": "PubMed", "id": "500817", "url": "https://glygen.org/publication/PubMed/500817" } ] }, { "title": "Metabolism of proline and the hydroxyprolines.", "journal": "Annual review of biochemistry", "date": "1980", "authors": "Adams E, Frank L", "evidence": [ { "database": "Reactome", "id": "R-HSA-389661", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389661" } ], "reference": [ { "type": "PubMed", "id": "6250440", "url": "https://glygen.org/publication/PubMed/6250440" } ] }, { "title": "Cloning and sequence analysis of a full length cDNA encoding human mitochondrial 3-oxoacyl-CoA thiolase.", "journal": "Biochimica et biophysica acta", "date": "1993", "authors": "Abe H, Ohtake A, Yamamoto S, Satoh Y, Takayanagi M, Amaya Y, Takiguchi M, Sakuraba H, Suzuki Y, Mori M, et al.", "evidence": [ { "database": "Reactome", "id": "R-HSA-77289", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-77289" } ], "reference": [ { "type": "PubMed", "id": "8241273", "url": "https://glygen.org/publication/PubMed/8241273" } ] }, { "title": "Structural and functional characterization of the human brain D-aspartate oxidase.", "journal": "Journal of biochemistry", "date": "1997", "authors": "Setoyama C, Miura R", "evidence": [ { "database": "Reactome", "id": "R-HSA-389661", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389661" } ], "reference": [ { "type": "PubMed", "id": "9163533", "url": "https://glygen.org/publication/PubMed/9163533" } ] }, { "title": "Cloning of the human mitochondrial 51 kDa subunit (NDUFV1) reveals a 100% antisense homology of its 3'UTR with the 5'UTR of the gamma-interferon inducible protein (IP-30) precursor: is this a link between mitochondrial myopathy and inflammation?", "journal": "Biochemical and biophysical research communications", "date": "1998", "authors": "Schuelke M, Loeffen J, Mariman E, Smeitink J, van den Heuvel L", "evidence": [ { "database": "Reactome", "id": "R-HSA-6799198", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6799198" } ], "reference": [ { "type": "PubMed", "id": "9571201", "url": "https://glygen.org/publication/PubMed/9571201" } ] }, { "title": "C-terminal tripeptide Ser-Asn-Leu (SNL) of human D-aspartate oxidase is a functional peroxisome-targeting signal.", "journal": "The Biochemical journal", "date": "1998", "authors": "Amery L, Brees C, Baes M, Setoyama C, Miura R, Mannaerts GP, Van Veldhoven PP", "evidence": [ { "database": "Reactome", "id": "R-HSA-389661", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389661" } ], "reference": [ { "type": "PubMed", "id": "9820813", "url": "https://glygen.org/publication/PubMed/9820813" } ] }, { "title": "cDNA of eight nuclear encoded subunits of NADH:ubiquinone oxidoreductase: human complex I cDNA characterization completed.", "journal": "Biochem. Biophys. Res. Commun.", "date": "1998", "authors": "Loeffen JL, Triepels RH, van den Heuvel LP, Schuelke M, Buskens CA, Smeets RJ, Trijbels JM, Smeitink JA", "evidence": [ { "database": "UniProtKB", "id": "O14561", "url": "https://www.uniprot.org/uniprot/O14561" }, { "database": "Reactome", "id": "R-HSA-611105", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-611105" } ], "reference": [ { "type": "PubMed", "id": "9878551", "url": "https://glygen.org/publication/PubMed/9878551" } ] } ], "pathway": [ { "id": "R-HSA-389661", "name": "Glyoxylate metabolism and glycine degradation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-389661", "resource": "Reactome", "description": "Glyoxylate metabolism and glycine degradation" }, { "id": "R-HSA-611105", "name": "Respiratory electron transport", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-611105", "resource": "Reactome", "description": "Respiratory electron transport" }, { "id": "R-HSA-6799198", "name": "Complex I biogenesis", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-6799198", "resource": "Reactome", "description": "Complex I biogenesis" }, { "id": "R-HSA-77289", "name": "Mitochondrial Fatty Acid Beta-Oxidation", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-77289", "resource": "Reactome", "description": "Mitochondrial Fatty Acid Beta-Oxidation" } ], "orthologs": [ { "uniprot_canonical_ac": "D3ZF13-1", "protein_name": "Acyl carrier protein", "gene_name": "Ndufab1", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MASRVLCACVRRLPAAFAPLPRLPTLALARPLSTILCPEGIWRRTGTLQPTLALAQVPGTVTHLCRQYSDAPPLTLEGIRDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYD", "length": 156 }, "evidence": [ { "id": "45918658", "url": "http://www.informatics.jax.org/homology/45918658", "database": "MGI" }, { "id": "O14561", "url": "https://omabrowser.org/oma/group/O14561/", "database": "OMA" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q9CR21-1", "protein_name": "Acyl carrier protein, mitochondrial", "gene_name": "Ndufab1", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MASRVLCACVRRLPAAFAPLPRLPTLALARPLSTTLCPEGIRRRPGALQSALALAQVPGTVTHLCRQYSDAPPLTLDGIKDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAMEDEFGFEIPDIDAEKLMCPQEIVDYIADKKDVYE", "length": 156 }, "evidence": [ { "id": "45918658", "url": "http://www.informatics.jax.org/homology/45918658", "database": "MGI" }, { "id": "O14561", "url": "https://omabrowser.org/oma/group/O14561/", "database": "OMA" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 8, "go_terms": [ { "name": "fatty acid biosynthetic process", "id": "GO:0006633", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006633", "evidence": [ { "database": "UniProtKB", "id": "O14561", "url": "https://www.uniprot.org/uniprot/O14561" } ], "pmid": "" }, { "name": "iron-sulfur cluster assembly", "id": "GO:0016226", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016226", "evidence": [ { "database": "UniProtKB", "id": "O14561", "url": "https://www.uniprot.org/uniprot/O14561" } ], "pmid": "" }, { "name": "mitochondrial respiratory chain complex I assembly", "id": "GO:0032981", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0032981", "evidence": [ { "database": "UniProtKB", "id": "O14561", "url": "https://www.uniprot.org/uniprot/O14561" } ], "pmid": "" }, { "name": "mitochondrial electron transport, NADH to ubiquinone", "id": "GO:0006120", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006120", "evidence": [ { "database": "UniProtKB", "id": "O14561", "url": "https://www.uniprot.org/uniprot/O14561" } ], "pmid": "" }, { "name": "protein lipoylation", "id": "GO:0009249", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009249", "evidence": [ { "database": "UniProtKB", "id": "O14561", "url": "https://www.uniprot.org/uniprot/O14561" } ], "pmid": "" }, { "name": "proton motive force-driven mitochondrial ATP synthesis", "id": "GO:0042776", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042776", "evidence": [ { "database": "UniProtKB", "id": "O14561", "url": "https://www.uniprot.org/uniprot/O14561" } ], "pmid": "" }, { "name": "aerobic respiration", "id": "GO:0009060", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0009060", "evidence": [ { "database": "UniProtKB", "id": "O14561", "url": "https://www.uniprot.org/uniprot/O14561" } ], "pmid": "" }, { "name": "[2Fe-2S] cluster assembly", "id": "GO:0044571", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0044571", "evidence": [ { "database": "UniProtKB", "id": "O14561", "url": "https://www.uniprot.org/uniprot/O14561" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 5, "go_terms": [ { "name": "fatty acid binding", "id": "GO:0005504", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005504", "evidence": [ { "database": "UniProtKB", "id": "O14561", "url": "https://www.uniprot.org/uniprot/O14561" } ], "pmid": "" }, { "name": "calcium ion binding", "id": "GO:0005509", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005509", "evidence": [ { "database": "UniProtKB", "id": "O14561", "url": "https://www.uniprot.org/uniprot/O14561" } ], "pmid": "" }, { "name": "acyl binding", "id": "GO:0000035", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000035", "evidence": [ { "database": "UniProtKB", "id": "O14561", "url": "https://www.uniprot.org/uniprot/O14561" } ], "pmid": "" }, { "name": "acyl carrier activity", "id": "GO:0000036", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000036", "evidence": [ { "database": "UniProtKB", "id": "O14561", "url": "https://www.uniprot.org/uniprot/O14561" } ], "pmid": "" }, { "name": "mitochondrial large ribosomal subunit binding", "id": "GO:0140978", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0140978", "evidence": [ { "database": "UniProtKB", "id": "O14561", "url": "https://www.uniprot.org/uniprot/O14561" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 7, "go_terms": [ { "name": "nucleoplasm", "id": "GO:0005654", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005654", "evidence": [ { "database": "UniProtKB", "id": "O14561", "url": "https://www.uniprot.org/uniprot/O14561" } ], "pmid": "" }, { "name": "mitochondrion", "id": "GO:0005739", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005739", "evidence": [ { "database": "UniProtKB", "id": "O14561", "url": "https://www.uniprot.org/uniprot/O14561" } ], "pmid": "" }, { "name": "mitochondrial inner membrane", "id": "GO:0005743", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005743", "evidence": [ { "database": "UniProtKB", "id": "O14561", "url": "https://www.uniprot.org/uniprot/O14561" } ], "pmid": "" }, { "name": "mitochondrial matrix", "id": "GO:0005759", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005759", "evidence": [ { "database": "UniProtKB", "id": "O14561", "url": "https://www.uniprot.org/uniprot/O14561" } ], "pmid": "" }, { "name": "mitochondrial membrane", "id": "GO:0031966", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0031966", "evidence": [ { "database": "UniProtKB", "id": "O14561", "url": "https://www.uniprot.org/uniprot/O14561" } ], "pmid": "" }, { "name": "mitochondrial respiratory chain complex I", "id": "GO:0005747", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005747", "evidence": [ { "database": "UniProtKB", "id": "O14561", "url": "https://www.uniprot.org/uniprot/O14561" } ], "pmid": "" }, { "name": "iron-sulfur cluster assembly complex", "id": "GO:1990229", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1990229", "evidence": [ { "database": "UniProtKB", "id": "O14561", "url": "https://www.uniprot.org/uniprot/O14561" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [], "ptm_annotation": [ { "annotation": "Phosphopantetheinylation at Ser-112 is essential for interactions with LYR motif-containing proteins.", "evidence": [ { "database": "UniProtKB", "id": "O14561", "url": "https://www.uniprot.org/uniprot/O14561" }, { "database": "PubMed", "id": "31664822", "url": "https://glygen.org/publication/PubMed/31664822" } ] } ], "interactions": [], "reactions": [], "reaction_participants": [], "reaction_enzymes": [], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "isoformset.uniprotkb", "label": "Isoforms" }, { "name": "homologset.mgi", "label": "MGI Homologs" }, { "name": "homologset.oma", "label": "OMA Homologs" } ], "sequence_features": { "n_linked_sites": [], "o_linked_sites": [], "snv_sites": [], "glycation_sites": [], "phosphorylation_sites": [ 38 ], "sequon_annotation_sites": [] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 99 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }