{ "uniprot_canonical_ac": "O14495-1", "uniprot_ac": "O14495", "uniprot_id": "PLPP3_HUMAN", "mass": { "chemical_mass": 35116.0, "monoisotopic_mass": 35116.0 }, "refseq": { "ac": "NP_003704", "name": "phospholipid phosphatase 3", "summary": "The protein encoded by this gene is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in de novo synthesis of glycerolipids as well as in receptor-activated signal transduction mediated by phospholipase D. This protein is a membrane glycoprotein localized at the cell plasma membrane. It has been shown to actively hydrolyze extracellular lysophosphatidic acid and short-chain phosphatidic acid. The expression of this gene is found to be enhanced by epidermal growth factor in Hela cells. [provided by RefSeq, Mar 2010].", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003704" }, "gene_names": [ { "name": "PLPP3", "resource": "UniProtKB", "type": "recommended", "url": "https://www.uniprot.org/uniprot/O14495", "id": "O14495" }, { "name": "Dri42; LPP3; PAP2B; PPAP2B; VCIP", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003704", "id": "NP_003704" }, { "name": "LPP3", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O14495", "id": "O14495" }, { "name": "PLPP3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003704", "id": "NP_003704" }, { "name": "PPAP2B", "resource": "UniProtKB", "type": "synonym", "url": "https://www.uniprot.org/uniprot/O14495", "id": "O14495" } ], "protein_names": [ { "name": "Phospholipid phosphatase 3", "resource": "UniProtKB", "type": "recommended", "url": "", "id": "O14495" }, { "name": "3.1.3.-", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O14495" }, { "name": "3.1.3.4", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O14495" }, { "name": "Lipid phosphate phosphohydrolase 3", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O14495" }, { "name": "PAP-2b", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O14495" }, { "name": "PAP2-beta", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O14495" }, { "name": "PAP2b", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O14495" }, { "name": "Phosphatidate phosphohydrolase type 2b", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O14495" }, { "name": "Phosphatidic acid phosphatase 2b", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O14495" }, { "name": "VCIP", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O14495" }, { "name": "Vascular endothelial growth factor and type I collagen-inducible protein", "resource": "UniProtKB", "type": "synonym", "url": "", "id": "O14495" }, { "name": "lipid phosphate phosphohydrolase 3; type-2 phosphatidic acid phosphatase-beta; vascular endothelial growth factor and type I collagen inducible; PAP2 beta; phosphatidate phosphohydrolase type 2b; phosphatidic acid phosphatase type 2B", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003704", "id": "NP_003704" }, { "name": "phospholipid phosphatase 3", "resource": "RefSeq", "type": "synonym", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003704", "id": "NP_003704" } ], "function": [ { "annotation": "Autotaxin-LPA-LPP3 Axis in Energy Metabolism and Metabolic Disease. Review article Publication Status: Online-Only", "evidence": [ { "database": "RefSeq", "id": "NP_003704", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003704" }, { "database": "PubMed", "id": "34502491", "url": "https://glygen.org/publication/PubMed/34502491" } ] }, { "annotation": "DNA methylation of a MIR-based enhancer downregulates the expression of PLPP3 and promotes the mineralization of the aortic valve in calcific aortic valve disease.", "evidence": [ { "database": "RefSeq", "id": "NP_003704", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003704" }, { "database": "PubMed", "id": "29726894", "url": "https://glygen.org/publication/PubMed/29726894" } ] }, { "annotation": "Findings indicate that up-regulation of PLPP3 during inflammation and atherosclerosis results from canonical activation of the NF-kappaB signaling cascade to increase PLPP3 expression through nuclear import and binding of RelA and RelB transcription factors to the PLPP3 promoter and suggest a mechanism by which the LPP3 substrate, LPA, can regulate PLPP3 expression.", "evidence": [ { "database": "RefSeq", "id": "NP_003704", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003704" }, { "database": "PubMed", "id": "31362988", "url": "https://glygen.org/publication/PubMed/31362988" } ] }, { "annotation": "Independently of this phosphatase activity may also function in the Wnt signaling pathway and the stabilization of beta-catenin/CTNNB1, thereby regulating cell proliferation, migration and differentiation in angiogenesis or yet in tumor growth (PubMed:20123964, PubMed:21569306). Also plays a role in integrin-mediated cell-cell adhesion in angiogenesis (PubMed:12660161, PubMed:16099422).", "evidence": [ { "database": "UniProtKB", "id": "O14495", "url": "https://www.uniprot.org/uniprot/O14495#function" }, { "database": "PubMed", "id": "20123964", "url": "https://glygen.org/publication/PubMed/20123964" }, { "database": "PubMed", "id": "12660161", "url": "https://glygen.org/publication/PubMed/12660161" }, { "database": "PubMed", "id": "21569306", "url": "https://glygen.org/publication/PubMed/21569306" }, { "database": "PubMed", "id": "16099422", "url": "https://glygen.org/publication/PubMed/16099422" } ] }, { "annotation": "Lipid phosphate phosphatase 3 maintains NO-mediated flow-mediated dilatation in human adipose resistance arterioles.", "evidence": [ { "database": "RefSeq", "id": "NP_003704", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003704" }, { "database": "PubMed", "id": "36575638", "url": "https://glygen.org/publication/PubMed/36575638" } ] }, { "annotation": "Magnesium-independent phospholipid phosphatase of the plasma membrane that catalyzes the dephosphorylation of a variety of glycerolipid and sphingolipid phosphate esters including phosphatidate/PA, lysophosphatidate/LPA, diacylglycerol pyrophosphate/DGPP, sphingosine 1-phosphate/S1P and ceramide 1-phosphate/C1P (PubMed:9705349, PubMed:9607309, PubMed:27694435). Also acts on N-oleoyl ethanolamine phosphate/N-(9Z-octadecenoyl)-ethanolamine phosphate, a potential physiological compound (PubMed:9607309). Has both an extracellular and an intracellular phosphatase activity, allowing the hydrolysis and the cellular uptake of these bioactive lipid mediators from the milieu, regulating signal transduction in different cellular processes (PubMed:9607309, PubMed:23591818, PubMed:27694435). Through the dephosphorylation of extracellular sphingosine-1-phosphate and the regulation of its extra- and intracellular availability, plays a role in vascular homeostasis, regulating endothelial cell migration, adhesion, survival, proliferation and the production of pro-inflammatory cytokines (PubMed:27694435). By maintaining the appropriate levels of this lipid in the cerebellum, also ensure its proper development and function (By similarity). Through its intracellular lipid phosphatase activity may act in early compartments of the secretory pathway, regulating the formation of Golgi to endoplasmic reticulum retrograde transport carriers (PubMed:23591818).", "evidence": [ { "database": "UniProtKB", "id": "O14495", "url": "https://www.uniprot.org/uniprot/O14495#function" }, { "database": "PubMed", "id": "9705349", "url": "https://glygen.org/publication/PubMed/9705349" }, { "database": "PubMed", "id": "23591818", "url": "https://glygen.org/publication/PubMed/23591818" }, { "database": "UniProtKB", "id": "Q99JY8", "url": "https://www.uniprot.org/uniprot/Q99JY8#function" }, { "database": "PubMed", "id": "27694435", "url": "https://glygen.org/publication/PubMed/27694435" }, { "database": "PubMed", "id": "9607309", "url": "https://glygen.org/publication/PubMed/9607309" } ] }, { "annotation": "Roles for lysophosphatidic acid signaling in vascular development and disease. Review article", "evidence": [ { "database": "RefSeq", "id": "NP_003704", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003704" }, { "database": "PubMed", "id": "32376340", "url": "https://glygen.org/publication/PubMed/32376340" } ] }, { "annotation": "The protein encoded by this gene is a member of the phosphatidic acid phosphatase (PAP) family. PAPs convert phosphatidic acid to diacylglycerol, and function in de novo synthesis of glycerolipids as well as in receptor-activated signal transduction mediated by phospholipase D. This protein is a membrane glycoprotein localized at the cell plasma membrane. It has been shown to actively hydrolyze extracellular lysophosphatidic acid and short-chain phosphatidic acid. The expression of this gene is found to be enhanced by epidermal growth factor in Hela cells. [provided by RefSeq, Mar 2010].", "evidence": [ { "database": "RefSeq", "id": "NP_003704", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003704" } ] } ], "disease": [], "snv": [ { "evidence": [ { "id": "O14495", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O14495" } ], "glycoeffect": [], "start_pos": 153, "end_pos": 153, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "R", "sequence_mut": "C", "comment": "Somatic mutation passed 1 out of 6 filters: num. of cancers (3).", "chr_id": "1", "chr_pos": "56524395", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "R153", "disease": [ { "disease_id": "DOID:1793", "recommended_name": { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "pancreatic cancer", "description": "An endocrine gland cancer located_in the pancreas." }, "synonyms": [ { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "Ca body of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "Ca head of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "Ca tail of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "malignant neoplasm of body of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "malignant neoplasm of head of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "malignant neoplasm of tail of pancreas", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "pancreas neoplasm", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "pancreatic neoplasm", "description": "" }, { "id": "DOID:1793", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1793", "name": "pancreatic tumor", "description": "" } ] }, { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] }, { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "O14495", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O14495" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 172, "end_pos": 172, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "S", "sequence_mut": "F", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-loss (NCS->NCF).", "chr_id": "1", "chr_pos": "56524337", "ref_nt": "G", "alt_nt": "A", "minor_allelic_frequency": "", "site_lbl": "S172", "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] }, { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs747029264", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747029264" }, { "id": "rs747029264", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs747029264" }, { "id": "rs747029264", "database": "gnomAD", "url": "http://gnomad.broadinstitute.org/awesome?query=rs747029264" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 172, "end_pos": 172, "sequence_org": "S", "sequence_mut": "P", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->NCP).", "chr_id": "1", "chr_pos": "56524338", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S172", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs941431841", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs941431841" }, { "id": "rs941431841", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs941431841" } ], "glycoeffect": [ "n-glyco-sequon-loss", "o-glyco-site-loss" ], "start_pos": 172, "end_pos": 172, "sequence_org": "S", "sequence_mut": "Y", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-loss (NCS->NCY).", "chr_id": "1", "chr_pos": "56524337", "ref_nt": "T", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "S172", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs1034600155", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1034600155" }, { "id": "rs1034600155", "database": "TOPMed", "url": "https://www.ncbi.nlm.nih.gov/snp/rs1034600155#frequency_tab" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 25, "end_pos": 25, "sequence_org": "N", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NNN->NNT).", "chr_id": "1", "chr_pos": "56578943", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "N25", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "rs779117993", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs779117993" }, { "id": "rs779117993", "database": "ExAC", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs779117993" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 311, "end_pos": 311, "sequence_org": "M", "sequence_mut": "T", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NMM->NMT).", "chr_id": "1", "chr_pos": "56496555", "ref_nt": "G", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "M311", "keywords": [ "ebi", "germline" ] }, { "evidence": [ { "id": "O14495", "database": "BioMuta", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O14495" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 70, "end_pos": 70, "subjects_tested": "0", "subjects_positive": "0", "frequency": "0.0", "sequence_org": "D", "sequence_mut": "N", "comment": "Somatic mutation passed 1 out of 6 filters: n-glyco-sequon-gain (DES->NES).", "chr_id": "1", "chr_pos": "56537044", "ref_nt": "C", "alt_nt": "T", "minor_allelic_frequency": "", "site_lbl": "D70", "disease": [ { "disease_id": "DOID:4159", "recommended_name": { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "skin cancer", "description": "An integumentary system cancer located_in the skin that is the uncontrolled growth of abnormal skin cells." }, "synonyms": [ { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "CA - skin cancer", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "malignant neoplasm of skin", "description": "" }, { "id": "DOID:4159", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:4159", "name": "melanoma and Non-melanoma skin cancer", "description": "" } ] } ], "keywords": [ "biomuta", "somatic", "cancer", "disease" ] }, { "evidence": [ { "id": "rs1557506920", "database": "dbSNP", "url": "https://www.ncbi.nlm.nih.gov/SNP/snp_ref.cgi?type=rs&rs=rs1557506920" }, { "id": "rs1557506920", "database": "ENSEMBL", "url": "https://www.ensembl.org/id/rs1557506920" } ], "glycoeffect": [ "n-glyco-sequon-gain" ], "start_pos": 86, "end_pos": 86, "sequence_org": "A", "sequence_mut": "S", "comment": "Germline mutation passed 1 out of 1 filters: n-glyco-sequon-gain (NDA->NDS).", "chr_id": "1", "chr_pos": "56536996", "ref_nt": "A", "alt_nt": "null", "minor_allelic_frequency": "", "site_lbl": "A86", "keywords": [ "ebi", "germline" ] } ], "mutagenesis": [ { "start_pos": 106, "end_pos": 106, "sequence_org": "Y", "sequence_mut": "A", "comment": "No effect on basolateral localization in polarized cells.", "evidence": [ { "database": "UniProtKB", "id": "O14495", "url": "https://www.uniprot.org/uniprot/O14495" }, { "database": "PubMed", "id": "17005594", "url": "https://glygen.org/publication/PubMed/17005594" } ] }, { "start_pos": 109, "end_pos": 109, "sequence_org": "Y", "sequence_mut": "A", "comment": "Loss of basolateral localization in polarized cells.", "evidence": [ { "database": "UniProtKB", "id": "O14495", "url": "https://www.uniprot.org/uniprot/O14495" }, { "database": "PubMed", "id": "17005594", "url": "https://glygen.org/publication/PubMed/17005594" } ] }, { "start_pos": 110, "end_pos": 110, "sequence_org": "Y", "sequence_mut": "A", "comment": "Loss of basolateral localization in polarized cells.", "evidence": [ { "database": "UniProtKB", "id": "O14495", "url": "https://www.uniprot.org/uniprot/O14495" }, { "database": "PubMed", "id": "17005594", "url": "https://glygen.org/publication/PubMed/17005594" } ] }, { "start_pos": 184, "end_pos": 184, "sequence_org": "D", "sequence_mut": "E", "comment": "Loss of binding to integrin. Loss of function in integrin-mediated cell-cell interaction.", "evidence": [ { "database": "UniProtKB", "id": "O14495", "url": "https://www.uniprot.org/uniprot/O14495" }, { "database": "PubMed", "id": "9705349", "url": "https://glygen.org/publication/PubMed/9705349" } ] } ], "expression_tissue": [ { "tissue": { "name": "Adult mammalian kidney", "namespace": "UBERON", "id": "0000082", "url": "http://purl.obolibrary.org/obo/UBERON_0000082" }, "score": "96.99", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000162407", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000162407" } ] }, { "tissue": { "name": "Oral cavity", "namespace": "UBERON", "id": "0000167", "url": "http://purl.obolibrary.org/obo/UBERON_0000167" }, "score": "95.5", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000162407", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000162407" } ] }, { "tissue": { "name": "Stomach", "namespace": "UBERON", "id": "0000945", "url": "http://purl.obolibrary.org/obo/UBERON_0000945" }, "score": "96.18", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000162407", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000162407" } ] }, { "tissue": { "name": "Uterus", "namespace": "UBERON", "id": "0000995", "url": "http://purl.obolibrary.org/obo/UBERON_0000995" }, "score": "99.21", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000162407", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000162407" } ] }, { "tissue": { "name": "Esophagus", "namespace": "UBERON", "id": "0001043", "url": "http://purl.obolibrary.org/obo/UBERON_0001043" }, "score": "99.21", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000162407", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000162407" } ] }, { "tissue": { "name": "Rectum", "namespace": "UBERON", "id": "0001052", "url": "http://purl.obolibrary.org/obo/UBERON_0001052" }, "score": "94.82", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000162407", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000162407" } ] }, { "tissue": { "name": "Colon", "namespace": "UBERON", "id": "0001155", "url": "http://purl.obolibrary.org/obo/UBERON_0001155" }, "score": "96.54", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000162407", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000162407" } ] }, { "tissue": { "name": "Urinary bladder", "namespace": "UBERON", "id": "0001255", "url": "http://purl.obolibrary.org/obo/UBERON_0001255" }, "score": "98.82", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000162407", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000162407" } ] }, { "tissue": { "name": "Thyroid gland", "namespace": "UBERON", "id": "0002046", "url": "http://purl.obolibrary.org/obo/UBERON_0002046" }, "score": "98.68", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000162407", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000162407" } ] }, { "tissue": { "name": "Lung", "namespace": "UBERON", "id": "0002048", "url": "http://purl.obolibrary.org/obo/UBERON_0002048" }, "score": "99.05", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000162407", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000162407" } ] }, { "tissue": { "name": "Liver", "namespace": "UBERON", "id": "0002107", "url": "http://purl.obolibrary.org/obo/UBERON_0002107" }, "score": "95.95", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000162407", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000162407" } ] }, { "tissue": { "name": "Prostate gland", "namespace": "UBERON", "id": "0002367", "url": "http://purl.obolibrary.org/obo/UBERON_0002367" }, "score": "96.32", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000162407", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000162407" } ] }, { "tissue": { "name": "Thoracic mammary gland", "namespace": "UBERON", "id": "0005200", "url": "http://purl.obolibrary.org/obo/UBERON_0005200" }, "score": "96.22", "present": "HIGH", "evidence": [ { "database": "Bgee", "id": "ENSG00000162407", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000162407" } ] } ], "expression_disease": [ { "significant": "Yes", "trend": "down", "name": "Prostate cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10283", "evidence": [ { "database": "BioXpress", "id": "O14495", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14495" } ], "disease": [ { "disease_id": "DOID:10283", "recommended_name": { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer", "description": "A male reproductive organ cancer that is located_in the prostate." }, "synonyms": [ { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "NGP - new growth of prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "hereditary prostate cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "malignant tumor of the prostate", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate cancer, familial", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostate neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic cancer", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "prostatic neoplasm", "description": "" }, { "id": "DOID:10283", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10283", "name": "tumor of the prostate", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "prostate cancer, hereditary, type 9", "description": "" }, { "id": "MONDO:0012597", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012597", "name": "HPC9", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the EHBP1 gene." }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "EHBP1 familial prostate cancer", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "familial prostate cancer caused by mutation in EHBP1", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "prostate cancer, hereditary, type 12", "description": "" }, { "id": "MONDO:0012741", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012741", "name": "HPC12", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "prostate cancer, hereditary, type 5", "description": "" }, { "id": "MONDO:0012244", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012244", "name": "HPC5", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, hereditary, type 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "prostate cancer, susceptibility to, 3", "description": "" }, { "id": "MONDO:0012093", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012093", "name": "HPC3", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, type 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, susceptibility to, 4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "HPC4", "description": "" }, { "id": "MONDO:0012094", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012094", "name": "prostate cancer, hereditary, on chromosome 7", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the MSMB gene." }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "MSMB familial prostate cancer", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "familial prostate cancer caused by mutation in MSMB", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "prostate cancer, hereditary, type 13", "description": "" }, { "id": "MONDO:0012758", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012758", "name": "HPC13", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, hereditary, type 8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "HPC8", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "predisposing for prostate cancer", "description": "" }, { "id": "MONDO:0011270", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011270", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, hereditary, type 6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "HPC6", "description": "" }, { "id": "MONDO:0012300", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012300", "name": "prostate cancer, susceptibility to", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "HPC10", "description": "" }, { "id": "MONDO:0012620", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012620", "name": "prostate cancer, hereditary, 10", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate carcinoma", "description": "Prostate carcinoma that has developed in relatives of patients with a history of prostate carcinoma." }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "familial prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate cancer", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "hereditary prostate carcinoma", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, somatic", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, familial", "description": "" }, { "id": "MONDO:0023122", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0023122", "name": "prostate cancer, hereditary", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "HPC7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer, hereditary, 7", "description": "" }, { "id": "MONDO:0012470", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012470", "name": "prostate cancer aggressiveness", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "Any familial prostate cancer in which the cause of the disease is a mutation in the RNASEL gene." }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "RNASEL familial prostate cancer", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "familial prostate cancer caused by mutation in RNASEL", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "prostate cancer, hereditary, type 1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "HPC1", "description": "" }, { "id": "MONDO:0011098", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0011098", "name": "Prca1", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "HPC11", "description": "" }, { "id": "MONDO:0012768", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012768", "name": "prostate cancer, hereditary, 11", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "HPC14", "description": "" }, { "id": "MONDO:0012769", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012769", "name": "prostate cancer, hereditary, 14", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "HPC15", "description": "" }, { "id": "MONDO:0012770", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012770", "name": "prostate cancer, hereditary, 15", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "HPCX1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer, hereditary, X-linked 1", "description": "" }, { "id": "MONDO:0010257", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010257", "name": "prostate cancer susceptibility, X-linked", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "HPCX2", "description": "" }, { "id": "MONDO:0010405", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0010405", "name": "prostate cancer, hereditary, X-linked 2", "description": "" }, { "id": "MIM:611868", "resource": "MIM", "url": "https://www.omim.org/entry/611868", "name": "Prostate cancer, hereditary, 12", "description": "Prostate cancer, hereditary, 12" }, { "id": "MIM:611928", "resource": "MIM", "url": "https://www.omim.org/entry/611928", "name": "Prostate cancer, hereditary, 13", "description": "Prostate cancer, hereditary, 13" }, { "id": "MIM:176807", "resource": "MIM", "url": "https://www.omim.org/entry/176807", "name": "Prostate cancer", "description": "Prostate cancer" }, { "id": "MIM:601518", "resource": "MIM", "url": "https://www.omim.org/entry/601518", "name": "Prostate cancer, hereditary, 1", "description": "Prostate cancer, hereditary, 1" }, { "id": "MIM:611955", "resource": "MIM", "url": "https://www.omim.org/entry/611955", "name": "Prostate cancer, hereditary, 11", "description": "Prostate cancer, hereditary, 11" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Stomach cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:10534", "evidence": [ { "database": "BioXpress", "id": "O14495", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14495" } ], "disease": [ { "disease_id": "DOID:10534", "recommended_name": { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "stomach cancer", "description": "A gastrointestinal system cancer that is located_in the stomach." }, "synonyms": [ { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric cancer", "description": "" }, { "id": "DOID:10534", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:10534", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "A primary or metastatic malignant neoplasm involving the stomach." }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca lesser curvature - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "cancer of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer risk after h. pylori infection", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, somatic", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumor", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant gastric tumour", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant stomach neoplasm", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumor of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of greater curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of lesser curve of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant tumour of the stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "stomach cancer", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "Ca body - stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "ca greater curvature of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "malignant neoplasm of body of stomach", "description": "" }, { "id": "MONDO:0001056", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001056", "name": "gastric cancer, intestinal", "description": "" }, { "id": "MIM:613659", "resource": "MIM", "url": "https://www.omim.org/entry/613659", "name": "Gastric cancer", "description": "Gastric cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Urinary bladder cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11054", "evidence": [ { "database": "BioXpress", "id": "O14495", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14495" } ], "disease": [ { "disease_id": "DOID:11054", "recommended_name": { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "urinary bladder cancer", "description": "An urinary system cancer that results_in malignant growth located_in the urinary bladder." }, "synonyms": [ { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "bladder cancer", "description": "" }, { "id": "DOID:11054", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11054", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "A primary or metastatic malignant neoplasm involving the bladder." }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "bladder cancer, somatic", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "cancer of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant neoplasm, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumor, urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of the urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant tumour of urinary bladder", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "malignant urinary bladder tumour", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder cancer", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant neoplasm", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumor", "description": "" }, { "id": "MONDO:0001187", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0001187", "name": "urinary bladder malignant tumour", "description": "" }, { "id": "MIM:109800", "resource": "MIM", "url": "https://www.omim.org/entry/109800", "name": "Bladder cancer", "description": "Bladder cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Head and neck cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:11934", "evidence": [ { "database": "BioXpress", "id": "O14495", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14495" } ], "disease": [ { "disease_id": "DOID:11934", "recommended_name": { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck cancer", "description": "An organ system cancer that arises in the head or neck region. This region includes the nasal cavity, sinuses, lips, mouth, salivary glands, throat, or larynx." }, "synonyms": [ { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head and neck tumours", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "head/neck neoplasm", "description": "" }, { "id": "DOID:11934", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:11934", "name": "tumor of head and neck", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Lung cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1324", "evidence": [ { "database": "BioXpress", "id": "O14495", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14495" } ], "disease": [ { "disease_id": "DOID:1324", "recommended_name": { "id": "DOID:1324", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1324", "name": "lung cancer", "description": "A respiratory system cancer that is located_in the lung." }, "synonyms": [ { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "LNCR1", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility", "description": "" }, { "id": "MONDO:0012159", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012159", "name": "lung cancer susceptibility 1", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "LNCR3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "lung cancer susceptibility 3", "description": "" }, { "id": "MONDO:0012942", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012942", "name": "adenocarcinoma of lung, susceptibility to", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "LNCR4", "description": "" }, { "id": "MONDO:0012955", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0012955", "name": "lung cancer susceptibility 4", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "LNCR5", "description": "" }, { "id": "MONDO:0013631", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0013631", "name": "lung cancer susceptibility 5", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "A malignant neoplasm involving the lung." }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "adenocarcinoma of lung, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "cancer of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, resistance to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung neoplasm", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumor", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant lung tumour", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant neoplasm of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumor of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "malignant tumour of the lung", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, response to tyrosine kinase inhibitor in, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, somatic", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "nonsmall cell lung cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "Nonsmall cell lung cancer", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "alveolar cell carcinoma", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung cancer, protection against", "description": "" }, { "id": "MONDO:0008903", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0008903", "name": "lung neoplasm", "description": "" }, { "id": "MIM:211980", "resource": "MIM", "url": "https://www.omim.org/entry/211980", "name": "Lung cancer", "description": "Lung cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Breast cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1612", "evidence": [ { "database": "BioXpress", "id": "O14495", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14495" } ], "disease": [ { "disease_id": "DOID:1612", "recommended_name": { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast cancer", "description": "A thoracic cancer that originates in the mammary gland." }, "synonyms": [ { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "breast tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant neoplasm of breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "malignant tumor of the breast", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary cancer", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "mammary tumor", "description": "" }, { "id": "DOID:1612", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1612", "name": "primary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "Breast carcinoma that has developed in relatives of patients with history of breast carcinoma." }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer susceptibility, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, early-onset, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, invasive ductal, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, lobular, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, male, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, protection against, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, somatic", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "familial cancer of the breast", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast cancer", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "hereditary breast carcinoma", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial", "description": "" }, { "id": "MONDO:0016419", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0016419", "name": "breast cancer, familial Male", "description": "" }, { "id": "MIM:114480", "resource": "MIM", "url": "https://www.omim.org/entry/114480", "name": "Breast cancer", "description": "Breast cancer" } ] } ] }, { "significant": "No", "trend": "up", "name": "Thyroid cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:1781", "evidence": [ { "database": "BioXpress", "id": "O14495", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14495" } ], "disease": [ { "disease_id": "DOID:1781", "recommended_name": { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid cancer", "description": "An endocrine gland cancer located in the thryoid gland located in the neck below the thyroid cartilage." }, "synonyms": [ { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid gland cancer", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "Thyroid gland neoplasm", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "malignant tumour of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "neoplasm of thyroid gland", "description": "" }, { "id": "DOID:1781", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:1781", "name": "thyroid neoplasm", "description": "" } ] } ] }, { "significant": "No", "trend": "up", "name": "Kidney cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:263", "evidence": [ { "database": "BioXpress", "id": "O14495", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14495" } ], "disease": [ { "disease_id": "DOID:263", "recommended_name": { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "kidney cancer", "description": "A urinary system cancer that is located_in the kidney." }, "synonyms": [ { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant neoplasm of kidney except pelvis", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "malignant tumour of kidney", "description": "" }, { "id": "DOID:263", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:263", "name": "renal cancer", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Liver cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:3571", "evidence": [ { "database": "BioXpress", "id": "O14495", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14495" } ], "disease": [ { "disease_id": "DOID:3571", "recommended_name": { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "liver cancer", "description": "A hepatobiliary system cancer that is located_in the liver." }, "synonyms": [ { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Ca liver - primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "Resectable malignant neoplasm of Liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "hepatic neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant hepato-biliary neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, primary", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant tumor of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "non-resectable primary hepatic malignant neoplasm", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary liver cancer", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "primary malignant neoplasm of liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "resectable malignant neoplasm of the liver", "description": "" }, { "id": "DOID:3571", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:3571", "name": "malignant neoplasm of liver, not specified as primary or secondary", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Uterine cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:363", "evidence": [ { "database": "BioXpress", "id": "O14495", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14495" } ], "disease": [ { "disease_id": "DOID:363", "recommended_name": { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine cancer", "description": "A female reproductive organ cancer that is located_in the uterus." }, "synonyms": [ { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "CA - cancer of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "Tumour of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "malignant uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "neoplasm of uterus", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterine tumor", "description": "" }, { "id": "DOID:363", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:363", "name": "uterus neoplasm", "description": "" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Esophageal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:5041", "evidence": [ { "database": "BioXpress", "id": "O14495", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14495" } ], "disease": [ { "disease_id": "DOID:5041", "recommended_name": { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophageal cancer", "description": "A gastrointestinal system cancer that is located_in the esophagus." }, "synonyms": [ { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca lower third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "Ca middle third oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "esophagus cancer", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Distal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of Proximal Third of esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "DOID:5041", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:5041", "name": "malignant tumor of the middle Third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "A primary or metastatic malignant neoplasm involving the esophagus." }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "cancer of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal cancer, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, somatic", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophageal tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant esophagus tumor", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus neoplasm", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant oesophagus tumour", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "oesophagus cancer", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca lower third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Ca middle third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of lower third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of middle third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant neoplasm of upper third oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of abdominal esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of distal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of proximal third of esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumor of the middle third of the esophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of abdominal oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of distal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of proximal third of oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "malignant tumour of the middle third of the oesophagus", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Aerodigestive tract cancer, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "Escc, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "esophageal squamous cell carcinoma, susceptibility to", "description": "" }, { "id": "MONDO:0007576", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0007576", "name": "gastric cardia adenocarcinoma, susceptibility to", "description": "" }, { "id": "MIM:133239", "resource": "MIM", "url": "https://www.omim.org/entry/133239", "name": "Esophageal cancer", "description": "Esophageal cancer" } ] } ] }, { "significant": "Yes", "trend": "down", "name": "Colorectal cancer [DO disease name]", "url": "http://disease-ontology.org/term/DOID:9256", "evidence": [ { "database": "BioXpress", "id": "O14495", "url": "https://hive.biochemistry.gwu.edu/bioxpress/transcriptview/O14495" } ], "disease": [ { "disease_id": "DOID:9256", "recommended_name": { "id": "DOID:9256", "resource": "Disease Ontology", "url": "http://disease-ontology.org/term/DOID:9256", "name": "colorectal cancer", "description": "A large intestine cancer that is located_in the colon and/or located_in the rectum." }, "synonyms": [ { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "A primary or metastatic malignant neoplasm that affects the colon or rectum. Representative examples include carcinoma, lymphoma, and sarcoma." }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "cancer of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, advanced, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer with chromosomal instability, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, somatic", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectal cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colorectum cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectal tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant colorectum neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large bowel tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine neoplasm", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumor", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant large intestine tumour", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of colorectum", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant neoplasm of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumor of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large bowel", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "malignant tumour of the large intestine", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "CRC", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "colon cancer, susceptibility to, autosomal dominant, somatic mutation", "description": "" }, { "id": "MONDO:0005575", "resource": "MONDO", "url": "https://monarchinitiative.org/disease/MONDO:0005575", "name": "large intestine cancer", "description": "" }, { "id": "MIM:114500", "resource": "MIM", "url": "https://www.omim.org/entry/114500", "name": "Colorectal cancer", "description": "Colorectal cancer" } ] } ] } ], "species": [ { "name": "Homo sapiens", "taxid": 9606, "evidence": [ { "database": "UniProtKB", "id": "O14495", "url": "https://www.uniprot.org/uniprot/O14495" } ], "common_name": "Human" } ], "gene": [ { "name": "PLPP3", "url": "https://www.uniprot.org/uniprot/O14495", "locus": { "chromosome": "1", "start_pos": 56494761, "end_pos": 56645301, "strand": "+", "evidence": [ { "database": "Ensembl Gene", "id": "ENSG00000162407", "url": "https://www.ensembl.org/id/ENSG00000162407" } ] } } ], "crossref": [ { "id": "ENSG00000162407", "url": "https://bgee.org/?page=gene&gene_id=ENSG00000162407", "database": "Bgee", "categories": [ "Gene Expression" ] }, { "id": "O14495", "url": "https://hive.biochemistry.gwu.edu/biomuta/proteinview/O14495", "database": "BioMuta", "categories": [ "Variation" ] }, { "id": "3.1.3.4", "url": "https://www.brenda-enzymes.org/enzyme.php?ecno=3.1.3.4&UniProtAcc=O14495", "database": "BRENDA", "categories": [ "Enzyme and Pathway" ] }, { "id": "cd03384", "url": "https://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=cd03384", "database": "CDD", "categories": [ "Protein Classification" ] }, { "id": "PLPP3", "url": "http://www.genecards.org/cgi-bin/carddisp.pl?gene=PLPP3", "database": "GeneCards", "categories": [ "Gene Annotation", "Organism-specific" ] }, { "id": "8613", "url": "https://www.ncbi.nlm.nih.gov/gene/8613", "database": "GeneID", "categories": [ "Genome Annotation" ] }, { "id": "9229", "url": "https://www.genenames.org/cgi-bin/gene_symbol_report?hgnc_id=9229", "database": "HGNC", "categories": [ "Organism-specific" ] }, { "id": "O14495", "url": "https://www.ebi.ac.uk/intact/interactors/id:O14495*", "database": "IntAct", "categories": [ "Other" ] }, { "id": "IPR000326", "url": "https://www.ebi.ac.uk/interpro/entry/IPR000326", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR036938", "url": "https://www.ebi.ac.uk/interpro/entry/IPR036938", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "IPR043216", "url": "https://www.ebi.ac.uk/interpro/entry/IPR043216", "database": "InterPro", "categories": [ "Protein Classification" ] }, { "id": "hsa:8613", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:8613", "database": "KEGG Pathway", "categories": [ "Enzyme and Pathway" ] }, { "id": "607125", "url": "http://www.omim.org/entry/607125", "database": "MIM", "categories": [ "Other" ] }, { "id": "NX_O14495", "url": "https://www.nextprot.org/entry/NX_O14495", "database": "neXtProt", "categories": [ "Protein", "Organism-specific" ] }, { "id": "O14495", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14495", "database": "O-GlcNAc Database", "categories": [ "Glycoproteomics" ] }, { "id": "YRIHYLH", "url": "https://omabrowser.org/oma/group/YRIHYLH/", "database": "OMA", "categories": [ "Protein Classification" ] }, { "id": "25293at2759", "url": "http://www.orthodb.org/?query=25293at2759", "database": "OrthoDB", "categories": [ "Protein Classification" ] }, { "id": "PTHR10165", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10165", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PTHR10165:SF79", "url": "http://www.pantherdb.org/panther/family.do?clsAccession=PTHR10165:SF79", "database": "PANTHER", "categories": [ "Protein Classification" ] }, { "id": "PF01569", "url": "http://pfam.xfam.org/family/PF01569", "database": "Pfam", "categories": [ "Protein Classification" ] }, { "id": "O14495", "url": "https://pharos.nih.gov/targets/O14495", "database": "PHAROS", "categories": [ "Organism-specific" ] }, { "id": "PR_O14495", "url": "http://purl.obolibrary.org/obo/PR_O14495", "database": "PRO", "categories": [ "Protein" ] }, { "id": "R-HSA-9845614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9845614", "database": "Reactome", "categories": [ "Protein Classification" ] }, { "id": "NP_003704", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003704", "database": "RefSeq", "categories": [ "Protein" ] }, { "id": "27429", "url": "https://www.rhea-db.org/rhea/27429", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "27518", "url": "https://www.rhea-db.org/rhea/27518", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "33743", "url": "https://www.rhea-db.org/rhea/33743", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "43236", "url": "https://www.rhea-db.org/rhea/43236", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "43244", "url": "https://www.rhea-db.org/rhea/43244", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "46736", "url": "https://www.rhea-db.org/rhea/46736", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "50884", "url": "https://www.rhea-db.org/rhea/50884", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "62040", "url": "https://www.rhea-db.org/rhea/62040", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "62160", "url": "https://www.rhea-db.org/rhea/62160", "database": "Rhea", "categories": [ "Enzyme and Pathway" ] }, { "id": "O14495", "url": "https://www.uniprot.org/uniprot/O14495", "database": "UniProtKB", "categories": [ "Protein" ] }, { "id": "O14495-1", "url": "https://www.uniprot.org/uniprot/O14495-1", "database": "UniProtKB", "categories": [ "Protein" ] } ], "sequence": { "sequence": "MQNYKYDKAIVPESKNGGSPALNNNPRRSGSKRVLLICLDLFCLFMAGLPFLIIETSTIKPYHRGFYCNDESIKYPLKTGETINDAVLCAVGIVIAILAIITGEFYRIYYLKKSRSTIQNPYVAALYKQVGCFLFGCAISQSFTDIAKVSIGRLRPHFLSVCNPDFSQINCSEGYIQNYRCRGDDSKVQEARKSFFSGHASFSMYTMLYLVLYLQARFTWRGARLLRPLLQFTLIMMAFYTGLSRVSDHKHHPSDVLAGFAQGALVACCIVFFVSDLFKTKTTLSLPAPAIRKEILSPVDIIDRNNHHNMM", "length": 311, "header": "sp|O14495-1|PLPP3_HUMAN Isoform 1 of Phospholipid phosphatase 3 OS=Homo sapiens OX=9606 GN=PLPP3 PE=1 SV=1 CANONICAL=O14495-1" }, "isoforms": [ { "isoform_ac": "O14495-1", "url": "", "sequence": { "sequence": "MQNYKYDKAIVPESKNGGSPALNNNPRRSGSKRVLLICLDLFCLFMAGLPFLIIETSTIKPYHRGFYCNDESIKYPLKTGETINDAVLCAVGIVIAILAIITGEFYRIYYLKKSRSTIQNPYVAALYKQVGCFLFGCAISQSFTDIAKVSIGRLRPHFLSVCNPDFSQINCSEGYIQNYRCRGDDSKVQEARKSFFSGHASFSMYTMLYLVLYLQARFTWRGARLLRPLLQFTLIMMAFYTGLSRVSDHKHHPSDVLAGFAQGALVACCIVFFVSDLFKTKTTLSLPAPAIRKEILSPVDIIDRNNHHNMM", "length": 311, "header": "sp|O14495-1|PLPP3_HUMAN Isoform 1 of Phospholipid phosphatase 3 OS=Homo sapiens OX=9606 GN=PLPP3 PE=1 SV=1 CANONICAL=O14495-1" }, "locus": { "chromosome": "1", "start_pos": 56579016, "end_pos": 56496554, "strand": "+", "evidence": [ { "database": "Ensembl Transcript", "id": "ENST00000371250.4", "url": "https://www.ensembl.org/id/ENST00000371250.4" }, { "database": "Ensembl Peptide", "id": "ENSP00000360296.3", "url": "https://www.ensembl.org/id/ENSP00000360296.3" } ] } } ], "glycosylation": [ { "glytoucan_ac": "", "type": "N-linked", "subtype": "", "site_category": "reported", "site_seq": "N", "relation": "attached", "comment": "N-linked (GlcNAc...) asparagine", "start_pos": 170, "start_aa": "Asn", "end_pos": 170, "end_aa": "Asn", "residue": "Asn", "site_lbl": "Asn170", "evidence": [ { "id": "O14495", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14495#ptm_processing" }, { "id": "24190977", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/24190977" }, { "id": "GLY_000143", "database": "GlyGen", "url": "https://data.glygen.org/GLY_000143" } ] }, { "glytoucan_ac": "G49108TO", "type": "O-linked", "subtype": "O-GlcNAcylation", "site_category": "reported_with_glycan", "site_seq": "", "relation": "attached", "comment": "O-GlcNAcylation", "evidence": [ { "id": "O14495", "database": "O-GlcNAc Database", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14495" }, { "id": "37217939", "database": "PubMed", "url": "https://glygen.org/publication/PubMed/37217939" } ] } ], "phosphorylation": [ { "start_pos": 110, "end_pos": 110, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Tyr", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O14495", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14495" }, { "database": "PubMed", "id": "17924679", "url": "https://glygen.org/publication/PubMed/17924679" } ], "site_lbl": "Tyr110" }, { "start_pos": 19, "end_pos": 19, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "Phosphoserine", "evidence": [ { "database": "UniProtKB", "id": "O14495", "url": "https://www.uniprot.org/uniprot/O14495" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" }, { "database": "iPTMnet", "id": "O14495", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14495" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" }, { "database": "phospho.ELM", "id": "O14495", "url": "http://phospho.elm.eu.org/byAccession/O14495.html" } ], "site_lbl": "Ser19" }, { "start_pos": 297, "end_pos": 297, "kinase_uniprot_canonical_ac": "", "kinase_gene_name": "", "residue": "Ser", "comment": "", "evidence": [ { "database": "iPTMnet", "id": "O14495", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14495" }, { "database": "PubMed", "id": "18578522", "url": "https://glygen.org/publication/PubMed/18578522" }, { "database": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" }, { "database": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" }, { "database": "PubMed", "id": "19664994", "url": "https://glygen.org/publication/PubMed/19664994" }, { "database": "phospho.ELM", "id": "O14495", "url": "http://phospho.elm.eu.org/byAccession/O14495.html" } ], "site_lbl": "Ser297" } ], "glycation": [], "keywords": [ "enzyme", "glycoprotein", "glycoprotein_reported", "glycoprotein_reported_with_glycan" ], "publication": [ { "title": "Human sphingosine-1-phosphate lyase: cDNA cloning, functional expression studies and mapping to chromosome 10q22(1).", "journal": "Biochimica et biophysica acta", "date": "2000", "authors": "Van Veldhoven PP, Gijsbers S, Mannaerts GP, Vermeesch JR, Brys V", "evidence": [ { "database": "Reactome", "id": "R-HSA-9845614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9845614" } ], "reference": [ { "type": "PubMed", "id": "11018465", "url": "https://glygen.org/publication/PubMed/11018465" } ] }, { "title": "Cloning and characterization of a novel human alkaline ceramidase. A mammalian enzyme that hydrolyzes phytoceramide.", "journal": "The Journal of biological chemistry", "date": "2001", "authors": "Mao C, Xu R, Szulc ZM, Bielawska A, Galadari SH, Obeid LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9845614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9845614" } ], "reference": [ { "type": "PubMed", "id": "11356846", "url": "https://glygen.org/publication/PubMed/11356846" } ] }, { "title": "Identification and characterization of a novel human sphingosine-1-phosphate phosphohydrolase, hSPP2.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Ogawa C, Kihara A, Gokoh M, Igarashi Y", "evidence": [ { "database": "Reactome", "id": "R-HSA-9845614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9845614" } ], "reference": [ { "type": "PubMed", "id": "12411432", "url": "https://glygen.org/publication/PubMed/12411432" } ] }, { "title": "Regulation of cell-cell interactions by phosphatidic acid phosphatase 2b/VCIP.", "journal": "The EMBO journal", "date": "2003-04-01", "authors": "Humtsoe Joseph O, Feng Shu, Thakker Geeta D, Yang Jun, Hong Jun, Wary Kishore K", "evidence": [ { "database": "UniProtKB", "id": "O14495", "url": "https://www.uniprot.org/uniprot/O14495" } ], "reference": [ { "type": "PubMed", "id": "12660161", "url": "https://glygen.org/publication/PubMed/12660161" } ] }, { "title": "Role of human sphingosine-1-phosphate phosphatase 1 in the regulation of intra- and extracellular sphingosine-1-phosphate levels and cell viability.", "journal": "The Journal of biological chemistry", "date": "2003", "authors": "Johnson KR, Johnson KY, Becker KP, Bielawski J, Mao C, Obeid LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9845614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9845614" } ], "reference": [ { "type": "PubMed", "id": "12815058", "url": "https://glygen.org/publication/PubMed/12815058" } ] }, { "title": "Differential localization of lipid phosphate phosphatases 1 and 3 to cell surface subdomains in polarized MDCK cells.", "journal": "FEBS Lett.", "date": "2003", "authors": "Jia Yan-Jun, Kai Masahiro, Wada Ikuo, Sakane Fumio, Kanoh Hideo", "evidence": [ { "database": "UniProtKB", "id": "O14495", "url": "https://www.uniprot.org/uniprot/O14495" } ], "reference": [ { "type": "PubMed", "id": "14527693", "url": "https://glygen.org/publication/PubMed/14527693" } ] }, { "title": "Lipid phosphate phosphatases dimerise, but this interaction is not required for in vivo activity.", "journal": "BMC Biochem.", "date": "2004", "authors": "Burnett C, Makridou P, Hewlett L, Howard K", "evidence": [ { "database": "UniProtKB", "id": "O14495", "url": "https://www.uniprot.org/uniprot/O14495" } ], "reference": [ { "type": "PubMed", "id": "14725715", "url": "https://glygen.org/publication/PubMed/14725715" } ] }, { "title": "Murine lipid phosphate phosphohydrolase-3 acts as a cell-associated integrin ligand.", "journal": "Biochemical and biophysical research communications", "date": "2005", "authors": "Humtsoe JO, Bowling RA Jr, Feng S, Wary KK", "evidence": [ { "database": "UniProtKB", "id": "O14495", "url": "https://www.uniprot.org/uniprot/O14495" } ], "reference": [ { "type": "PubMed", "id": "16099422", "url": "https://glygen.org/publication/PubMed/16099422" } ] }, { "title": "Sphingosine-1-phosphate phosphohydrolase regulates endoplasmic reticulum-to-golgi trafficking of ceramide.", "journal": "Molecular and cellular biology", "date": "2006", "authors": "Giussani P, Maceyka M, Le Stunff H, Mikami A, Lepine S, Wang E, Kelly S, Merrill AH Jr, Milstien S, Spiegel S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9845614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9845614" } ], "reference": [ { "type": "PubMed", "id": "16782891", "url": "https://glygen.org/publication/PubMed/16782891" } ] }, { "title": "Golgi alkaline ceramidase regulates cell proliferation and survival by controlling levels of sphingosine and S1P.", "journal": "FASEB journal : official publication of the Federation of American Societies for Experimental Biology", "date": "2006", "authors": "Xu R, Jin J, Hu W, Sun W, Bielawski J, Szulc Z, Taha T, Obeid LM, Mao C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9845614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9845614" } ], "reference": [ { "type": "PubMed", "id": "16940153", "url": "https://glygen.org/publication/PubMed/16940153" } ] }, { "title": "Lipid phosphate phosphatases 1 and 3 are localized in distinct lipid rafts.", "journal": "Journal of biochemistry", "date": "2006", "authors": "Kai M, Sakane F, Jia YJ, Imai S, Yasuda S, Kanoh H", "evidence": [ { "database": "UniProtKB", "id": "O14495", "url": "https://www.uniprot.org/uniprot/O14495" } ], "reference": [ { "type": "PubMed", "id": "17005594", "url": "https://glygen.org/publication/PubMed/17005594" } ] }, { "title": "Intracellular generation of sphingosine 1-phosphate in human lung endothelial cells: role of lipid phosphate phosphatase-1 and sphingosine kinase 1.", "journal": "The Journal of biological chemistry", "date": "2007-05-11", "authors": "Zhao Yutong, Kalari Satish K, Usatyuk Peter V, Gorshkova Irina, He Donghong, Watkins Tonya, Brindley David N, Sun Chaode, Bittman Robert, Garcia Joe G N, Berdyshev Evgeni V, Natarajan Viswanathan", "evidence": [ { "database": "Reactome", "id": "R-HSA-9845614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9845614" } ], "reference": [ { "type": "PubMed", "id": "17379599", "url": "https://glygen.org/publication/PubMed/17379599" } ] }, { "title": "Expression and initial characterization of human ALDH3B1.", "journal": "Biochemical and biophysical research communications", "date": "2007-05-11", "authors": "Marchitti Satori A, Orlicky David J, Vasiliou Vasilis", "evidence": [ { "database": "Reactome", "id": "R-HSA-9845614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9845614" } ], "reference": [ { "type": "PubMed", "id": "17382292", "url": "https://glygen.org/publication/PubMed/17382292" } ] }, { "title": "Upregulation of the human alkaline ceramidase 1 and acid ceramidase mediates calcium-induced differentiation of epidermal keratinocytes.", "journal": "The Journal of investigative dermatology", "date": "2008", "authors": "Sun W, Xu R, Hu W, Jin J, Crellin HA, Bielawski J, Szulc ZM, Thiers BH, Obeid LM, Mao C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9845614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9845614" } ], "reference": [ { "type": "PubMed", "id": "17713573", "url": "https://glygen.org/publication/PubMed/17713573" } ] }, { "title": "Improved titanium dioxide enrichment of phosphopeptides from HeLa cells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.", "journal": "Journal of proteome research", "date": "2007", "authors": "Yu LR, Zhu Z, Chan KC, Issaq HJ, Dimitrov DS, Veenstra TD", "evidence": [ { "database": "iPTMnet", "id": "O14495", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14495" } ], "reference": [ { "type": "PubMed", "id": "17924679", "url": "https://glygen.org/publication/PubMed/17924679" } ] }, { "title": "Lipid phosphate phosphatases form homo- and hetero-oligomers: catalytic competency, subcellular distribution and function.", "journal": "Biochem. J.", "date": "2008", "authors": "Long JS, Pyne NJ, Pyne S", "evidence": [ { "database": "UniProtKB", "id": "O14495", "url": "https://www.uniprot.org/uniprot/O14495" } ], "reference": [ { "type": "PubMed", "id": "18215144", "url": "https://glygen.org/publication/PubMed/18215144" } ] }, { "title": "Sphingosine-1-phosphate lyase in development and disease: sphingolipid metabolism takes flight.", "journal": "Biochimica et biophysica acta", "date": "2008", "authors": "Fyrst H, Saba JD", "evidence": [ { "database": "Reactome", "id": "R-HSA-9845614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9845614" } ], "reference": [ { "type": "PubMed", "id": "18558101", "url": "https://glygen.org/publication/PubMed/18558101" } ] }, { "title": "TiO(2)-based phosphoproteomic analysis of the plasma membrane and the effects of phosphatase inhibitor treatment.", "journal": "Journal of proteome research", "date": "2008", "authors": "Thingholm TE, Larsen MR, Ingrell CR, Kassem M, Jensen ON", "evidence": [ { "database": "iPTMnet", "id": "O14495", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14495" } ], "reference": [ { "type": "PubMed", "id": "18578522", "url": "https://glygen.org/publication/PubMed/18578522" } ] }, { "title": "Ceramidases: regulators of cellular responses mediated by ceramide, sphingosine, and sphingosine-1-phosphate.", "journal": "Biochimica et biophysica acta", "date": "2008", "authors": "Mao C, Obeid LM", "evidence": [ { "database": "Reactome", "id": "R-HSA-9845614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9845614" } ], "reference": [ { "type": "PubMed", "id": "18619555", "url": "https://glygen.org/publication/PubMed/18619555" } ] }, { "title": "A quantitative atlas of mitotic phosphorylation.", "journal": "Proceedings of the National Academy of Sciences of the United States of America", "date": "2008", "authors": "Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP", "evidence": [ { "database": "iPTMnet", "id": "O14495", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14495" } ], "reference": [ { "type": "PubMed", "id": "18669648", "url": "https://glygen.org/publication/PubMed/18669648" } ] }, { "title": "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.", "journal": "Molecular cell", "date": "2008", "authors": "Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M", "evidence": [ { "database": "UniProtKB", "id": "O14495", "url": "https://www.uniprot.org/uniprot/O14495" }, { "database": "iPTMnet", "id": "O14495", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14495" } ], "reference": [ { "type": "PubMed", "id": "18691976", "url": "https://glygen.org/publication/PubMed/18691976" } ] }, { "title": "Phosphoproteomic analysis of human embryonic stem cells.", "journal": "Cell stem cell", "date": "2009", "authors": "Brill LM, Xiong W, Lee KB, Ficarro SB, Crain A, Xu Y, Terskikh A, Snyder EY, Ding S", "evidence": [ { "database": "iPTMnet", "id": "O14495", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14495" } ], "reference": [ { "type": "PubMed", "id": "19664994", "url": "https://glygen.org/publication/PubMed/19664994" } ] }, { "title": "Phosphorylation dynamics during early differentiation of human embryonic stem cells.", "journal": "Cell stem cell", "date": "2009", "authors": "Van Hoof D, Munoz J, Braam SR, Pinkse MW, Linding R, Heck AJ, Mummery CL, Krijgsveld J", "evidence": [ { "database": "iPTMnet", "id": "O14495", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14495" } ], "reference": [ { "type": "PubMed", "id": "19664995", "url": "https://glygen.org/publication/PubMed/19664995" } ] }, { "title": "Alkaline ceramidase 3 (ACER3) hydrolyzes unsaturated long-chain ceramides, and its down-regulation inhibits both cell proliferation and apoptosis.", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Hu W, Xu R, Sun W, Szulc ZM, Bielawski J, Obeid LM, Mao C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9845614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9845614" } ], "reference": [ { "type": "PubMed", "id": "20068046", "url": "https://glygen.org/publication/PubMed/20068046" } ] }, { "title": "Substrate specificity, membrane topology, and activity regulation of human alkaline ceramidase 2 (ACER2).", "journal": "The Journal of biological chemistry", "date": "2010", "authors": "Sun W, Jin J, Xu R, Hu W, Szulc ZM, Bielawski J, Obeid LM, Mao C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9845614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9845614" } ], "reference": [ { "type": "PubMed", "id": "20089856", "url": "https://glygen.org/publication/PubMed/20089856" } ] }, { "title": "Lipid phosphate phosphatase 3 stabilization of beta-catenin induces endothelial cell migration and formation of branching point structures.", "journal": "Molecular and cellular biology", "date": "2010-04", "authors": "Humtsoe Joseph O, Liu Mingyao, Malik Asrar B, Wary Kishore K", "evidence": [ { "database": "UniProtKB", "id": "O14495", "url": "https://www.uniprot.org/uniprot/O14495" } ], "reference": [ { "type": "PubMed", "id": "20123964", "url": "https://glygen.org/publication/PubMed/20123964" } ] }, { "title": "Molecular characterization, expression analysis, and role of ALDH3B1 in the cellular protection against oxidative stress.", "journal": "Free radical biology & medicine", "date": "2010", "authors": "Marchitti SA, Brocker C, Orlicky DJ, Vasiliou V", "evidence": [ { "database": "Reactome", "id": "R-HSA-9845614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9845614" } ], "reference": [ { "type": "PubMed", "id": "20699116", "url": "https://glygen.org/publication/PubMed/20699116" } ] }, { "title": "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.", "journal": "Science signaling", "date": "2011", "authors": "Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B", "evidence": [ { "database": "UniProtKB", "id": "O14495", "url": "https://www.uniprot.org/uniprot/O14495" }, { "database": "iPTMnet", "id": "O14495", "url": "http://research.bioinformatics.udel.edu/iptmnet/entry/O14495" } ], "reference": [ { "type": "PubMed", "id": "21406692", "url": "https://glygen.org/publication/PubMed/21406692" } ] }, { "title": "Lipid phosphate phosphatase-3 regulates tumor growth via \u03b2-catenin and CYCLIN-D1 signaling.", "journal": "Molecular cancer", "date": "2011-05-11", "authors": "Chatterjee Ishita, Humtsoe Joseph O, Kohler Erin E, Sorio Claudio, Wary Kishore K", "evidence": [ { "database": "UniProtKB", "id": "O14495", "url": "https://www.uniprot.org/uniprot/O14495" } ], "reference": [ { "type": "PubMed", "id": "21569306", "url": "https://glygen.org/publication/PubMed/21569306" } ] }, { "title": "Lipid phosphate phosphatase 3 participates in transport carrier formation and protein trafficking in the early secretory pathway.", "journal": "Journal of cell science", "date": "2013-06-15", "authors": "Guti\u00e9rrez-Mart\u00ednez Enric, Fern\u00e1ndez-Ulibarri In\u00e9s, L\u00e1zaro-Di\u00e9guez Francisco, Johannes Ludger, Pyne Susan, Sarri Elisabet, Egea Gustavo", "evidence": [ { "database": "UniProtKB", "id": "O14495", "url": "https://www.uniprot.org/uniprot/O14495" } ], "reference": [ { "type": "PubMed", "id": "23591818", "url": "https://glygen.org/publication/PubMed/23591818" } ] }, { "title": "Substrate specificity, plasma membrane localization, and lipid modification of the aldehyde dehydrogenase ALDH3B1.", "journal": "Biochimica et biophysica acta", "date": "2013", "authors": "Kitamura T, Naganuma T, Abe K, Nakahara K, Ohno Y, Kihara A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9845614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9845614" } ], "reference": [ { "type": "PubMed", "id": "23721920", "url": "https://glygen.org/publication/PubMed/23721920" } ] }, { "title": "N-linked glycosylation enrichment for in-depth cell surface proteomics of diffuse large B-cell lymphoma subtypes.", "journal": "Molecular & cellular proteomics : MCP", "date": "2014", "authors": "Deeb SJ, Cox J, Schmidt-Supprian M, Mann M", "evidence": [ { "database": "GlyGen", "id": "GLY_000143", "url": "https://data.glygen.org/GLY_000143" } ], "reference": [ { "type": "PubMed", "id": "24190977", "url": "https://glygen.org/publication/PubMed/24190977" } ] }, { "title": "Mouse aldehyde dehydrogenase ALDH3B2 is localized to lipid droplets via two C-terminal tryptophan residues and lipid modification.", "journal": "The Biochemical journal", "date": "2015", "authors": "Kitamura T, Takagi S, Naganuma T, Kihara A", "evidence": [ { "database": "Reactome", "id": "R-HSA-9845614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9845614" } ], "reference": [ { "type": "PubMed", "id": "25286108", "url": "https://glygen.org/publication/PubMed/25286108" } ] }, { "title": "Alkaline ceramidase 1 is essential for mammalian skin homeostasis and regulating whole-body energy expenditure.", "journal": "The Journal of pathology", "date": "2016-07", "authors": "Liakath-Ali Kifayathullah, Vancollie Valerie E, Lelliott Christopher J, Speak Anneliese O, Lafont David, Protheroe Hayley J, Ingvorsen Camilla, Galli Antonella, Green Angela, Gleeson Diane, Ryder Ed, Glover Leanne, Vizcay-Barrena Gema, Karp Natasha A, Arends Mark J, Brenn Thomas, Spiegel Sarah, Adams David J, Watt Fiona M, van der Weyden Louise", "evidence": [ { "database": "Reactome", "id": "R-HSA-9845614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9845614" } ], "reference": [ { "type": "PubMed", "id": "27126290", "url": "https://glygen.org/publication/PubMed/27126290" } ] }, { "title": "Role of lipid phosphate phosphatase 3 in human aortic endothelial cell function.", "journal": "Cardiovascular research", "date": "2016", "authors": "Touat-Hamici Z, Weidmann H, Blum Y, Proust C, Durand H, Iannacci F, Codoni V, Gaignard P, Therond P, Civelek M, Karabina SA, Lusis AJ, Cambien F, Ninio E", "evidence": [ { "database": "UniProtKB", "id": "O14495", "url": "https://www.uniprot.org/uniprot/O14495" } ], "reference": [ { "type": "PubMed", "id": "27694435", "url": "https://glygen.org/publication/PubMed/27694435" } ] }, { "title": "Tumor suppressor p53 links ceramide metabolism to DNA damage response through alkaline ceramidase 2.", "journal": "Cell death and differentiation", "date": "2018", "authors": "Xu R, Garcia-Barros M, Wen S, Li F, Lin CL, Hannun YA, Obeid LM, Mao C", "evidence": [ { "database": "Reactome", "id": "R-HSA-9845614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9845614" } ], "reference": [ { "type": "PubMed", "id": "29229990", "url": "https://glygen.org/publication/PubMed/29229990" } ] }, { "title": "DNA methylation of a PLPP3 MIR transposon-based enhancer promotes an osteogenic programme in calcific aortic valve disease.", "journal": "Cardiovascular research", "date": "2018", "authors": "Mkannez G, Gagne-Ouellet V, Jalloul Nsaibia M, Boulanger MC, Rosa M, Argaud D, Hadji F, Gaudreault N, Rheaume G, Bouchard L, Bosse Y, Mathieu P", "evidence": [ { "database": "RefSeq", "id": "NP_003704", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003704" } ], "reference": [ { "type": "PubMed", "id": "29726894", "url": "https://glygen.org/publication/PubMed/29726894" } ] }, { "title": "Nephrotic syndrome and adrenal insufficiency caused by a variant in SGPL1.", "journal": "Clinical kidney journal", "date": "2018", "authors": "Linhares ND, Arantes RR, Araujo SA, Pena SDJ", "evidence": [ { "database": "Reactome", "id": "R-HSA-9845614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9845614" } ], "reference": [ { "type": "PubMed", "id": "30090628", "url": "https://glygen.org/publication/PubMed/30090628" } ] }, { "title": "Structure of a human intramembrane ceramidase explains enzymatic dysfunction found in leukodystrophy.", "journal": "Nature communications", "date": "2018", "authors": "Vasiliauskaite-Brooks I, Healey RD, Rochaix P, Saint-Paul J, Sounier R, Grison C, Waltrich-Augusto T, Fortier M, Hoh F, Saied EM, Arenz C, Basu S, Leyrat C, Granier S", "evidence": [ { "database": "Reactome", "id": "R-HSA-9845614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9845614" } ], "reference": [ { "type": "PubMed", "id": "30575723", "url": "https://glygen.org/publication/PubMed/30575723" } ] }, { "title": "Fifty years of lyase and a moment of truth: sphingosine phosphate lyase from discovery to disease.", "journal": "Journal of lipid research", "date": "2019-03", "authors": "Saba Julie D", "evidence": [ { "database": "Reactome", "id": "R-HSA-9845614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9845614" } ], "reference": [ { "type": "PubMed", "id": "30635364", "url": "https://glygen.org/publication/PubMed/30635364" } ] }, { "title": "Regulation of PLPP3 gene expression by NF-kappaB family transcription factors.", "journal": "The Journal of biological chemistry", "date": "2019", "authors": "Mao G, Smyth SS, Morris AJ", "evidence": [ { "database": "RefSeq", "id": "NP_003704", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003704" } ], "reference": [ { "type": "PubMed", "id": "31362988", "url": "https://glygen.org/publication/PubMed/31362988" } ] }, { "title": "Roles for lysophosphatidic acid signaling in vascular development and disease.", "journal": "Biochimica et biophysica acta. Molecular and cell biology of lipids", "date": "2020", "authors": "Smyth SS, Kraemer M, Yang L, Van Hoose P, Morris AJ", "evidence": [ { "database": "RefSeq", "id": "NP_003704", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003704" } ], "reference": [ { "type": "PubMed", "id": "32376340", "url": "https://glygen.org/publication/PubMed/32376340" } ] }, { "title": "Autotaxin-LPA-LPP3 Axis in Energy Metabolism and Metabolic Disease.", "journal": "International journal of molecular sciences", "date": "2021", "authors": "Jose A, Kienesberger PC", "evidence": [ { "database": "RefSeq", "id": "NP_003704", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003704" } ], "reference": [ { "type": "PubMed", "id": "34502491", "url": "https://glygen.org/publication/PubMed/34502491" } ] }, { "title": "Lipid phosphate phosphatase 3 maintains NO-Mediated flow-mediated dilation in human adipose resistance arterioles.", "journal": "The Journal of physiology", "date": "2022-12-27", "authors": "Chabowski Dawid S, Hughes William E, Hockenberry Joseph C, LoGiudice John, Beyer Andreas M, Gutterman David D", "evidence": [ { "database": "RefSeq", "id": "NP_003704", "url": "https://www.ncbi.nlm.nih.gov/protein/NP_003704" } ], "reference": [ { "type": "PubMed", "id": "36575638", "url": "https://glygen.org/publication/PubMed/36575638" } ] }, { "title": "Extracellular arginine availability modulates eIF2\u03b1 O-GlcNAcylation and heme oxygenase 1 translation for cellular homeostasis.", "journal": "Journal of biomedical science", "date": "2023-05-22", "authors": "Hung Yu-Wen, Ouyang Ching, Ping Xiaoli, Qi Yue, Wang Yi-Chang, Kung Hsing-Jien, Ann David K", "evidence": [ { "database": "O-GlcNAc Database", "id": "O14495", "url": "https://www.oglcnac.mcw.edu/search/?query_protein=O14495" } ], "reference": [ { "type": "PubMed", "id": "37217939", "url": "https://glygen.org/publication/PubMed/37217939" } ] }, { "title": "Cloning and characterization of two human isozymes of Mg2+-independent phosphatidic acid phosphatase.", "journal": "J. Biol. Chem.", "date": "1997", "authors": "Kai M, Wada I, Imai Si, Sakane F, Kanoh H", "evidence": [ { "database": "UniProtKB", "id": "O14495", "url": "https://www.uniprot.org/uniprot/O14495" } ], "reference": [ { "type": "PubMed", "id": "9305923", "url": "https://glygen.org/publication/PubMed/9305923" } ] }, { "title": "Identification of a novel human phosphatidic acid phosphatase type 2 isoform.", "journal": "FEBS letters", "date": "1998", "authors": "Hooks SB, Ragan SP, Lynch KR", "evidence": [ { "database": "UniProtKB", "id": "O14495", "url": "https://www.uniprot.org/uniprot/O14495" } ], "reference": [ { "type": "PubMed", "id": "9607309", "url": "https://glygen.org/publication/PubMed/9607309" } ] }, { "title": "Human type 2 phosphatidic acid phosphohydrolases. Substrate specificity of the type 2a, 2b, and 2c enzymes and cell surface activity of the 2a isoform.", "journal": "The Journal of biological chemistry", "date": "1998", "authors": "Roberts R, Sciorra VA, Morris AJ", "evidence": [ { "database": "UniProtKB", "id": "O14495", "url": "https://www.uniprot.org/uniprot/O14495" }, { "database": "Reactome", "id": "R-HSA-9845614", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9845614" } ], "reference": [ { "type": "PubMed", "id": "9705349", "url": "https://glygen.org/publication/PubMed/9705349" } ] } ], "pathway": [ { "id": "hsa:8613", "name": "", "url": "https://www.genome.jp/dbget-bin/get_linkdb?-t+pathway+hsa:8613", "resource": "KEGG Pathway" }, { "id": "R-HSA-9845614", "name": "Sphingolipid catabolism", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-9845614", "resource": "Reactome", "description": "Sphingolipid catabolism" } ], "orthologs": [ { "uniprot_canonical_ac": "P97544-1", "protein_name": "Phospholipid phosphatase 3", "gene_name": "Plpp3", "tax_id": 10116, "organism": "Rattus norvegicus", "sequence": { "sequence": "MQSYKYDKAIVPESKNGGSPALNNNPRKGGSKRVLLICLDLFCLFMAALPFLIIETSTIKPYRRGFYCNDESIKYPLKVSETINDAVLCAVGIVIAILRIITGEFYRIYYLKEKSRSTIQNPYVAALYKQVGCFLFGCAISQSFTDIAKVSIGRLRPHFLSVCDPDFSQINCSEGYIQNYRCRGEDSKVQEARKSFFSGHASFSMFTMLYLVLYLQARFTWRGARLLRPLLQFTLLMMAFYTGLSRVSDYKHHPSDVLAGFAQGALVACCIVFFVSDLFKTKTTLSLPAPAIRREILSPVDIMDRSNHHNMV", "length": 312 }, "evidence": [ { "id": "45926585", "url": "http://www.informatics.jax.org/homology/45926585", "database": "MGI" } ], "common_name": "Rat" }, { "uniprot_canonical_ac": "Q99JY8-1", "protein_name": "Phospholipid phosphatase 3", "gene_name": "Plpp3", "tax_id": 10090, "organism": "Mus musculus", "sequence": { "sequence": "MQSYKYDKAIVPESKNGGSPALNNNPRKGGSKRVLLICLDLFCLFMAALPFLIIETSTIKPYRRGFYCNDESIKYPLKVSETINDAVLCAVGIVIAILAIITGEFYRIYYLKEKSRSTTQNPYVAALYKQVGCFLFGCAISQSFTDIAKVSIGRLRPHFLSVCDPDFSQINCSEGYIQNYRCRGEDSKVQEARKSFFSGHASFSMFTMLYLVLYLQARFTWRGARLLRPLLQFTLLMMAFYTGLSRVSDYKHHPSDVLAGFAQGALVACCIVFFVSDLFKTKTSLSLPAPAIRREILSPVDIIDRNNHHNMV", "length": 312 }, "evidence": [ { "id": "45926585", "url": "http://www.informatics.jax.org/homology/45926585", "database": "MGI" } ], "common_name": "Mouse" } ], "go_annotation": { "categories": [ { "name": "Biological Process", "total": 22, "go_terms": [ { "name": "positive regulation of cell-cell adhesion", "id": "GO:0022409", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0022409", "evidence": [ { "database": "UniProtKB", "id": "O14495", "url": "https://www.uniprot.org/uniprot/O14495" } ], "pmid": "" }, { "name": "homotypic cell-cell adhesion", "id": "GO:0034109", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0034109", "evidence": [ { "database": "UniProtKB", "id": "O14495", "url": "https://www.uniprot.org/uniprot/O14495" } ], "pmid": "" }, { "name": "sphingosine metabolic process", "id": "GO:0006670", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006670", "evidence": [ { "database": "UniProtKB", "id": "O14495", "url": "https://www.uniprot.org/uniprot/O14495" } ], "pmid": "" }, { "name": "signal transduction", "id": "GO:0007165", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007165", "evidence": [ { "database": "UniProtKB", "id": "O14495", "url": "https://www.uniprot.org/uniprot/O14495" } ], "pmid": "" }, { "name": "integrin-mediated signaling pathway", "id": "GO:0007229", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0007229", "evidence": [ { "database": "UniProtKB", "id": "O14495", "url": "https://www.uniprot.org/uniprot/O14495" } ], "pmid": "" }, { "name": "positive regulation of DNA-binding transcription factor activity", "id": "GO:0051091", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0051091", "evidence": [ { "database": "UniProtKB", "id": "O14495", "url": "https://www.uniprot.org/uniprot/O14495" } ], "pmid": "" }, { "name": "negative regulation of protein phosphorylation", "id": "GO:0001933", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001933", "evidence": [ { "database": "UniProtKB", "id": "O14495", "url": "https://www.uniprot.org/uniprot/O14495" } ], "pmid": "" }, { "name": "positive regulation of endothelial cell migration", "id": "GO:0010595", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0010595", "evidence": [ { "database": "UniProtKB", "id": "O14495", "url": "https://www.uniprot.org/uniprot/O14495" } ], "pmid": "" }, { "name": "sphingolipid biosynthetic process", "id": "GO:0030148", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030148", "evidence": [ { "database": "UniProtKB", "id": "O14495", "url": "https://www.uniprot.org/uniprot/O14495" } ], "pmid": "" }, { "name": "cell-cell adhesion mediated by integrin", "id": "GO:0033631", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033631", "evidence": [ { "database": "UniProtKB", "id": "O14495", "url": "https://www.uniprot.org/uniprot/O14495" } ], "pmid": "" }, { "name": "ceramide metabolic process", "id": "GO:0006672", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006672", "evidence": [ { "database": "UniProtKB", "id": "O14495", "url": "https://www.uniprot.org/uniprot/O14495" } ], "pmid": "" }, { "name": "protein stabilization", "id": "GO:0050821", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050821", "evidence": [ { "database": "UniProtKB", "id": "O14495", "url": "https://www.uniprot.org/uniprot/O14495" } ], "pmid": "" }, { "name": "blood vessel development", "id": "GO:0001568", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001568", "evidence": [ { "database": "UniProtKB", "id": "O14495", "url": "https://www.uniprot.org/uniprot/O14495" } ], "pmid": "" }, { "name": "positive regulation of peptidyl-tyrosine phosphorylation", "id": "GO:0050731", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0050731", "evidence": [ { "database": "UniProtKB", "id": "O14495", "url": "https://www.uniprot.org/uniprot/O14495" } ], "pmid": "" }, { "name": "Bergmann glial cell differentiation", "id": "GO:0060020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0060020", "evidence": [ { "database": "UniProtKB", "id": "O14495", "url": "https://www.uniprot.org/uniprot/O14495" } ], "pmid": "" }, { "name": "regulation of Wnt signaling pathway", "id": "GO:0030111", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0030111", "evidence": [ { "database": "UniProtKB", "id": "O14495", "url": "https://www.uniprot.org/uniprot/O14495" } ], "pmid": "" }, { "name": "gastrulation with mouth forming second", "id": "GO:0001702", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0001702", "evidence": [ { "database": "UniProtKB", "id": "O14495", "url": "https://www.uniprot.org/uniprot/O14495" } ], "pmid": "" }, { "name": "retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum", "id": "GO:0006890", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006890", "evidence": [ { "database": "UniProtKB", "id": "O14495", "url": "https://www.uniprot.org/uniprot/O14495" } ], "pmid": "" }, { "name": "phospholipid metabolic process", "id": "GO:0006644", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0006644", "evidence": [ { "database": "UniProtKB", "id": "O14495", "url": "https://www.uniprot.org/uniprot/O14495" } ], "pmid": "" }, { "name": "wound healing", "id": "GO:0042060", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042060", "evidence": [ { "database": "UniProtKB", "id": "O14495", "url": "https://www.uniprot.org/uniprot/O14495" } ], "pmid": "" }, { "name": "regulation of sphingolipid mediated signaling pathway", "id": "GO:1902068", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:1902068", "evidence": [ { "database": "UniProtKB", "id": "O14495", "url": "https://www.uniprot.org/uniprot/O14495" } ], "pmid": "" }, { "name": "phospholipid dephosphorylation", "id": "GO:0046839", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0046839", "evidence": [ { "database": "UniProtKB", "id": "O14495", "url": "https://www.uniprot.org/uniprot/O14495" } ], "pmid": "" } ] }, { "name": "Cellular Component", "total": 11, "go_terms": [ { "name": "Golgi membrane", "id": "GO:0000139", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0000139", "evidence": [ { "database": "UniProtKB", "id": "O14495", "url": "https://www.uniprot.org/uniprot/O14495" } ], "pmid": "" }, { "name": "Golgi apparatus", "id": "GO:0005794", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005794", "evidence": [ { "database": "UniProtKB", "id": "O14495", "url": "https://www.uniprot.org/uniprot/O14495" } ], "pmid": "" }, { "name": "plasma membrane", "id": "GO:0005886", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005886", "evidence": [ { "database": "UniProtKB", "id": "O14495", "url": "https://www.uniprot.org/uniprot/O14495" } ], "pmid": "" }, { "name": "adherens junction", "id": "GO:0005912", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005912", "evidence": [ { "database": "UniProtKB", "id": "O14495", "url": "https://www.uniprot.org/uniprot/O14495" } ], "pmid": "" }, { "name": "membrane", "id": "GO:0016020", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016020", "evidence": [ { "database": "UniProtKB", "id": "O14495", "url": "https://www.uniprot.org/uniprot/O14495" } ], "pmid": "" }, { "name": "basolateral plasma membrane", "id": "GO:0016323", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0016323", "evidence": [ { "database": "UniProtKB", "id": "O14495", "url": "https://www.uniprot.org/uniprot/O14495" } ], "pmid": "" }, { "name": "membrane raft", "id": "GO:0045121", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0045121", "evidence": [ { "database": "UniProtKB", "id": "O14495", "url": "https://www.uniprot.org/uniprot/O14495" } ], "pmid": "" }, { "name": "endoplasmic reticulum membrane", "id": "GO:0005789", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005789", "evidence": [ { "database": "UniProtKB", "id": "O14495", "url": "https://www.uniprot.org/uniprot/O14495" } ], "pmid": "" }, { "name": "endoplasmic reticulum-Golgi intermediate compartment membrane", "id": "GO:0033116", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0033116", "evidence": [ { "database": "UniProtKB", "id": "O14495", "url": "https://www.uniprot.org/uniprot/O14495" } ], "pmid": "" }, { "name": "endoplasmic reticulum exit site", "id": "GO:0070971", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0070971", "evidence": [ { "database": "UniProtKB", "id": "O14495", "url": "https://www.uniprot.org/uniprot/O14495" } ], "pmid": "" }, { "name": "trans-Golgi network", "id": "GO:0005802", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005802", "evidence": [ { "database": "UniProtKB", "id": "O14495", "url": "https://www.uniprot.org/uniprot/O14495" } ], "pmid": "" } ] }, { "name": "Molecular Function", "total": 4, "go_terms": [ { "name": "integrin binding", "id": "GO:0005178", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0005178", "evidence": [ { "database": "UniProtKB", "id": "O14495", "url": "https://www.uniprot.org/uniprot/O14495" } ], "pmid": "" }, { "name": "phosphatidate phosphatase activity", "id": "GO:0008195", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0008195", "evidence": [ { "database": "UniProtKB", "id": "O14495", "url": "https://www.uniprot.org/uniprot/O14495" } ], "pmid": "" }, { "name": "sphingosine-1-phosphate phosphatase activity", "id": "GO:0042392", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0042392", "evidence": [ { "database": "UniProtKB", "id": "O14495", "url": "https://www.uniprot.org/uniprot/O14495" } ], "pmid": "" }, { "name": "ceramide-1-phosphate phosphatase activity", "id": "GO:0106235", "url": "https://www.ebi.ac.uk/QuickGO/term/GO:0106235", "evidence": [ { "database": "UniProtKB", "id": "O14495", "url": "https://www.uniprot.org/uniprot/O14495" } ], "pmid": "" } ] } ] }, "pro_annotation": [], "site_annotation": [ { "start_pos": 170, "end_pos": 172, "annotation": "n_glycosylation_sequon" } ], "ptm_annotation": [ { "annotation": "N-glycosylated (PubMed:9705349). Contains high-mannose oligosaccharides (PubMed:9705349).", "evidence": [ { "database": "UniProtKB", "id": "O14495", "url": "https://www.uniprot.org/uniprot/O14495" }, { "database": "PubMed", "id": "9705349", "url": "https://glygen.org/publication/PubMed/9705349" } ] } ], "interactions": [], "reactions": [ { "id": "27429", "name": "", "equation": "a 1,2-diacyl-sn-glycero-3-phosphate + H2O = a 1,2-diacyl-sn-glycerol + phosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O08564-1", "P97544-1", "Q8K593-1", "D3ZYB4-1", "F7FDH2-1", "A0A8I6AUU1-1", "Q92539-1", "Q14693-1", "Q9BQK8-1", "Q8NEB5-1", "O14494-1", "O14495-1", "O43688-1", "Q5VZY2-1", "Q91ZP3-1", "Q99PI4-1", "Q99PI5-1", "Q61469-1", "Q99JY8-1", "Q0VBU9-1", "Q3UMZ3-1", "Q9DAX2-1", "P53933-1", "P32567-1", "Q04396-1", "Q05521-1", "Q9V576-1", "Q8SXP0-1" ], "evidence": [ { "id": "27429", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/27429" } ] }, { "id": "27518", "name": "", "equation": "H2O + sphing-4-enine 1-phosphate = phosphate + sphing-4-enine", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "Q99P55-1", "O08564-1", "P97544-1", "Q8K593-1", "Q8IWX5-1", "Q9BX95-1", "O14494-1", "O14495-1", "O43688-1", "Q810K3-1", "Q9JI99-1", "Q61469-1", "Q99JY8-1", "Q9DAX2-1" ], "evidence": [ { "id": "27518", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/27518" } ] }, { "id": "33743", "name": "", "equation": "an N-acylsphing-4-enine 1-phosphate + H2O = an N-acylsphing-4-enine + phosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O08564-1", "P97544-1", "Q8K593-1", "O14494-1", "O14495-1", "O43688-1", "Q61469-1", "Q99JY8-1", "Q9DAX2-1" ], "evidence": [ { "id": "33743", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/33743" } ] }, { "id": "43236", "name": "", "equation": "1,2-dihexadecanoyl-sn-glycero-3-phosphate + H2O = 1,2-dihexadecanoyl-sn-glycerol + phosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O08564-1", "P97544-1", "Q8K593-1", "Q66H88-1", "Q14693-1", "O14494-1", "O14495-1", "O43688-1", "Q8IY26-1", "Q61469-1", "Q99JY8-1", "Q9DAX2-1", "Q91ZP3-1", "Q9D4F2-1" ], "evidence": [ { "id": "43236", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/43236" } ] }, { "id": "43244", "name": "", "equation": "1,2-di-(9Z-octadecenoyl)-sn-glycero-3-phosphate + H2O = 1,2-di-(9Z-octadecenoyl)-sn-glycerol + phosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O08564-1", "P97544-1", "Q8K593-1", "Q14693-1", "O14494-1", "O14495-1", "O43688-1", "Q61469-1", "Q99JY8-1", "Q9DAX2-1", "Q91ZP3-1", "P53933-1" ], "evidence": [ { "id": "43244", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/43244" } ] }, { "id": "46736", "name": "", "equation": "H2O + monoacyl-sn-glycero-3-phosphate = a monoacylglycerol + phosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O08564-1", "P97544-1", "Q8K593-1", "O14494-1", "O14495-1", "O43688-1", "Q61469-1", "Q99JY8-1", "Q9DAX2-1" ], "evidence": [ { "id": "46736", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/46736" } ] }, { "id": "50884", "name": "", "equation": "(9Z)-octadecenoyl-sn-glycero-3-phosphate + H2O = (9Z-octadecenoyl)-glycerol + phosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O08564-1", "P97544-1", "Q8K593-1", "O14494-1", "O14495-1", "O43688-1", "Q61469-1", "Q99JY8-1", "Q9DAX2-1" ], "evidence": [ { "id": "50884", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/50884" } ] }, { "id": "62040", "name": "", "equation": "H2O + N-(octanoyl)-sphing-4-enine-1-phosphate = N-octanoylsphing-4-enine + phosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O08564-1", "P97544-1", "Q8K593-1", "O14494-1", "O14495-1", "O43688-1", "Q61469-1", "Q99JY8-1", "Q9DAX2-1" ], "evidence": [ { "id": "62040", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/62040" } ] }, { "id": "62160", "name": "", "equation": "H2O + N-(9Z-octadecenoyl)-ethanolamine phosphate = N-(9Z-octadecenoyl) ethanolamine + phosphate", "summary": "", "cellular_location": "", "input_participant_list": [], "output_participant_list": [], "enzyme_list": [ "O08564-1", "P97544-1", "Q8K593-1", "O14494-1", "O14495-1", "O43688-1", "Q61469-1", "Q99JY8-1", "Q9DAX2-1" ], "evidence": [ { "id": "62160", "database": "Rhea", "url": "https://www.rhea-db.org/rhea/62160" } ] }, { "id": "R-HSA-428696", "name": "PLPP1,2,3 dephosphorylate cytosolic sphingosine-1-phosphate", "equation": "", "summary": "Phospholipid phosphatases 1 (PLPP1, PPAP2A, LPP1), 2 (PLPP2, LPP2, PPAP2C), and 3 (PLPP3, LPP3, PPAP2B) associated with the plasma membrane catalyze the hydrolysis of cytosolic sphingosine 1-phosphate to form sphingosine and orthophosphate (Roberts et al. 1998). PLPPs have roles in angiogenesis and cancer (reviewed by Tang et al., 2015; Tang & Brindley, 2020).", "cellular_location": "cytosol, plasma membrane", "input_participant_list": [ "R-ALL-428203" ], "output_participant_list": [], "enzyme_list": [ "O43688-1", "O14495-1", "O14494-1" ], "evidence": [ { "id": "R-HSA-428696", "database": "Reactome", "url": "https://www.reactome.org/PathwayBrowser/#R-HSA-428696" } ] } ], "reaction_participants": [ { "participant_id": "R-ALL-428203", "participant_name": "C18-S1P [cytosol]", "crossref": [ { "id": "000008860500", "database": "ZINC", "url": "" }, { "id": "60119", "database": "ChEBI", "url": "" }, { "id": "60119", "database": "ChEBI", "url": "" }, { "id": "000008860500", "database": "ZINC", "url": "" }, { "id": "60119", "database": "ChEBI", "url": "" }, { "id": "000008860500", "database": "ZINC", "url": "" }, { "id": "000008860500", "database": "ZINC", "url": "" }, { "id": "60119", "database": "ChEBI", "url": "" }, { "id": "60119", "database": "ChEBI", "url": "" }, { "id": "000008860500", "database": "ZINC", "url": "" }, { "id": "000008860500", "database": "ZINC", "url": "" }, { "id": "60119", "database": "ChEBI", "url": "" }, { "id": "000008860500", "database": "ZINC", "url": "" }, { "id": "60119", "database": "ChEBI", "url": "" } ] } ], "reaction_enzymes": [ { "uniprot_ac": "A0A8I6AUU1", "gene_name": "Lpin3", "activity": [ { "ec_number": "3.1.3.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphate + H2O = 1-O-alkyl-2-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "A0A8I6AUU1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6AUU1" } ] }, { "ec_number": "3.1.3.4", "activity": "", "evidence": [ { "id": "A0A8I6AUU1", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/A0A8I6AUU1" } ] } ] }, { "uniprot_ac": "D3ZYB4", "gene_name": "Lpin2", "activity": [ { "ec_number": "3.1.3.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphate + H2O = 1-O-alkyl-2-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "D3ZYB4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZYB4" } ] }, { "ec_number": "3.1.3.4", "activity": "", "evidence": [ { "id": "D3ZYB4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/D3ZYB4" } ] } ] }, { "uniprot_ac": "F7FDH2", "gene_name": "Lpin1", "activity": [ { "ec_number": "3.1.3.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphate + H2O = 1-O-alkyl-2-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "F7FDH2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F7FDH2" } ] }, { "ec_number": "3.1.3.4", "activity": "", "evidence": [ { "id": "F7FDH2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/F7FDH2" } ] } ] }, { "uniprot_ac": "O08564", "gene_name": "Plpp1", "activity": [ { "ec_number": "3.1.3.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphate + H2O = 1-O-alkyl-2-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "O08564", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08564" } ] }, { "ec_number": "3.1.3.106", "activity": "a 1-acyl-sn-glycero-3-phosphate + H2O = a 1-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "O08564", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08564" } ] }, { "ec_number": "3.6.1.75", "activity": "a 1,2-diacyl-sn-glycerol 3-diphosphate + H2O = a 1,2-diacyl-sn-glycero-3-phosphate + H(+) + phosphate.", "evidence": [ { "id": "O08564", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08564" } ] }, { "ec_number": "3.6.1.75", "activity": "", "evidence": [ { "id": "O08564", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08564" } ] }, { "ec_number": "3.1.3.4", "activity": "", "evidence": [ { "id": "O08564", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08564" } ] }, { "ec_number": "3.1.3.106", "activity": "", "evidence": [ { "id": "O08564", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08564" } ] }, { "ec_number": "3.1.3.-", "activity": "", "evidence": [ { "id": "O08564", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O08564" } ] } ] }, { "uniprot_ac": "O14494", "gene_name": "PLPP1", "activity": [ { "ec_number": "3.1.3.-", "activity": "", "evidence": [ { "id": "O14494", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14494" } ] }, { "ec_number": "3.1.3.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphate + H2O = 1-O-alkyl-2-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "O14494", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14494" } ] }, { "ec_number": "3.1.3.106", "activity": "a 1-acyl-sn-glycero-3-phosphate + H2O = a 1-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "O14494", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14494" } ] }, { "ec_number": "3.6.1.75", "activity": "a 1,2-diacyl-sn-glycerol 3-diphosphate + H2O = a 1,2-diacyl-sn-glycero-3-phosphate + H(+) + phosphate.", "evidence": [ { "id": "O14494", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14494" } ] }, { "ec_number": "3.1.3.4", "activity": "", "evidence": [ { "id": "O14494", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14494" } ] }, { "ec_number": "3.6.1.75", "activity": "", "evidence": [ { "id": "O14494", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14494" } ] }, { "ec_number": "3.1.3.106", "activity": "", "evidence": [ { "id": "O14494", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14494" } ] } ] }, { "uniprot_ac": "O14495", "gene_name": "PLPP3", "activity": [ { "ec_number": "3.1.3.-", "activity": "", "evidence": [ { "id": "O14495", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14495" } ] }, { "ec_number": "3.1.3.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphate + H2O = 1-O-alkyl-2-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "O14495", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14495" } ] }, { "ec_number": "3.1.3.4", "activity": "", "evidence": [ { "id": "O14495", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O14495" } ] } ] }, { "uniprot_ac": "O43688", "gene_name": "PLPP2", "activity": [ { "ec_number": "3.1.3.-", "activity": "", "evidence": [ { "id": "O43688", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43688" } ] }, { "ec_number": "3.1.3.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphate + H2O = 1-O-alkyl-2-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "O43688", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43688" } ] }, { "ec_number": "3.1.3.4", "activity": "", "evidence": [ { "id": "O43688", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/O43688" } ] } ] }, { "uniprot_ac": "P32567", "gene_name": "PAH1", "activity": [ { "ec_number": "3.1.3.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphate + H2O = 1-O-alkyl-2-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "P32567", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32567" } ] }, { "ec_number": "3.1.3.4", "activity": "", "evidence": [ { "id": "P32567", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P32567" } ] } ] }, { "uniprot_ac": "P53933", "gene_name": "APP1", "activity": [ { "ec_number": "3.1.3.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphate + H2O = 1-O-alkyl-2-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "P53933", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53933" } ] }, { "ec_number": "3.1.3.4", "activity": "", "evidence": [ { "id": "P53933", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P53933" } ] } ] }, { "uniprot_ac": "P97544", "gene_name": "Plpp3", "activity": [ { "ec_number": "3.1.3.-", "activity": "", "evidence": [ { "id": "P97544", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97544" } ] }, { "ec_number": "3.1.3.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphate + H2O = 1-O-alkyl-2-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "P97544", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97544" } ] }, { "ec_number": "3.1.3.4", "activity": "", "evidence": [ { "id": "P97544", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/P97544" } ] } ] }, { "uniprot_ac": "Q04396", "gene_name": "LPP1", "activity": [ { "ec_number": "3.1.3.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphate + H2O = 1-O-alkyl-2-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "Q04396", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04396" } ] }, { "ec_number": "3.1.3.106", "activity": "a 1-acyl-sn-glycero-3-phosphate + H2O = a 1-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "Q04396", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04396" } ] }, { "ec_number": "3.6.1.75", "activity": "a 1,2-diacyl-sn-glycerol 3-diphosphate + H2O = a 1,2-diacyl-sn-glycero-3-phosphate + H(+) + phosphate.", "evidence": [ { "id": "Q04396", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04396" } ] }, { "ec_number": "3.6.1.75", "activity": "", "evidence": [ { "id": "Q04396", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q04396" } ] } ] }, { "uniprot_ac": "Q05521", "gene_name": "DPP1", "activity": [ { "ec_number": "3.1.3.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphate + H2O = 1-O-alkyl-2-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "Q05521", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05521" } ] }, { "ec_number": "3.1.3.106", "activity": "a 1-acyl-sn-glycero-3-phosphate + H2O = a 1-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "Q05521", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05521" } ] }, { "ec_number": "3.6.1.75", "activity": "a 1,2-diacyl-sn-glycerol 3-diphosphate + H2O = a 1,2-diacyl-sn-glycero-3-phosphate + H(+) + phosphate.", "evidence": [ { "id": "Q05521", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05521" } ] }, { "ec_number": "3.6.1.75", "activity": "", "evidence": [ { "id": "Q05521", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q05521" } ] } ] }, { "uniprot_ac": "Q0VBU9", "gene_name": "Plpp4", "activity": [ { "ec_number": "3.1.3.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphate + H2O = 1-O-alkyl-2-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "Q0VBU9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q0VBU9" } ] }, { "ec_number": "3.6.1.75", "activity": "a 1,2-diacyl-sn-glycerol 3-diphosphate + H2O = a 1,2-diacyl-sn-glycero-3-phosphate + H(+) + phosphate.", "evidence": [ { "id": "Q0VBU9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q0VBU9" } ] }, { "ec_number": "3.6.1.75", "activity": "", "evidence": [ { "id": "Q0VBU9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q0VBU9" } ] }, { "ec_number": "3.1.3.4", "activity": "", "evidence": [ { "id": "Q0VBU9", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q0VBU9" } ] } ] }, { "uniprot_ac": "Q14693", "gene_name": "LPIN1", "activity": [ { "ec_number": "3.1.3.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphate + H2O = 1-O-alkyl-2-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "Q14693", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q14693" } ] }, { "ec_number": "3.1.3.4", "activity": "", "evidence": [ { "id": "Q14693", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q14693" } ] } ] }, { "uniprot_ac": "Q3UMZ3", "gene_name": "Plpp5", "activity": [ { "ec_number": "3.1.3.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphate + H2O = 1-O-alkyl-2-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "Q3UMZ3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UMZ3" } ] }, { "ec_number": "3.6.1.75", "activity": "a 1,2-diacyl-sn-glycerol 3-diphosphate + H2O = a 1,2-diacyl-sn-glycero-3-phosphate + H(+) + phosphate.", "evidence": [ { "id": "Q3UMZ3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UMZ3" } ] }, { "ec_number": "3.6.1.75", "activity": "", "evidence": [ { "id": "Q3UMZ3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UMZ3" } ] }, { "ec_number": "3.1.3.4", "activity": "", "evidence": [ { "id": "Q3UMZ3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q3UMZ3" } ] } ] }, { "uniprot_ac": "Q5VZY2", "gene_name": "PLPP4", "activity": [ { "ec_number": "3.1.3.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphate + H2O = 1-O-alkyl-2-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "Q5VZY2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5VZY2" } ] }, { "ec_number": "3.6.1.75", "activity": "a 1,2-diacyl-sn-glycerol 3-diphosphate + H2O = a 1,2-diacyl-sn-glycero-3-phosphate + H(+) + phosphate.", "evidence": [ { "id": "Q5VZY2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5VZY2" } ] }, { "ec_number": "3.6.1.75", "activity": "", "evidence": [ { "id": "Q5VZY2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5VZY2" } ] }, { "ec_number": "3.1.3.4", "activity": "", "evidence": [ { "id": "Q5VZY2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q5VZY2" } ] } ] }, { "uniprot_ac": "Q61469", "gene_name": "Plpp1", "activity": [ { "ec_number": "3.1.3.-", "activity": "", "evidence": [ { "id": "Q61469", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61469" } ] }, { "ec_number": "3.1.3.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphate + H2O = 1-O-alkyl-2-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "Q61469", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61469" } ] }, { "ec_number": "3.1.3.106", "activity": "a 1-acyl-sn-glycero-3-phosphate + H2O = a 1-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "Q61469", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61469" } ] }, { "ec_number": "3.6.1.75", "activity": "a 1,2-diacyl-sn-glycerol 3-diphosphate + H2O = a 1,2-diacyl-sn-glycero-3-phosphate + H(+) + phosphate.", "evidence": [ { "id": "Q61469", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61469" } ] }, { "ec_number": "3.6.1.75", "activity": "", "evidence": [ { "id": "Q61469", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61469" } ] }, { "ec_number": "3.1.3.4", "activity": "", "evidence": [ { "id": "Q61469", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61469" } ] }, { "ec_number": "3.1.3.106", "activity": "", "evidence": [ { "id": "Q61469", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q61469" } ] } ] }, { "uniprot_ac": "Q66H88", "gene_name": "Plpp6", "activity": [ { "ec_number": "3.6.1.-", "activity": "", "evidence": [ { "id": "Q66H88", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q66H88" } ] }, { "ec_number": "3.1.3.-", "activity": "", "evidence": [ { "id": "Q66H88", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q66H88" } ] }, { "ec_number": "3.6.1.68", "activity": "(2E)-geranyl diphosphate + H2O = (2E)-geranyl phosphate + H(+) + phosphate.", "evidence": [ { "id": "Q66H88", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q66H88" } ] }, { "ec_number": "3.6.1.68", "activity": "", "evidence": [ { "id": "Q66H88", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q66H88" } ] } ] }, { "uniprot_ac": "Q810K3", "gene_name": "Sgpp2", "activity": [ { "ec_number": "3.1.3.-", "activity": "", "evidence": [ { "id": "Q810K3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q810K3" } ] } ] }, { "uniprot_ac": "Q8IWX5", "gene_name": "SGPP2", "activity": [ { "ec_number": "3.1.3.-", "activity": "", "evidence": [ { "id": "Q8IWX5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IWX5" } ] } ] }, { "uniprot_ac": "Q8IY26", "gene_name": "PLPP6", "activity": [ { "ec_number": "3.6.1.-", "activity": "", "evidence": [ { "id": "Q8IY26", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IY26" } ] }, { "ec_number": "3.1.3.-", "activity": "", "evidence": [ { "id": "Q8IY26", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IY26" } ] }, { "ec_number": "3.6.1.68", "activity": "(2E)-geranyl diphosphate + H2O = (2E)-geranyl phosphate + H(+) + phosphate.", "evidence": [ { "id": "Q8IY26", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IY26" } ] }, { "ec_number": "3.6.1.68", "activity": "", "evidence": [ { "id": "Q8IY26", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8IY26" } ] } ] }, { "uniprot_ac": "Q8K593", "gene_name": "Plpp2", "activity": [ { "ec_number": "3.1.3.-", "activity": "", "evidence": [ { "id": "Q8K593", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K593" } ] }, { "ec_number": "3.1.3.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphate + H2O = 1-O-alkyl-2-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "Q8K593", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K593" } ] }, { "ec_number": "3.1.3.4", "activity": "", "evidence": [ { "id": "Q8K593", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8K593" } ] } ] }, { "uniprot_ac": "Q8NEB5", "gene_name": "PLPP5", "activity": [ { "ec_number": "3.1.3.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphate + H2O = 1-O-alkyl-2-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "Q8NEB5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NEB5" } ] }, { "ec_number": "3.6.1.75", "activity": "a 1,2-diacyl-sn-glycerol 3-diphosphate + H2O = a 1,2-diacyl-sn-glycero-3-phosphate + H(+) + phosphate.", "evidence": [ { "id": "Q8NEB5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NEB5" } ] }, { "ec_number": "3.1.3.4", "activity": "", "evidence": [ { "id": "Q8NEB5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NEB5" } ] }, { "ec_number": "3.6.1.75", "activity": "", "evidence": [ { "id": "Q8NEB5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8NEB5" } ] } ] }, { "uniprot_ac": "Q8SXP0", "gene_name": "Lpin", "activity": [ { "ec_number": "3.1.3.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphate + H2O = 1-O-alkyl-2-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "Q8SXP0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8SXP0" } ] }, { "ec_number": "3.1.3.4", "activity": "", "evidence": [ { "id": "Q8SXP0", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q8SXP0" } ] } ] }, { "uniprot_ac": "Q91ZP3", "gene_name": "Lpin1", "activity": [ { "ec_number": "3.1.3.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphate + H2O = 1-O-alkyl-2-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "Q91ZP3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91ZP3" } ] }, { "ec_number": "3.1.3.4", "activity": "", "evidence": [ { "id": "Q91ZP3", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q91ZP3" } ] } ] }, { "uniprot_ac": "Q92539", "gene_name": "LPIN2", "activity": [ { "ec_number": "3.1.3.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphate + H2O = 1-O-alkyl-2-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "Q92539", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92539" } ] }, { "ec_number": "3.1.3.4", "activity": "", "evidence": [ { "id": "Q92539", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q92539" } ] } ] }, { "uniprot_ac": "Q99JY8", "gene_name": "Plpp3", "activity": [ { "ec_number": "3.1.3.-", "activity": "", "evidence": [ { "id": "Q99JY8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99JY8" } ] }, { "ec_number": "3.1.3.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphate + H2O = 1-O-alkyl-2-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "Q99JY8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99JY8" } ] }, { "ec_number": "3.1.3.4", "activity": "", "evidence": [ { "id": "Q99JY8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99JY8" } ] } ] }, { "uniprot_ac": "Q99P55", "gene_name": "Sgpp1", "activity": [ { "ec_number": "3.1.3.-", "activity": "", "evidence": [ { "id": "Q99P55", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99P55" } ] } ] }, { "uniprot_ac": "Q99PI4", "gene_name": "Lpin3", "activity": [ { "ec_number": "3.1.3.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphate + H2O = 1-O-alkyl-2-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "Q99PI4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99PI4" } ] }, { "ec_number": "3.1.3.4", "activity": "", "evidence": [ { "id": "Q99PI4", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99PI4" } ] } ] }, { "uniprot_ac": "Q99PI5", "gene_name": "Lpin2", "activity": [ { "ec_number": "3.1.3.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphate + H2O = 1-O-alkyl-2-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "Q99PI5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99PI5" } ] }, { "ec_number": "3.1.3.4", "activity": "", "evidence": [ { "id": "Q99PI5", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q99PI5" } ] } ] }, { "uniprot_ac": "Q9BQK8", "gene_name": "LPIN3", "activity": [ { "ec_number": "3.1.3.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphate + H2O = 1-O-alkyl-2-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "Q9BQK8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BQK8" } ] }, { "ec_number": "3.1.3.4", "activity": "", "evidence": [ { "id": "Q9BQK8", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BQK8" } ] } ] }, { "uniprot_ac": "Q9BX95", "gene_name": "SGPP1", "activity": [ { "ec_number": "3.1.3.-", "activity": "", "evidence": [ { "id": "Q9BX95", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9BX95" } ] } ] }, { "uniprot_ac": "Q9D4F2", "gene_name": "Plpp6", "activity": [ { "ec_number": "3.6.1.-", "activity": "", "evidence": [ { "id": "Q9D4F2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D4F2" } ] }, { "ec_number": "3.1.3.-", "activity": "", "evidence": [ { "id": "Q9D4F2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D4F2" } ] }, { "ec_number": "3.6.1.68", "activity": "(2E)-geranyl diphosphate + H2O = (2E)-geranyl phosphate + H(+) + phosphate.", "evidence": [ { "id": "Q9D4F2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D4F2" } ] }, { "ec_number": "3.6.1.68", "activity": "", "evidence": [ { "id": "Q9D4F2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9D4F2" } ] } ] }, { "uniprot_ac": "Q9DAX2", "gene_name": "Plpp2", "activity": [ { "ec_number": "3.1.3.-", "activity": "", "evidence": [ { "id": "Q9DAX2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DAX2" } ] }, { "ec_number": "3.1.3.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphate + H2O = 1-O-alkyl-2-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "Q9DAX2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DAX2" } ] }, { "ec_number": "3.1.3.4", "activity": "", "evidence": [ { "id": "Q9DAX2", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9DAX2" } ] } ] }, { "uniprot_ac": "Q9JI99", "gene_name": "Sgpp1", "activity": [ { "ec_number": "3.1.3.-", "activity": "", "evidence": [ { "id": "Q9JI99", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9JI99" } ] } ] }, { "uniprot_ac": "Q9V576", "gene_name": "wun", "activity": [ { "ec_number": "3.1.3.4", "activity": "1-O-alkyl-2-acyl-sn-glycero-3-phosphate + H2O = 1-O-alkyl-2-acyl-sn-glycerol + phosphate.", "evidence": [ { "id": "Q9V576", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9V576" } ] }, { "ec_number": "3.1.3.4", "activity": "", "evidence": [ { "id": "Q9V576", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9V576" } ] }, { "ec_number": "3.1.3.-", "activity": "", "evidence": [ { "id": "Q9V576", "database": "UniProtKB", "url": "https://www.uniprot.org/uniprot/Q9V576" } ] } ] } ], "biomarkers": [], "synthesized_glycans": [], "cluster_types": [ { "name": "homologset.mgi", "label": "MGI Homologs" } ], "sequence_features": { "n_linked_sites": [ 170 ], "o_linked_sites": [], "snv_sites": [ 25, 70, 86, 153, 172, 311 ], "glycation_sites": [], "phosphorylation_sites": [ 19, 110, 297 ], "sequon_annotation_sites": [ { "start_pos": 170, "end_pos": 172 } ] }, "section_stats": [ { "table_id": "glycosylation", "table_stats": [ { "field": "total", "count": 2 }, { "field": "total_sites", "count": 2 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 1 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_reported_with_glycan", "table_stats": [ { "field": "total", "count": 1 }, { "field": "total_sites", "count": 1 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 1 }, { "field": "o_linked_glycan_sites", "count": 1 } ], "sort_fields": [ "glytoucan_ac", "type", "subtype", "site_category", "site_seq", "relation", "comment", "start_pos", "start_aa", "end_pos", "end_aa", "residue", "site_lbl" ] }, { "table_id": "glycosylation_predicted", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "glycosylation_automatic_literature_mining", "table_stats": [ { "field": "total", "count": 0 }, { "field": "total_sites", "count": 0 }, { "field": "n_linked_glycans", "count": 0 }, { "field": "n_linked_glycan_sites", "count": 0 }, { "field": "o_linked_glycans", "count": 0 }, { "field": "o_linked_glycan_sites", "count": 0 } ], "sort_fields": [] }, { "table_id": "phosphorylation", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "kinase_uniprot_canonical_ac", "kinase_gene_name", "residue", "comment", "site_lbl" ] }, { "table_id": "snv", "table_stats": [ { "field": "total", "count": 8 }, { "field": "total_sites", "count": 6 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_disease", "table_stats": [ { "field": "total", "count": 3 }, { "field": "total_sites", "count": 3 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "snv_non_disease", "table_stats": [ { "field": "total", "count": 5 }, { "field": "total_sites", "count": 4 } ], "sort_fields": [ "start_pos", "end_pos", "subjects_tested", "subjects_positive", "frequency", "sequence_org", "sequence_mut", "comment", "chr_id", "chr_pos", "ref_nt", "alt_nt", "minor_allelic_frequency", "site_lbl" ] }, { "table_id": "publication", "table_stats": [ { "field": "total", "count": 48 } ], "sort_fields": [ "title", "journal", "date", "authors" ] } ] }